BYKdb

Annotate results for A0A1D7NH48

A0A1D7NH48 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D7NH48
DOMAINtad38/200IPPVLLQYWHTALRWRWVLAGIVTASLVIGLVVTLLMAPLFTARSQIEISRQQKNVTNVE
GLETTEAGRDLEFYATQYALLKAVSLAQRVEKTMNLAKKNEFFEAHGATPSDKGEDARRR
QAVELLLDNVAIEPIRTSRLVDIKYTSRSPELSASIANTWVSE
DOMAINcd539/728ISSQPNEGKSTSSLALATIIGRTGKSVLLVDGDLRSPSVHELVGKPNKGGFSNLLAGDND
VASHVLATDYRGMSVLPSGPLPPSPSELLSSDRLGEVLKMLLERFDHVIIDSPPVIGLTD
GPLIARATEGCLFVIEPGRSPVRGIRAALQRLRMVGGTVFGAIVTKIDINRQSYGYSYGY
GYGYGYGYGY
SITE-562/-564GKS
SITEWalker A'566/573LLVDGDLR
SITEWalker B646/652VIIDSPP
SITEY Cluster712/728YGYSYGYGYGYGYGYGY
SITEWalker A546/548GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTAQPIDPMPIGEPTRREPSPAELAMADAEREQDERLIPPVLLQYWHTALRWRWVLAGIVTASLVIGLVVTLLMAPLFTA
                                     IPPVLLQYWHTALRWRWVLAGIVTASLVIGLVVTLLMAPLFTA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSQIEISRQQKNVTNVEGLETTEAGRDLEFYATQYALLKAVSLAQRVEKTMNLAKKNEFFEAHGATPSDKGEDARRRQAV
RSQIEISRQQKNVTNVEGLETTEAGRDLEFYATQYALLKAVSLAQRVEKTMNLAKKNEFFEAHGATPSDKGEDARRRQAV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELLLDNVAIEPIRTSRLVDIKYTSRSPELSASIANTWVSEFIGASMDREFSSTADARRFLEQRLEVLRKRVEESERDVAN
ELLLDNVAIEPIRTSRLVDIKYTSRSPELSASIANTWVSE                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FATERGIVALAVTRDSEGKTETQRTLAAADLEAMNTALLQARQNRIAAESRLGGAADSSSDALSNSTISNLRQRRGEIAA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYAKMLIQFEPDYPAAQALKSQIDALDAAITRETSRVGSSRRQAFTEAAAQERELQSKVADLKDQFDQQQRDTIQYNIYV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
READTNRQLYDALLQRYKEIGVAGSVGASNIAIVDRAEVPGAPSAPSLPINLALALLIGVGLAAVTVIGLEQIDEGIRGP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADVWNLLQTPLLGNVPLVSGDPRDALQDPKSHLTEAYFSIRSALAFSTTHGLPRSLCVISSQPNEGKSTSSLALATIIGR
                                                          ISSQPNEGKSTSSLALATIIGR
                                                                 GKS            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGKSVLLVDGDLRSPSVHELVGKPNKGGFSNLLAGDNDVASHVLATDYRGMSVLPSGPLPPSPSELLSSDRLGEVLKMLL
TGKSVLLVDGDLRSPSVHELVGKPNKGGFSNLLAGDNDVASHVLATDYRGMSVLPSGPLPPSPSELLSSDRLGEVLKMLL
     LLVDGDLR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERFDHVIIDSPPVIGLTDGPLIARATEGCLFVIEPGRSPVRGIRAALQRLRMVGGTVFGAIVTKIDINRQSYGYSYGYGY
ERFDHVIIDSPPVIGLTDGPLIARATEGCLFVIEPGRSPVRGIRAALQRLRMVGGTVFGAIVTKIDINRQSYGYSYGYGY
     VIIDSPP                                                           YGYSYGYGY
       730       740 
....:....|....:....|.
GYGYGYGYGNNLKGSEGEAAA
GYGYGYGY             
GYGYGYGY             

© 1998-2020Legal notice