BYKdb

Annotate results for A0A1D7ZR49

A0A1D7ZR49 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D7ZR49
DOMAINtad1/253MLIRHAGRIAAVTAACTALGAGYALVAKPVYRADIAVQVESGGSDLRSMTEGGLVGSLGG
LFDVKSTDDGEMQILRSRLVTEPVVDSQNLHIEARPRRVPVIGPIVARFNRGVSTPGLLG
IGGFVWGSERIDISVFDVPRELQEHTFIVTSAGDGRYRLSGAGLDREAEGVTGEPLRVKT
AAGDVTLQVAGIEAEAGAQFVVKAESKQVALAALQKKLAIANRGKDQSGVIGVSYEGHDP
ARAAAVLNAIADN
DOMAINcd530/717TGPSEGVGKSFVSANVAALLGQANKRVLLIDGDLRRGELAKRFGIRPDIGLSTVLRGGVT
AFDAIVRDAAPNVDLLPAGPRAERPVELLSSDRFAAWLAHVARDYDVVLLDAPPLLPVTD
AVVLAEHADTILLVARSGETSAGELLESAKRIERVGARTTAVVFNGFRPGLRSAQYGNYG
AYAYNGAD
SITEWalker A537/539GKS
SITEWalker A'557/564LLIDGDLR
SITEWalker B637/643VLLDAPP
SITEY Cluster705/713YGNYGAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIRHAGRIAAVTAACTALGAGYALVAKPVYRADIAVQVESGGSDLRSMTEGGLVGSLGGLFDVKSTDDGEMQILRSRLV
MLIRHAGRIAAVTAACTALGAGYALVAKPVYRADIAVQVESGGSDLRSMTEGGLVGSLGGLFDVKSTDDGEMQILRSRLV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEPVVDSQNLHIEARPRRVPVIGPIVARFNRGVSTPGLLGIGGFVWGSERIDISVFDVPRELQEHTFIVTSAGDGRYRLS
TEPVVDSQNLHIEARPRRVPVIGPIVARFNRGVSTPGLLGIGGFVWGSERIDISVFDVPRELQEHTFIVTSAGDGRYRLS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAGLDREAEGVTGEPLRVKTAAGDVTLQVAGIEAEAGAQFVVKAESKQVALAALQKKLAIANRGKDQSGVIGVSYEGHDP
GAGLDREAEGVTGEPLRVKTAAGDVTLQVAGIEAEAGAQFVVKAESKQVALAALQKKLAIANRGKDQSGVIGVSYEGHDP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARAAAVLNAIADNYVRQNANRKAAAAEKSLAFLSDQLPTVERQLRAAEDRLNAYQARHEIVDLTEQAKAMVTQSATAQTT
ARAAAVLNAIADN                                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFELEQKRLALASTLTPAHPELAAVDRQIAAARAQVGTVNDAIRRLPDTQRNVVRLRRDVTVQTDIYVGLLSSIQQLHLA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TASKVGNVRVIDRAIVPDEPVRPKPALVTAIAALVGLVLGTCGVIGRAMLFGGLTDPVEIERDTNLNVIATIPQCTVRRR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAQPDAAGRGASILALEQPDEPAVEALRSLCTALRFQLMDRPDANRVLITGPSEGVGKSFVSANVAALLGQANKRVLLID
                                                 TGPSEGVGKSFVSANVAALLGQANKRVLLID
                                                        GKS                 LLID
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDLRRGELAKRFGIRPDIGLSTVLRGGVTAFDAIVRDAAPNVDLLPAGPRAERPVELLSSDRFAAWLAHVARDYDVVLLD
GDLRRGELAKRFGIRPDIGLSTVLRGGVTAFDAIVRDAAPNVDLLPAGPRAERPVELLSSDRFAAWLAHVARDYDVVLLD
GDLR                                                                        VLLD
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APPLLPVTDAVVLAEHADTILLVARSGETSAGELLESAKRIERVGARTTAVVFNGFRPGLRSAQYGNYGAYAYNGADPQT
APPLLPVTDAVVLAEHADTILLVARSGETSAGELLESAKRIERVGARTTAVVFNGFRPGLRSAQYGNYGAYAYNGAD   
APP                                                             YGNYGAYAY       
     
....:
AEDRT


© 1998-2020Legal notice