BYKdb

Annotate results for A0A1D3JZN6

A0A1D3JZN6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D3JZN6
DOMAINcd288/478CGPSPGVGKTFVSANLAAVVAQSGQRVLLIDADMRKGYMHKMLGTTAEIGLSDLLVKRCQ
LQEATQKTDVELFDFIGRGQIPPNPSELLMHPNFAALLAEVSELYDLVIIDTPPLLAVTD
AAIVGRQSGTSLLVTRFGINSAKEVELTLRRFNQNGIELKGAIFNGVEKRRSASYGYGDY
GYYHYAYQSDK
SITEWalker A295/297GKT
SITEWalker A'315/322LLIDADMR
SITEWalker B395/401VIIDTPP
SITEY Cluster462/474YGYGDYGYYHYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRTLNEISSLYVRQNVDRTSAEAAQSLAFLNDQLPQVRRDLEKAESALNSFQTRSKSIDISLEAKAVLDQVVALDTGISE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKLQQAEMDRKFTRQHPAYRALLAKLDELTGKQAQLTKRIEGLPSTQQELLSLTRDVQVGTEIYTQLLNRSQELDVMRAG


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVGNVRLIDSADANISKPVEPRKVIVVLLAMLLGGMLSVGLVLMRSLLSRGLENPDDIEKLGLPVYASIPFSSLQKTEEI


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAFKGRSAVPSLLALNHPNDLVMEAMRSLRTSLHFAMLEAKDNRLMICGPSPGVGKTFVSANLAAVVAQSGQRVLLIDAD
                                               CGPSPGVGKTFVSANLAAVVAQSGQRVLLIDAD
                                                      GKT                 LLIDAD
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRKGYMHKMLGTTAEIGLSDLLVKRCQLQEATQKTDVELFDFIGRGQIPPNPSELLMHPNFAALLAEVSELYDLVIIDTP
MRKGYMHKMLGTTAEIGLSDLLVKRCQLQEATQKTDVELFDFIGRGQIPPNPSELLMHPNFAALLAEVSELYDLVIIDTP
MR                                                                        VIIDTP
       410       420       430       440       450       460       470         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
PLLAVTDAAIVGRQSGTSLLVTRFGINSAKEVELTLRRFNQNGIELKGAIFNGVEKRRSASYGYGDYGYYHYAYQSDKA
PLLAVTDAAIVGRQSGTSLLVTRFGINSAKEVELTLRRFNQNGIELKGAIFNGVEKRRSASYGYGDYGYYHYAYQSDK 
P                                                            YGYGDYGYYHYAY     
© 1998-2020Legal notice