BYKdb

Annotate results for A0A1D2LG11

A0A1D2LG11 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D2LG11
DOMAINcd45/221TSPTPSSGKSVVSSNLAVSYAQQDKKVLIIDGDLRKATQHYQFKADPYRGLSSLLIGKLS
IADAIQETFVPNLSVLTSGPMPPNPAELLSTNKLDTLMDEFKKSFDIIIIDTPPVINLTD
AVVISRVADGIILVVRANHTQKNEVSRSVEILKTTNKKLFGTILNDAKYEVSDYYYY
SITEWalker A52/54GKS
SITEWalker A'72/79LIIDGDLR
SITEWalker B152/158IIIDTPP
SITEY Cluster213/221YEVSDYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKRKLKQNLITFYNSKSPVSEQIKAVRTSLNFATIDQDAQVILITSPTPSSGKSVVSSNLAVSYAQQDKKVLIIDGDLRK
                                            TSPTPSSGKSVVSSNLAVSYAQQDKKVLIIDGDLRK
                                                   GKS                 LIIDGDLR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATQHYQFKADPYRGLSSLLIGKLSIADAIQETFVPNLSVLTSGPMPPNPAELLSTNKLDTLMDEFKKSFDIIIIDTPPVI
ATQHYQFKADPYRGLSSLLIGKLSIADAIQETFVPNLSVLTSGPMPPNPAELLSTNKLDTLMDEFKKSFDIIIIDTPPVI
                                                                       IIIDTPP  
       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
NLTDAVVISRVADGIILVVRANHTQKNEVSRSVEILKTTNKKLFGTILNDAKYEVSDYYYY
NLTDAVVISRVADGIILVVRANHTQKNEVSRSVEILKTTNKKLFGTILNDAKYEVSDYYYY
                                                    YEVSDYYYY
© 1998-2020Legal notice