BYKdb

Annotate results for A0A1D2S760

A0A1D2S760 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D2S760
DOMAINcd105/285TSPTVGSGKTVTAINLAISIAHHTQRTAMLVDFDLRRPRVGTYLGVRKTPSLSEVLTGKA
QLADAMVNPDLPRLVVLPTSRPVPHAAEVLSSVVVRSMVADLRERYADRIVIFDLPPVMA
GDDVMALLPSVDAVLLVVGNGDSTRKEIEESMRHLPPEQLLGVVLNKAEAEVRRGYGYGY
Y
SITEWalker A112/114GKT
SITEWalker A'133/140MLVDFDLR
SITEWalker B215/221VIFDLPP
SITEY Cluster280/285YGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MERIKQALEKARQQSAGAAPHPAHPSAPALTAPAAAAQQADALASGAIEVNYTQTEIVRLDRATLERNRIVAFEKTNPDN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WVYDVLRTQVLQKMDEKGWRTLAITSPTVGSGKTVTAINLAISIAHHTQRTAMLVDFDLRRPRVGTYLGVRKTPSLSEVL
                        TSPTVGSGKTVTAINLAISIAHHTQRTAMLVDFDLRRPRVGTYLGVRKTPSLSEVL
                               GKT                  MLVDFDLR                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGKAQLADAMVNPDLPRLVVLPTSRPVPHAAEVLSSVVVRSMVADLRERYADRIVIFDLPPVMAGDDVMALLPSVDAVLL
TGKAQLADAMVNPDLPRLVVLPTSRPVPHAAEVLSSVVVRSMVADLRERYADRIVIFDLPPVMAGDDVMALLPSVDAVLL
                                                      VIFDLPP                   
       250       260       270       280     
....:....|....:....|....:....|....:....|....:
VVGNGDSTRKEIEESMRHLPPEQLLGVVLNKAEAEVRRGYGYGYY
VVGNGDSTRKEIEESMRHLPPEQLLGVVLNKAEAEVRRGYGYGYY
                                       YGYGYY
© 1998-2020Legal notice