BYKdb

Annotate results for A0A1D9D2E6

A0A1D9D2E6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D9D2E6
DOMAINtad18/269DEIDLMALLLALLRGWKTILFFAILGLLIGILYSRYVNPTYKSEALIQIDEKSSGISALG
GDISELIGAEDSKAQAEAELIRSRMILEPVINSLHLRIHLADPEVGAIDRIVNDRTNTAI
HTPEGVSLTTTDGQASISQFNVSQGYLNQSFTLTRSETGFTLSNELDEFKGQLNKPHQFK
GTDGQIQITVNDLPDNSHAVSLTKQSLQKTTNTINSALSVVEKGKQTGIIELSMTGNNQQ
QTSLILKEIVLS
DOMAINcd548/734TGESPGVGKSFISSNLTEVFSQLDKKVLIIDADMRLGELHRMFDMTPDNGLGDYLAQQIE
LAKVIHPTSIDNIDFMPRGQHPKNPSSLLSGDKFEQMMTELNEHYDYIIIDSPPILAASD
AMIMSHYADKVLMVTRYDQSVEGQVAYAIKQMHKADIQVDGIVLNDVQQGLMSKYSYHYS
YAYGNNS
SITEWalker A555/557GKS
SITEWalker A'575/582LIIDADMR
SITEWalker B655/661IIIDSPP
SITE-652/-654YDY
SITEY Cluster722/730YSYHYSYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIDSQNSAKTAVEKEDDEIDLMALLLALLRGWKTILFFAILGLLIGILYSRYVNPTYKSEALIQIDEKSSGISALGGDI
                 DEIDLMALLLALLRGWKTILFFAILGLLIGILYSRYVNPTYKSEALIQIDEKSSGISALGGDI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELIGAEDSKAQAEAELIRSRMILEPVINSLHLRIHLADPEVGAIDRIVNDRTNTAIHTPEGVSLTTTDGQASISQFNVS
SELIGAEDSKAQAEAELIRSRMILEPVINSLHLRIHLADPEVGAIDRIVNDRTNTAIHTPEGVSLTTTDGQASISQFNVS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGYLNQSFTLTRSETGFTLSNELDEFKGQLNKPHQFKGTDGQIQITVNDLPDNSHAVSLTKQSLQKTTNTINSALSVVEK
QGYLNQSFTLTRSETGFTLSNELDEFKGQLNKPHQFKGTDGQIQITVNDLPDNSHAVSLTKQSLQKTTNTINSALSVVEK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKQTGIIELSMTGNNQQQTSLILKEIVLSYVGQNQSRGTEDTTRTLEFMETQIPLLRKKLEDSEAVFNEFRTKYGTIDVS
GKQTGIIELSMTGNNQQQTSLILKEIVLS                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEAEILLAENSQIDTQLSELKLKKADLTTYYTDEHPLVIQINEQIAVLNARKQKIDNTIAGLPEVQREFLKLSQDTEINR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIYLNLLKNYQQLQIAKAGQTGFARIIDLPINTFDAIAPKKLQIMILALLLGGMLGTMLVLLKNLLRNVVKDPERLEAKT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVPVIATIPRSPLLTRLRKKNKSPNRLLAHVDNDSLSYEAIKSLRTNLMFGMPVVGKVGERAKVILITGESPGVGKSFIS
                                                                   TGESPGVGKSFIS
                                                                          GKS   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNLTEVFSQLDKKVLIIDADMRLGELHRMFDMTPDNGLGDYLAQQIELAKVIHPTSIDNIDFMPRGQHPKNPSSLLSGDK
SNLTEVFSQLDKKVLIIDADMRLGELHRMFDMTPDNGLGDYLAQQIELAKVIHPTSIDNIDFMPRGQHPKNPSSLLSGDK
              LIIDADMR                                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FEQMMTELNEHYDYIIIDSPPILAASDAMIMSHYADKVLMVTRYDQSVEGQVAYAIKQMHKADIQVDGIVLNDVQQGLMS
FEQMMTELNEHYDYIIIDSPPILAASDAMIMSHYADKVLMVTRYDQSVEGQVAYAIKQMHKADIQVDGIVLNDVQQGLMS
              IIIDSPP                                                           
       730    
....:....|....
KYSYHYSYAYGNNS
KYSYHYSYAYGNNS
 YSYHYSYAY    

© 1998-2020Legal notice