BYKdb

Annotate results for A0A1D7UM15

A0A1D7UM15 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D7UM15
DOMAINtad20/163NGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGA
SSNAGELSSGANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTM
LVDISVNNPDPKQASSIANSVAEN
DOMAINcd298/486TSAGPSEGKTTLSVNLATAFAENDSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVS
SHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMRALIEQVAEAYDYVIIDTAPMQVAND
AAVFAKEGPELLLVAGLGVTEKKLFRQTGRELSTLSIDPVGLAMNYGETEKPQKGGYYYY
GDESDDNGR
SITEWalker A305/307GKT
SITEWalker A'325/332LLIDADVR
SITEWalker B405/411VIIDTAP
SITE-402/-404YDY
SITEY Cluster474/477YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKEERSIAVDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGAS
                   NGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGAS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNAGELSSGANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNNPDPKQASSIANSV
SNAGELSSGANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNNPDPKQASSIANSV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AENLRKQVTSTIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTT
AEN                                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIDAPVLGSLSRNEAYVGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSAGPSEGKTTLSVNLATAFAEN
                                                         TSAGPSEGKTTLSVNLATAFAEN
                                                                GKT             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMRALIEQVAE
DSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMRALIEQVAE
    LLIDADVR                                                                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYDYVIIDTAPMQVANDAAVFAKEGPELLLVAGLGVTEKKLFRQTGRELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDE
AYDYVIIDTAPMQVANDAAVFAKEGPELLLVAGLGVTEKKLFRQTGRELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDE
    VIIDTAP                                                              YYYY   
       490       500 
....:....|....:....|.
SDDNGRKRQIQHKKSEKMKKD
SDDNGR               

© 1998-2020Legal notice