BYKdb

Annotate results for A0A1D8AAH4

A0A1D8AAH4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D8AAH4
DOMAINtad1/136MITLTIAATILALLPRTYTATSTLLLEPRQAEPVKINDRGFVAPADDNLIDTAVQVVRSL
ALTLDVVRQLGLARTREFGGKIDTAASAAERERRTAEILLAQSHVRRVGVTYLVEISVSS
TDPVNAARIANALAGR
DOMAINcd483/671TSALPREGKSTTSMCLARTLAIGKQRVVLVDADVRHHSTSDALLPGRNAEGLFRVLDGTI
RIDEALVREDRTGLHILPTLGQRSSEDQITEDAMARLIAGLREGFDIIIIDSAPVLGVAE
TRMVSRLSDKTLVIARWRRTPEKAVRTTLDLLAQGGGKVGGVALSLVNIKEFASAGLTDA
FGYHKKFKG
SITEWalker A490/492GKS
SITEWalker A'510/517VLVDADVR
SITEWalker B590/596IIIDSAP
SITEY Cluster672/673YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MITLTIAATILALLPRTYTATSTLLLEPRQAEPVKINDRGFVAPADDNLIDTAVQVVRSLALTLDVVRQLGLARTREFGG
MITLTIAATILALLPRTYTATSTLLLEPRQAEPVKINDRGFVAPADDNLIDTAVQVVRSLALTLDVVRQLGLARTREFGG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIDTAASAAERERRTAEILLAQSHVRRVGVTYLVEISVSSTDPVNAARIANALAGRYIQLDSTKKQLRNSQSARYVEGQA
KIDTAASAAERERRTAEILLAQSHVRRVGVTYLVEISVSSTDPVNAARIANALAGR                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STLQRQAVADDAALQNYMIRNNLMSAQGATMAEQEVSELNRQIADSQAQLAEQRGKLSAAQTQIARGGGGADTGSALASE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVRQLRQQEAQASARLAQLDARYGALHPDVVEARDELADVRSQLGAELTRIISGLRGDVQIAESRLGSLLASRAQAKGSL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQNSSAQVGRLELERRAEASRAIYNAYLTREKETAQVGALPNADATIASVARVPDTPSSPRYLLGALAGLAAAAIAACLT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAVAEYLEDTVATCADIETGLGAVYAGAIPTLSSATRAKAESILPQDYVTMRPMSLFTESLRNLATYLGLTMSDGTAKVL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TITSALPREGKSTTSMCLARTLAIGKQRVVLVDADVRHHSTSDALLPGRNAEGLFRVLDGTIRIDEALVREDRTGLHILP
  TSALPREGKSTTSMCLARTLAIGKQRVVLVDADVRHHSTSDALLPGRNAEGLFRVLDGTIRIDEALVREDRTGLHILP
         GKS                 VLVDADVR                                           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLGQRSSEDQITEDAMARLIAGLREGFDIIIIDSAPVLGVAETRMVSRLSDKTLVIARWRRTPEKAVRTTLDLLAQGGGK
TLGQRSSEDQITEDAMARLIAGLREGFDIIIIDSAPVLGVAETRMVSRLSDKTLVIARWRRTPEKAVRTTLDLLAQGGGK
                             IIIDSAP                                            
       650       660       670     
....:....|....:....|....:....|....:
VGGVALSLVNIKEFASAGLTDAFGYHKKFKGYYVD
VGGVALSLVNIKEFASAGLTDAFGYHKKFKG    
                               YY  
© 1998-2020Legal notice