BYKdb

Annotate results for A0A1D8TTM0

A0A1D8TTM0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D8TTM0
DOMAINcd499/676SSATSGEGKTTVTLGLASALITLGFRVLVVDGDFRKAELSQRLGWDRYAMSEVPSTPVQI
RPGLDLLSLRPDEDKIAEFVARGSFEECLSAAQGSGHYDYILIDSAPVSLTSEAALMASV
VPNVLLVVWLGKSNRNPFRDTLEQLMRHRAQILGLVVNGVDTQPEGYLYGHKIAEVSS
SITEWalker A506/508GKT
SITEWalker A'526/533LVVDGDFR
SITEWalker B599/605ILIDSAP
SITE-596/-598YDY
SITE-629/-631GKS
SITEY Cluster665/667YLY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNRLIAIAIRHWKPVIGLNIVLSAIALYNASKVTEVWAARAKLIIPKSSSDLNANLGTLGDFRDRGVSFSQQVNPLNNLS


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIMTSNDTISQVWEFDPEKSLYPRLSGYKSLFDVSPEGESTIISLSAEGSTPELARQRTAALIEAFQQRLNELRLDDAVQ


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSQFMRKELEQAAENLRQTQAALVAFKASSNLVSAEDQTREMVTAINTLTTEQAQVLAQAQASKAQVETLSARLELNPQQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIRSLSLGENQDYQFFRQELSEVEALLTETQAKFTNENPQVQALLEQREELQNQIEGYIFQARAAQPGVNATIGQESAAL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRELILAESQTQAYYSQGKQIQTQIDQLGSILKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEPRADSKPSGPGRRPIALGTILASVFGSAAIVLFLESRNPLLSLQDLQAISIPVLRSIPPFKHLVLDVDPSFGTAIEFQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLASAVSMKPLKNRRLMISSATSGEGKTTVTLGLASALITLGFRVLVVDGDFRKAELSQRLGWDRYAMSEVPSTPVQIRP
                  SSATSGEGKTTVTLGLASALITLGFRVLVVDGDFRKAELSQRLGWDRYAMSEVPSTPVQIRP
                         GKT                 LVVDGDFR                           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLDLLSLRPDEDKIAEFVARGSFEECLSAAQGSGHYDYILIDSAPVSLTSEAALMASVVPNVLLVVWLGKSNRNPFRDTL
GLDLLSLRPDEDKIAEFVARGSFEECLSAAQGSGHYDYILIDSAPVSLTSEAALMASVVPNVLLVVWLGKSNRNPFRDTL
                                      ILIDSAP                                   
       650       660       670      
....:....|....:....|....:....|....:.
EQLMRHRAQILGLVVNGVDTQPEGYLYGHKIAEVSS
EQLMRHRAQILGLVVNGVDTQPEGYLYGHKIAEVSS
                        YLY         
© 1998-2020Legal notice