BYKdb

Annotate results for A0A1D7QRL4

A0A1D7QRL4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D7QRL4
DOMAINcd55/237TSSSPGEGKSTVAANLAVVLAQQDKKVLIIDGDLRKPTVHYTFRIPNKTGLSSVITGQAL
LDDVIIASQTERVHVLPSGPVPPNPSEMLSSNRMAMLLDEVKVNYDYIVLDTPPVNAVTD
AQILGKMCDGVILTLRSGVTETEEALDAKRALEATGAKILGAVLNDLAVEQSKYHYYYGA
ESS
SITEWalker A62/64GKS
SITEWalker A'82/89LIIDGDLR
SITEWalker B162/168IVLDTPP
SITE-159/-161YDY
SITEY Cluster228/232YHYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGRKQKKRALKSITSKPQLITETDPRSPIAEQFKTLRTNIQFSSYDHALQTMVITSSSPGEGKSTVAANLAVVLAQQDKK
                                                      TSSSPGEGKSTVAANLAVVLAQQDKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIIDGDLRKPTVHYTFRIPNKTGLSSVITGQALLDDVIIASQTERVHVLPSGPVPPNPSEMLSSNRMAMLLDEVKVNYD
VLIIDGDLRKPTVHYTFRIPNKTGLSSVITGQALLDDVIIASQTERVHVLPSGPVPPNPSEMLSSNRMAMLLDEVKVNYD
 LIIDGDLR                                                                       
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
YIVLDTPPVNAVTDAQILGKMCDGVILTLRSGVTETEEALDAKRALEATGAKILGAVLNDLAVEQSKYHYYYGAESS
YIVLDTPPVNAVTDAQILGKMCDGVILTLRSGVTETEEALDAKRALEATGAKILGAVLNDLAVEQSKYHYYYGAESS
 IVLDTPP                                                           YHYYY     
© 1998-2020Legal notice