BYKdb

Annotate results for A0A1D3TRA1

A0A1D3TRA1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D3TRA1
DOMAINcd40/232TSCTPNEGKSSVSLKMAISMAEAGKNVLFIDADLRKSVLAGCYKLDKPLRGLSHFLSGQE
KFDEVVCVTEIENLHMVFSGPVPPNPAELLGNRKFELLLNELRKVYDYVIIDTPPLGYVI
DAAVVAEQCDGAIMVVESKAVSYKFAGKIKEQLERSNCKILGVVLNKVERRERGLYGRYY
GGYYGKYYGKYYG
SITEWalker A47/49GKS
SITEWalker A'67/74LFIDADLR
SITEWalker B148/154VIIDTPP
SITE-145/-147YDY
SITEY Cluster215/239YGRYYGGYYGKYYGKYYGKYYGKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQHISVGLEQKMDYYMSESFKSLRTNILFCGSENKVIAFTSCTPNEGKSSVSLKMAISMAEAGKNVLFIDADLRKSVLAG
                                       TSCTPNEGKSSVSLKMAISMAEAGKNVLFIDADLRKSVLAG
                                              GKS                 LFIDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CYKLDKPLRGLSHFLSGQEKFDEVVCVTEIENLHMVFSGPVPPNPAELLGNRKFELLLNELRKVYDYVIIDTPPLGYVID
CYKLDKPLRGLSHFLSGQEKFDEVVCVTEIENLHMVFSGPVPPNPAELLGNRKFELLLNELRKVYDYVIIDTPPLGYVID
                                                                   VIIDTPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVVAEQCDGAIMVVESKAVSYKFAGKIKEQLERSNCKILGVVLNKVERRERGLYGRYYGGYYGKYYGKYYGKYYGKYYG
AAVVAEQCDGAIMVVESKAVSYKFAGKIKEQLERSNCKILGVVLNKVERRERGLYGRYYGGYYGKYYGKYYG        
                                                      YGRYYGGYYGKYYGKYYGKYYGKYY 
       
....:..
HEENKDK


© 1998-2020Legal notice