BYKdb

Annotate results for A0A1D2RNR5

A0A1D2RNR5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D2RNR5
DOMAINcd204/393TSTTKNEGKSTTALALAINFAQMGAKVVLIDADMRNPSVHKYLNLPNTAGLSNYLSGHGK
PGEITRMSAIDNLMIITAGPIPPSPVDLLTGPRLGELMDLLEVRGAQYIIFDGPPVLGLA
DAIVLGNQVHSVLFVAQASQTRKSHIKDAFRRLRMAGVVPCGVVLTKTTAQNTAYYTYDN
YYGYGVDTPP
SITEWalker A211/213GKS
SITEWalker A'231/238VLIDADMR
SITEWalker B312/318IIFDGPP
SITEY Cluster378/387YYTYDNYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDELKARINAEVQSVLASVRNQALMAKRQENLIRTRLQQTRAEIMAAQDRSVDFNLLKREVDTNRELYNGLLQQVKEVGV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGGVETNNIQVVDKAEVPLFPYKPRLALNAAIGLLAGIVLGLGIVFLMESMDDSIKFADEVEKLLQVPLLGVIPKVKEKT


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNLASLALLVHEDPRGQMAEAYRSVRTALQFSTADGAPRRLVLTSTTKNEGKSTTALALAINFAQMGAKVVLIDADMRNP
                                           TSTTKNEGKSTTALALAINFAQMGAKVVLIDADMRNP
                                                  GKS                 VLIDADMR  
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVHKYLNLPNTAGLSNYLSGHGKPGEITRMSAIDNLMIITAGPIPPSPVDLLTGPRLGELMDLLEVRGAQYIIFDGPPVL
SVHKYLNLPNTAGLSNYLSGHGKPGEITRMSAIDNLMIITAGPIPPSPVDLLTGPRLGELMDLLEVRGAQYIIFDGPPVL
                                                                       IIFDGPP  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLADAIVLGNQVHSVLFVAQASQTRKSHIKDAFRRLRMAGVVPCGVVLTKTTAQNTAYYTYDNYYGYGVDTPPKPGPSAG
GLADAIVLGNQVHSVLFVAQASQTRKSHIKDAFRRLRMAGVVPCGVVLTKTTAQNTAYYTYDNYYGYGVDTPP       
                                                         YYTYDNYYGY             
       410
....:....|
DRTEPSLTTA


© 1998-2020Legal notice