BYKdb

Annotate results for A0A1D8AWD4

A0A1D8AWD4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D8AWD4
DOMAINtad9/163DSATLGDFVGLLRLRKGLIFLVLGLVLLTTLGVTALLPKWYLSTAKISVQKPESEVKLFQ
AQSNTYYDPYFIQDQFRIIQAEKILYPVIESLGLNEILGKQLNDGVALPSAITYRYLISK
MLRVEAPRASSIIEIDVYARDQRLAADIANAIARV
DOMAINcd503/691LSSGPGEGKSTTLRQLALCMAAAGEKVLLIDSDVRRPTQHKLAGLSRDPGLTDIVLNKVP
WTAAVVRDKSGLIDFIPAGAAANNVTLGLLYATKLKALVEEFRGRYDKVLFDSPPIIGVS
DASVLASLADGIVLLIQHRRNPESMVQRAKQIIDGLKVPVIGVVLNQVPTGTGEDYSYYT
NNYSYYSHE
SITEWalker A510/512GKS
SITEWalker A'530/537LLIDSDVR
SITEWalker B611/617VLFDSPP
SITEY Cluster678/688YSYYTNNYSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTLPSTKDSATLGDFVGLLRLRKGLIFLVLGLVLLTTLGVTALLPKWYLSTAKISVQKPESEVKLFQAQSNTYYDPYFI
        DSATLGDFVGLLRLRKGLIFLVLGLVLLTTLGVTALLPKWYLSTAKISVQKPESEVKLFQAQSNTYYDPYFI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDQFRIIQAEKILYPVIESLGLNEILGKQLNDGVALPSAITYRYLISKMLRVEAPRASSIIEIDVYARDQRLAADIANAI
QDQFRIIQAEKILYPVIESLGLNEILGKQLNDGVALPSAITYRYLISKMLRVEAPRASSIIEIDVYARDQRLAADIANAI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARVYAEDRITLATSDQREGLAQLRKELDKQELAVTTQRDHVEKLRKELDIAGVDLSQRYSDMDIETLRQMQNSLIALRVD
ARV                                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIGRKTRWERFRNIPAADRRNLVNSELIQDTNIQNLLQAYLISDQTVTRLMARLGAAHPDLIAAIDNSAKIQQQLDSQLR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GYESSLEMAFKEAEARVTELERQLAQAKVDQILSARERMRPFEEATGKLDDEQRLLTTLKLTLRQREIDFQVPKKTIEIL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTAEPARFASRPNWPLNILFACVFGTILGVGAAVLLEYFDTSFRNVADVEGKLSLPVLGVIPHMAEAGELHDPSSPEGEP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YRVLQTNLNLALTAGKTSVLVVLSSGPGEGKSTTLRQLALCMAAAGEKVLLIDSDVRRPTQHKLAGLSRDPGLTDIVLNK
                      LSSGPGEGKSTTLRQLALCMAAAGEKVLLIDSDVRRPTQHKLAGLSRDPGLTDIVLNK
                             GKS                 LLIDSDVR                       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPWTAAVVRDKSGLIDFIPAGAAANNVTLGLLYATKLKALVEEFRGRYDKVLFDSPPIIGVSDASVLASLADGIVLLIQH
VPWTAAVVRDKSGLIDFIPAGAAANNVTLGLLYATKLKALVEEFRGRYDKVLFDSPPIIGVSDASVLASLADGIVLLIQH
                                                  VLFDSPP                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRNPESMVQRAKQIIDGLKVPVIGVVLNQVPTGTGEDYSYYTNNYSYYSHEKPVPGAAGAAGPNEARGSDRIEMRETREP
RRNPESMVQRAKQIIDGLKVPVIGVVLNQVPTGTGEDYSYYTNNYSYYSHE                             
                                     YSYYTNNYSYY                                
    
....
ERKR


© 1998-2020Legal notice