BYKdb

Annotate results for A0A1D9FX10

A0A1D9FX10 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D9FX10
DOMAINtad7/155IDLDLSQYLLLLKRRWLPAVAIFLFTVISAAWSTLFLKPSYEAEGKLLFKIDRTAFLTGL
GEEIDQLRPLVDAQNPLSTEVEVIYSHPLLQQIIDQLNLTDNEGLPLEPEALKKKLTVKI
VGGTDVVRLSYKGKNSEKGAAVINKLMRL
DOMAINcd537/727TSSVSKEGKSTVSANLAAAMAQLGRRVLLIDSDMRHPCQHYIWQVMNVAGLSQVLIGEVP
LELAICKAMENLDVLTAGVMPPNPLALLDSKQMASLIQECSTQYDFVIIDAPPLLLTADA
LCLSPMTDGMLLVARPGVLDFANANVAKQMLDSSGQTVLGLVANGVIQKDESIGYFYQSQ
EYFHYGSVRRL
SITEWalker A544/546GKS
SITEWalker A'564/571LLIDSDMR
SITEWalker B643/649VIIDAPP
SITEY Cluster711/721YFYQSQEYFHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MESRSSIDLDLSQYLLLLKRRWLPAVAIFLFTVISAAWSTLFLKPSYEAEGKLLFKIDRTAFLTGLGEEIDQLRPLVDAQ
      IDLDLSQYLLLLKRRWLPAVAIFLFTVISAAWSTLFLKPSYEAEGKLLFKIDRTAFLTGLGEEIDQLRPLVDAQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPLSTEVEVIYSHPLLQQIIDQLNLTDNEGLPLEPEALKKKLTVKIVGGTDVVRLSYKGKNSEKGAAVINKLMRLYIENQ
NPLSTEVEVIYSHPLLQQIIDQLNLTDNEGLPLEPEALKKKLTVKIVGGTDVVRLSYKGKNSEKGAAVINKLMRL     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILSKKSEAAKAREFITNQLPQSEANVRQAEAALRQFKERNQVVSLTEEARSLVAVMADLDSQITTVQAQLEEANAQAAGL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNQVGLNPQQAIAISALSQSTSVQGVLQELQEVERQLAVSKNRYGKNHPVMIRLTKQQRSLRGHLQQQIDQILGSQSLAG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQIQITEGLLEVDELKQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLNELKVAENQDTANARIIEPAIVPKKPLGDKKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTLKEVKQLLRYPVLGVI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVFKHKKLSRRRDDLFFGGELPVTEQPHSMVSEVYRMIQANLKFLRSDHPLKVIVVTSSVSKEGKSTVSANLAAAMAQLG
                                                        TSSVSKEGKSTVSANLAAAMAQLG
                                                               GKS              
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRVLLIDSDMRHPCQHYIWQVMNVAGLSQVLIGEVPLELAICKAMENLDVLTAGVMPPNPLALLDSKQMASLIQECSTQY
RRVLLIDSDMRHPCQHYIWQVMNVAGLSQVLIGEVPLELAICKAMENLDVLTAGVMPPNPLALLDSKQMASLIQECSTQY
   LLIDSDMR                                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DFVIIDAPPLLLTADALCLSPMTDGMLLVARPGVLDFANANVAKQMLDSSGQTVLGLVANGVIQKDESIGYFYQSQEYFH
DFVIIDAPPLLLTADALCLSPMTDGMLLVARPGVLDFANANVAKQMLDSSGQTVLGLVANGVIQKDESIGYFYQSQEYFH
  VIIDAPP                                                             YFYQSQEYFH
       730       740   
....:....|....:....|...
YGSVRRLAQRQAQTKKTSNVSRR
YGSVRRL                
Y                      

© 1998-2020Legal notice