BYKdb

Annotate results for A0A1D2QNK8

A0A1D2QNK8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D2QNK8
DOMAINtad29/276SDIDFMHYYRLILRNLWKIILFSIVVGAFSALYALSLPPVYYSNTTLLIENQQPNLLSFQ
DVYQVDTRNRNYLGTQLEILKSRALASRVVDRMQLTRHPLFDIRAKDGNNKGFSWKMLQG
LFRTPGVDTKQEVNADIQPNIGNSPSESLDTNYSIELASDHDQRTSNDPRFGNTEQLDKE
LHSDGIRGYGEYFSKENAVERRVKKKVVDTVMKSLVAFPIRGTQLVNIRFSAQDPQLAAD
IANVFADV
DOMAINcd619/810TSSVPNEGKSTVSLCLAQALGQMEKVLLLDGDMRRPSIGKALDISLLTPGLSNLIAGTAE
LDECVTRLGDTEVDVITAGVVLGNPLDQIAGDRFQGVLQMMKEKYDRIIIDSAPIQAVSD
SIVIATHADALIYVVKSDGSPTPVIKRGLRRLSETSARFSGVVLNQVDIDKVNKSSGYEE
GYYENYGYTGPE
SITEWalker A626/628GKS
SITEWalker A'645/652LLLDGDMR
SITEWalker B726/732IIIDSAP
SITEY Cluster796/806YEEGYYENYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSEISFNQPKNSVPILGAGSNFNPFGSESDIDFMHYYRLILRNLWKIILFSIVVGAFSALYALSLPPVYYSNTTLLIENQ
                            SDIDFMHYYRLILRNLWKIILFSIVVGAFSALYALSLPPVYYSNTTLLIENQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPNLLSFQDVYQVDTRNRNYLGTQLEILKSRALASRVVDRMQLTRHPLFDIRAKDGNNKGFSWKMLQGLFRTPGVDTKQE
QPNLLSFQDVYQVDTRNRNYLGTQLEILKSRALASRVVDRMQLTRHPLFDIRAKDGNNKGFSWKMLQGLFRTPGVDTKQE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNADIQPNIGNSPSESLDTNYSIELASDHDQRTSNDPRFGNTEQLDKELHSDGIRGYGEYFSKENAVERRVKKKVVDTVM
VNADIQPNIGNSPSESLDTNYSIELASDHDQRTSNDPRFGNTEQLDKELHSDGIRGYGEYFSKENAVERRVKKKVVDTVM

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSLVAFPIRGTQLVNIRFSAQDPQLAADIANVFADVYIESHLEAKLEVTQKASAWLSDRLSDLRQGLRKSEQALQAYRER
KSLVAFPIRGTQLVNIRFSAQDPQLAADIANVFADV                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKLVDTGDVRSIDVAELEQLTQSLVEATRKKSDTEALYRQMAEGNLPLDRLLALPIVSNNVAVQGLVESRATARRRVAEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKRYGAKHPKMLSAVSDVTEVEGELRNQVSNVASGVEVNFLAAKDAEKALKTQIAEVKRRLQSVNRKEFDLRELEREVEA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRQVYEVFLNRGKETNEAGNLESVNARVVDAAIPAEYVDKPEKKKIVMIAVLFSGIFAAAVVLLLDFLDNTIKTPEDVEE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLHVPLLGHLPLDKENKGDAPLLDFLADEKWNFAEAIRTIRTSFILSGLDAPAKVTVITSSVPNEGKSTVSLCLAQALGQ
                                                          TSSVPNEGKSTVSLCLAQALGQ
                                                                 GKS            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKVLLLDGDMRRPSIGKALDISLLTPGLSNLIAGTAELDECVTRLGDTEVDVITAGVVLGNPLDQIAGDRFQGVLQMMK
MEKVLLLDGDMRRPSIGKALDISLLTPGLSNLIAGTAELDECVTRLGDTEVDVITAGVVLGNPLDQIAGDRFQGVLQMMK
    LLLDGDMR                                                                    
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKYDRIIIDSAPIQAVSDSIVIATHADALIYVVKSDGSPTPVIKRGLRRLSETSARFSGVVLNQVDIDKVNKSSGYEEGY
EKYDRIIIDSAPIQAVSDSIVIATHADALIYVVKSDGSPTPVIKRGLRRLSETSARFSGVVLNQVDIDKVNKSSGYEEGY
     IIIDSAP                                                               YEEGY
       810  
....:....|..
YENYGYTGPEES
YENYGYTGPE  
YENYGY      

© 1998-2020Legal notice