BYKdb

Annotate results for A0A1D8A5J9

A0A1D8A5J9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D8A5J9
DOMAINtad31/205LGIDLQRVVVLIRRNIVVIGAIVVGCLILGIIATLLRSPLYTTNSSVLVEDSAAPIIQNS
DLQPVNSASDTERFIQTQIEVISSRQLALQVVDRLKLADNEGLYENVGAGMPQLDDLPGR
PDKKALSKHRREAAATLLSKSLVVMSPADTRVINISFTSRSPAFSAEVADAFAEA
DOMAINcd546/737TSATESVGKSTTCQVVASDIASLGKRVLLIDADLRRPTAHKRIIDANEQGLTAILANVAS
FDQVVQRSGVEHLDVLTALPMNQQPSQLLAGPRLHLLMEEVRAKYDCVIVDCPPMLGLSD
SAMIANHVDAVLMVVSSDGFRRGAVKGALRRLNLVRAKVAGMVLTKFDPQSADGEYAYYG
YQYYSYGSHSES
SITEWalker A553/555GKS
SITEWalker A'573/580LLIDADLR
SITEWalker B653/659VIVDCPP
SITEY Cluster721/731YAYYGYQYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATVHPAEESQWEGEGHTRQGTAVVEENGILGIDLQRVVVLIRRNIVVIGAIVVGCLILGIIATLLRSPLYTTNSSVLVE
                              LGIDLQRVVVLIRRNIVVIGAIVVGCLILGIIATLLRSPLYTTNSSVLVE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSAAPIIQNSDLQPVNSASDTERFIQTQIEVISSRQLALQVVDRLKLADNEGLYENVGAGMPQLDDLPGRPDKKALSKHR
DSAAPIIQNSDLQPVNSASDTERFIQTQIEVISSRQLALQVVDRLKLADNEGLYENVGAGMPQLDDLPGRPDKKALSKHR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REAAATLLSKSLVVMSPADTRVINISFTSRSPAFSAEVADAFAEAFMQSGLDRKFQSSAYARTFLRDQLQDARVRLQQSE
REAAATLLSKSLVVMSPADTRVINISFTSRSPAFSAEVADAFAEA                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDLNRYASAAGLIRQSGVVDGNASESALSITNETLVQLNTALATATVERIAAQNRWESIANEKITNIPEVLGNTTVAQLL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDSASLEAQLAQERAKHLEDYPSVQALSAQVRELNGRIQAVGNSIKRSVGLNFEVAKQKEDTLKAQVAELQGAAIHEQDR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVQYQLLKRVADTNRATYDALLQRYNELSVSAGSLSNNISIIDRAKIPTQPSSPNLPLNILVSLLAGLGIAAIYVIVRDY


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDDTIRSPDDVEAKFGLPLLGLIPREADIDNAMSNSRSSLVESYRSLVTNMMYSLPGGLPQVLAVTSATESVGKSTTCQV
                                                                 TSATESVGKSTTCQV
                                                                        GKS     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VASDIASLGKRVLLIDADLRRPTAHKRIIDANEQGLTAILANVASFDQVVQRSGVEHLDVLTALPMNQQPSQLLAGPRLH
VASDIASLGKRVLLIDADLRRPTAHKRIIDANEQGLTAILANVASFDQVVQRSGVEHLDVLTALPMNQQPSQLLAGPRLH
            LLIDADLR                                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLMEEVRAKYDCVIVDCPPMLGLSDSAMIANHVDAVLMVVSSDGFRRGAVKGALRRLNLVRAKVAGMVLTKFDPQSADGE
LLMEEVRAKYDCVIVDCPPMLGLSDSAMIANHVDAVLMVVSSDGFRRGAVKGALRRLNLVRAKVAGMVLTKFDPQSADGE
            VIVDCPP                                                             
       730       
....:....|....:..
YAYYGYQYYSYGSHSES
YAYYGYQYYSYGSHSES
YAYYGYQYYSY      

© 1998-2020Legal notice