BYKdb

Annotate results for A0A1D2YVY5

A0A1D2YVY5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D2YVY5
DOMAINcd61/242TSTGPGEGKSTIIANLAVVLAQQEKKVLLVDADMRKPTVHHTFRLPNLVGLTNVLVGNEV
LEDAIQETTVNNLNILTSGPIPPNPAELLGSNRMSQLVDEVSSTYDIVLFDAPPVIAVTD
AQVLSRIIDGVLLVVHSGKTHREMAIKSKELLENVRANVIGVVLNHKEVKGENYYYYYYG
EN
SITE-198/-200GKT
SITEWalker A'88/95LLVDADMR
SITEWalker B168/174VLFDAPP
SITEY Cluster234/239YYYYYY
SITEWalker A68/70GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELYKRGVRYVKFKTKGKTKRERKLITIYSPKSPISESFRTLRTNIQFASIDQSLKTLMVTSTGPGEGKSTIIANLAVVL
                                                            TSTGPGEGKSTIIANLAVVL
                                                                   GKS          
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQQEKKVLLVDADMRKPTVHHTFRLPNLVGLTNVLVGNEVLEDAIQETTVNNLNILTSGPIPPNPAELLGSNRMSQLVDE
AQQEKKVLLVDADMRKPTVHHTFRLPNLVGLTNVLVGNEVLEDAIQETTVNNLNILTSGPIPPNPAELLGSNRMSQLVDE
       LLVDADMR                                                                 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSSTYDIVLFDAPPVIAVTDAQVLSRIIDGVLLVVHSGKTHREMAIKSKELLENVRANVIGVVLNHKEVKGENYYYYYYG
VSSTYDIVLFDAPPVIAVTDAQVLSRIIDGVLLVVHSGKTHREMAIKSKELLENVRANVIGVVLNHKEVKGENYYYYYYG
       VLFDAPP                                                           YYYYYY 
  
..
EN
EN

© 1998-2020Legal notice