BYKdb

Annotate results for A0A1D3TRD1

A0A1D3TRD1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D3TRD1
DOMAINcd40/226TSCTPNEGKTEISFRLAVSMAEAGKKVMFIDADLRKSVLVGRYKVETSLKGLSHYLSGQE
SLDSIICTTSAENMQVIFSGQVPPNPAELLGNSRYQSMIAEFREMYDYIIIDTPPLGRVI
DAAVIAGQSDGAVLVIESNAISYKFAQKIVEQLEKSNCRILGAVLNKVEHKDKGIYGKYY
GKYYGQY
SITEWalker A47/49GKT
SITEWalker A'67/74MFIDADLR
SITEWalker B148/154IIIDTPP
SITE-145/-147YDY
SITEY Cluster215/226YGKYYGKYYGQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQNVKIDIDRKMDYLSNEAYKGLRTNILFCGSDIKVIAITSCTPNEGKTEISFRLAVSMAEAGKKVMFIDADLRKSVLVG
                                       TSCTPNEGKTEISFRLAVSMAEAGKKVMFIDADLRKSVLVG
                                              GKT                 MFIDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKVETSLKGLSHYLSGQESLDSIICTTSAENMQVIFSGQVPPNPAELLGNSRYQSMIAEFREMYDYIIIDTPPLGRVID
RYKVETSLKGLSHYLSGQESLDSIICTTSAENMQVIFSGQVPPNPAELLGNSRYQSMIAEFREMYDYIIIDTPPLGRVID
                                                                   IIIDTPP      
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
AAVIAGQSDGAVLVIESNAISYKFAQKIVEQLEKSNCRILGAVLNKVEHKDKGIYGKYYGKYYGQY
AAVIAGQSDGAVLVIESNAISYKFAQKIVEQLEKSNCRILGAVLNKVEHKDKGIYGKYYGKYYGQY
                                                      YGKYYGKYYGQY
© 1998-2020Legal notice