BYKdb

Annotate results for A0A1D8D4L1

A0A1D8D4L1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D8D4L1
DOMAINtad20/209KEITLAEIFQIIARRKIGIGIIVSLSLLVSILFYYSQTPEYRAVSVLMINQKNDSQGLVE
AVLGGGPAADSKMAQKDVELLQSLPVADMTVRALWNSSRRDSLEFFGYRPYISPIRRLVD
WIAPVKPLNASDRDIIENTPAFDTMMRFYAIKLSKRIKVEGSRDSSVLRVSVASPFSDEA
TFLSNMLCSV
DOMAINcd614/803SGCSIGEGKSTVSTNLALAWAIADKKTLLIDADLRRPSQHTILGKKRSPGLTDCLIDDGK
NDNDKYFQKTHVENLFLMTAGTPVPNPNELLGSEKMHLFLKKISDQFDRVVIDSPPIFIS
DAAQLVNEVDGVLITARLHYSSRAPLKQYASDNFLHSKIIGVAIIDKPRPSKTRYGYGEG
KYGYGRSGYG
SITEWalker A621/623GKS
SITEWalker A'641/648LLIDADLR
SITEWalker B723/729VVIDSPP
SITEY Cluster788/809YGYGEGKYGYGRSGYGRYSSVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDYKSHQAVTGNQVQVQDDKEITLAEIFQIIARRKIGIGIIVSLSLLVSILFYYSQTPEYRAVSVLMINQKNDSQGLVEA
                   KEITLAEIFQIIARRKIGIGIIVSLSLLVSILFYYSQTPEYRAVSVLMINQKNDSQGLVEA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGGGPAADSKMAQKDVELLQSLPVADMTVRALWNSSRRDSLEFFGYRPYISPIRRLVDWIAPVKPLNASDRDIIENTPA
VLGGGPAADSKMAQKDVELLQSLPVADMTVRALWNSSRRDSLEFFGYRPYISPIRRLVDWIAPVKPLNASDRDIIENTPA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDTMMRFYAIKLSKRIKVEGSRDSSVLRVSVASPFSDEATFLSNMLCSVYQKSDIQRNSEKYIQSNQFVAEMLQEQKDMM
FDTMMRFYAIKLSKRIKVEGSRDSSVLRVSVASPFSDEATFLSNMLCSV                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANADAALSKFMTENQMYEVSGNTGGLLAKLIEFEGRYNDIMAEYNIVSNSRNFLENQLTQADREMSDRIARNVNAQLGAI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDEIHSKESAYISLLREKTVDDPEVKGKKQELEQAKARYDQISRSKIAGQIEYIGKAQKYRYDLISEKLQLDQKLNTLKF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAGEYAKVKQKYDGQLAQLPEKEQNFVRLQRDRDVVSKTYLFLKEKLDETRILIGSEVGSVTMIGSAFKPFMPEKPELVK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NILAGLVIGIVLAGLFTYGAEMIYDTVNEEMQFFKSLGLNIWGVIPFINSSSDYSGTYHEAKRKIEKKSVMLLDIFKKKE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQINNPQSEVSGDIKNNPLMTDKLNSSFAESFRTLRTNLNFSRIDKPFKTILISGCSIGEGKSTVSTNLALAWAIADKKT
                                                     SGCSIGEGKSTVSTNLALAWAIADKKT
                                                            GKS                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDADLRRPSQHTILGKKRSPGLTDCLIDDGKNDNDKYFQKTHVENLFLMTAGTPVPNPNELLGSEKMHLFLKKISDQF
LLIDADLRRPSQHTILGKKRSPGLTDCLIDDGKNDNDKYFQKTHVENLFLMTAGTPVPNPNELLGSEKMHLFLKKISDQF
LLIDADLR                                                                        
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRVVIDSPPIFISDAAQLVNEVDGVLITARLHYSSRAPLKQYASDNFLHSKIIGVAIIDKPRPSKTRYGYGEGKYGYGRS
DRVVIDSPPIFISDAAQLVNEVDGVLITARLHYSSRAPLKQYASDNFLHSKIIGVAIIDKPRPSKTRYGYGEGKYGYGRS
  VVIDSPP                                                          YGYGEGKYGYGRS
       810   
....:....|...
GYGRYSSVYPEKL
GYG          
GYGRYSSVY    

© 1998-2020Legal notice