BYKdb

Annotate results for A0A1D7ZX45

A0A1D7ZX45 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D7ZX45
DOMAINcd43/232TSSGISEGKSTVTANVAIAWAQEGKRVLLIDADLRRSTLHATFGLSNQKGLTTILTGDSK
EVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLINGVREAYDIVVLDVPPMLQ
VTDTQVLSSNLDGVILVVRQGMTKKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYG
YGYDYEGGEG
SITEWalker A50/52GKS
SITEWalker A'70/77LLIDADLR
SITEWalker B153/159VVLDVPP
SITEY Cluster207/227YVMNDVYDDDAGYGYGYGYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNNGVMLIMLADPKSGPAEQFRTIRTNIHFMSVDRPLKTFAFTSSGISEGKSTVTANVAIAWAQEGKRVLLIDADLRRST
                                          TSSGISEGKSTVTANVAIAWAQEGKRVLLIDADLRRST
                                                 GKS                 LLIDADLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHATFGLSNQKGLTTILTGDSKEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLINGVREAYDIVVLDVPPM
LHATFGLSNQKGLTTILTGDSKEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLINGVREAYDIVVLDVPPM
                                                                        VVLDVPP 
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
LQVTDTQVLSSNLDGVILVVRQGMTKKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYDYEGGEG
LQVTDTQVLSSNLDGVILVVRQGMTKKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYDYEGGEG
                                              YVMNDVYDDDAGYGYGYGYDY     
© 1998-2020Legal notice