BYKdb

Annotate results for A0A1D9FJN5

A0A1D9FJN5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D9FJN5
DOMAINcd42/232TSSGPGEGKTTTTANLAVTMAQLGAKVLVMDADLRKPAVHKAFQLSNSEGVTNILVKDLN
YKEFLLKTEVEGLEVLPSGAIPPNPSELLASQKMKNFIHSLREDYDYILIDTPPAAIVTD
AALLSTAVDGVILVCAAGEVAIQGAQRAKELLDNVNANIIGVVLNKIPIGKKGSSYYSYY
YYSSYYGEEEP
SITEWalker A49/51GKT
SITEWalker A'69/76LVMDADLR
SITEWalker B149/155ILIDTPP
SITE-146/-148YDY
SITEY Cluster217/227YYSYYYYSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKERKIITHSNPKSPISEAYRTLRTNIQFASLDNPIKVLMVTSSGPGEGKTTTTANLAVTMAQLGAKVLVMDADLRKPAV
                                         TSSGPGEGKTTTTANLAVTMAQLGAKVLVMDADLRKPAV
                                                GKT                 LVMDADLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKAFQLSNSEGVTNILVKDLNYKEFLLKTEVEGLEVLPSGAIPPNPSELLASQKMKNFIHSLREDYDYILIDTPPAAIVT
HKAFQLSNSEGVTNILVKDLNYKEFLLKTEVEGLEVLPSGAIPPNPSELLASQKMKNFIHSLREDYDYILIDTPPAAIVT
                                                                    ILIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAALLSTAVDGVILVCAAGEVAIQGAQRAKELLDNVNANIIGVVLNKIPIGKKGSSYYSYYYYSSYYGEEEPVKNKKNKR
DAALLSTAVDGVILVCAAGEVAIQGAQRAKELLDNVNANIIGVVLNKIPIGKKGSSYYSYYYYSSYYGEEEP        
                                                        YYSYYYYSSYY             
     
....:
MKQHG


© 1998-2020Legal notice