BYKdb

Annotate results for A0A1D2XD58

A0A1D2XD58 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D2XD58
DOMAINtad21/200DIISLREIFHVLTTHRWAIIGFTLATTLIAALVVFSLTPVYQATAVLQIEQEQAKVVSIE
EVYGIDGGGDSYLNTQFEVLKSRGVLEKVVEKLNLINNPEFNTSLRKKPWYAEYTDWRSW
FGLELPQEDDDKSRIIRDTVGVLEQNIAIAPVRKTQIVKINATSENPELSAKIANEVANA
DOMAINcd545/732TSTVPGEGKSSVASNLALSLSQLGNTLLVDADLRRPTVGKNYHIKGGSAGLANLLAGTAS
ASDCVHSADGLDIIPCGQVPPNPQELLASDRFAKLVAKLKERYDYIVIDCPPVQSVSDAL
MVSRLCDGLVYVVEASKVQLGAIQNTVGRLLQAQAPLTGVVINKINPNKKDAYGYSQSYY
DYEGYKSS
SITEWalker A552/554GKS
SITEWalker A'571/578LLVDADLR
SITEWalker B650/656IVIDCPP
SITE-647/-649YDY
SITEY Cluster717/729YGYSQSYYDYEGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTETTQSPLLPASQPGQDEDIISLREIFHVLTTHRWAIIGFTLATTLIAALVVFSLTPVYQATAVLQIEQEQAKVVSIE
                    DIISLREIFHVLTTHRWAIIGFTLATTLIAALVVFSLTPVYQATAVLQIEQEQAKVVSIE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVYGIDGGGDSYLNTQFEVLKSRGVLEKVVEKLNLINNPEFNTSLRKKPWYAEYTDWRSWFGLELPQEDDDKSRIIRDTV
EVYGIDGGGDSYLNTQFEVLKSRGVLEKVVEKLNLINNPEFNTSLRKKPWYAEYTDWRSWFGLELPQEDDDKSRIIRDTV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVLEQNIAIAPVRKTQIVKINATSENPELSAKIANEVANAYISSYMEAKLSLTLSATDWMQSRMEELSGKLRVAEANLQN
GVLEQNIAIAPVRKTQIVKINATSENPELSAKIANEVANA                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YREKEDLVELEGVLTISSNELKALTESLVQIRRKLAVSESIYDQIKSGKLKNKSDYESLQAVLAHPLIQELKQEESKVQR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVQDLSRRYGPKHPKMISVRSELQSIERNIRVQIENIIDGVERTYEVDKSNEQSLQEAVAVARKRVQEINRKQFRLKALE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REVRTNKDLYDAFFKRIQETSATSDLQTANARVVDKAFAPKDPVKPKKKLIVAIAALLGLMISAGIAFLLEMLNNTIRST


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDVEDKLNLSVLGVLPLMSGKSVKEGCHRLFLNKDEHGFGEAIRTIRTSVNLTAMDKDHKLFSVTSTVPGEGKSSVASNL
                                                                TSTVPGEGKSSVASNL
                                                                       GKS      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALSLSQLGNTLLVDADLRRPTVGKNYHIKGGSAGLANLLAGTASASDCVHSADGLDIIPCGQVPPNPQELLASDRFAKLV
ALSLSQLGNTLLVDADLRRPTVGKNYHIKGGSAGLANLLAGTASASDCVHSADGLDIIPCGQVPPNPQELLASDRFAKLV
          LLVDADLR                                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKLKERYDYIVIDCPPVQSVSDALMVSRLCDGLVYVVEASKVQLGAIQNTVGRLLQAQAPLTGVVINKINPNKKDAYGYS
AKLKERYDYIVIDCPPVQSVSDALMVSRLCDGLVYVVEASKVQLGAIQNTVGRLLQAQAPLTGVVINKINPNKKDAYGYS
         IVIDCPP                                                            YGYS
       730   
....:....|...
QSYYDYEGYKSSD
QSYYDYEGYKSS 
QSYYDYEGY    

© 1998-2020Legal notice