BYKdb

Annotate results for A0A1D2KMU4

A0A1D2KMU4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D2KMU4
DOMAINcd50/228TSPESGTGKSFVATNLALTYAEQGKKVLLVDTDLRRPTIHKMFGKENILGITSVLTGQET
IDDCVQDTIFNSLTILTSGFLPPNPAELLESEEMKAIIKQLTTDYDIVIFDAPPVLPVVD
SALLSTLVDGVIFVIRSRYTEQGAAVKAVEKIKSAGSRIIGTILNDKSSKDSGYEAEYY
SITEWalker A57/59GKS
SITEWalker A'77/84LLVDTDLR
SITEWalker B157/163VIFDAPP
SITEY Cluster223/228YEAEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRKTKIKDKKRLNIILNRENAKSIPYEQMKNIRSSIQFASTKELKSLIVTSPESGTGKSFVATNLALTYAEQGKKVLLVD
                                                 TSPESGTGKSFVATNLALTYAEQGKKVLLVD
                                                        GKS                 LLVD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDLRRPTIHKMFGKENILGITSVLTGQETIDDCVQDTIFNSLTILTSGFLPPNPAELLESEEMKAIIKQLTTDYDIVIFD
TDLRRPTIHKMFGKENILGITSVLTGQETIDDCVQDTIFNSLTILTSGFLPPNPAELLESEEMKAIIKQLTTDYDIVIFD
TDLR                                                                        VIFD
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
APPVLPVVDSALLSTLVDGVIFVIRSRYTEQGAAVKAVEKIKSAGSRIIGTILNDKSSKDSGYEAEYY
APPVLPVVDSALLSTLVDGVIFVIRSRYTEQGAAVKAVEKIKSAGSRIIGTILNDKSSKDSGYEAEYY
APP                                                           YEAEYY
© 1998-2020Legal notice