BYKdb

Annotate results for A0A1C9WMD3

A0A1C9WMD3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C9WMD3
DOMAINtad15/151AGLALEDYLRIARARWKGILAFTLALTVLAFCWTLLQPKIYAAQSSGIVVAGGSDNLSLS
LMSENLAQTKAAKYESVAKSRLVAERVVTSLGLTTSPDALLGSVTVAVPKESAQLAVTAT
STNPEMARKVADAWVMG
DOMAINcd297/483TSSVPAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLSGHAE
LEDVLQEWSAMPNLRVLGSGRIPPNPSELLGSQAMKTLLRTLAQDAIVLVDAPPLLPVTD
AAVLTRIADGAIVVIRSGKTTDEELGKSLGNLGRVNGNVLGTILNRVPTTGADSYRYYTA
YQSREPE
SITE-434/-436GKT
SITEWalker A'324/331VVVDGDLR
SITEWalker B404/410VLVDAPP
SITEY Cluster471/477YRYYTAY
SITE-442/-444GKS
SITEWalker A304/306GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTGFETADNSGQTSAGLALEDYLRIARARWKGILAFTLALTVLAFCWTLLQPKIYAAQSSGIVVAGGSDNLSLSLMSENL
              AGLALEDYLRIARARWKGILAFTLALTVLAFCWTLLQPKIYAAQSSGIVVAGGSDNLSLSLMSENL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQTKAAKYESVAKSRLVAERVVTSLGLTTSPDALLGSVTVAVPKESAQLAVTATSTNPEMARKVADAWVMGLAEQVKELE
AQTKAAKYESVAKSRLVAERVVTSLGLTTSPDALLGSVTVAVPKESAQLAVTATSTNPEMARKVADAWVMG         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIPAVEGSDVIPVPVIRVVPLGEATLPTAPTSPNVKLSLAIGALAGLALGLAYALIRHRLDRRLRSATAIERRFGVPVLG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLPVDHRLDGKSTVLDDGFSPVAAGEGSHAITEALRELRTNLQYVDVDNPPRIIVVTSSVPAEGKSTVTANLAVTMAAAG
                                                        TSSVPAEGKSTVTANLAVTMAAAG
                                                               GKS              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLSGHAELEDVLQEWSAMPNLRVLGSGRIPPNPSELLGSQAMKTLLRTLAQ
ENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLSGHAELEDVLQEWSAMPNLRVLGSGRIPPNPSELLGSQAMKTLLRTLAQ
   VVVDGDLR                                                                     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAIVLVDAPPLLPVTDAAVLTRIADGAIVVIRSGKTTDEELGKSLGNLGRVNGNVLGTILNRVPTTGADSYRYYTAYQSR
DAIVLVDAPPLLPVTDAAVLTRIADGAIVVIRSGKTTDEELGKSLGNLGRVNGNVLGTILNRVPTTGADSYRYYTAYQSR
   VLVDAPP                                                            YRYYTAY   
        
....:...
EPESQPVR
EPE     

© 1998-2020Legal notice