BYKdb

Annotate results for A0A1C9W7V6

A0A1C9W7V6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C9W7V6
DOMAINtad17/197EAFDIRQYIGVVNRFKWYILGLTAVATLGAILVTSALPKVYEATATLMVEAEQPKALKIE
DVYGQDPTRQDYMSTQFEMLRSRSIAREVVTRLDLVNDPKFAADRNSVSLKAAIKGVFSS
GPSYGNVTREEMEAIELEKVVDKVADNLTIEPVINTQFAKVKFESRSPEIAARVVNTVAE
V
DOMAINcd541/728TSSVAGEGKTTVAENMALALAQMEKVVLVDADLRRPSVGKDFGLAVYMPGLSNLINGSNS
LAECTYFDERRGLDILPSGVVPHNPQELLGKPQLAEVIKSLAEKYDRVIIDTPPIQVVSD
ALMVSRLADSTVYVVKANGESQAFVKTGLDRLIATGAKVDGVVLNQVESPAMSGYFGDYQ
GYEGGYGA
SITEWalker A548/550GKT
SITEWalker A'567/574VLVDADLR
SITEWalker B648/654VIIDTPP
SITEY Cluster715/732YFGDYQGYEGGYGAGAVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNDLIRNFPQDTAAQPEAFDIRQYIGVVNRFKWYILGLTAVATLGAILVTSALPKVYEATATLMVEAEQPKALKIEDVYG
                EAFDIRQYIGVVNRFKWYILGLTAVATLGAILVTSALPKVYEATATLMVEAEQPKALKIEDVYG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDPTRQDYMSTQFEMLRSRSIAREVVTRLDLVNDPKFAADRNSVSLKAAIKGVFSSGPSYGNVTREEMEAIELEKVVDKV
QDPTRQDYMSTQFEMLRSRSIAREVVTRLDLVNDPKFAADRNSVSLKAAIKGVFSSGPSYGNVTREEMEAIELEKVVDKV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADNLTIEPVINTQFAKVKFESRSPEIAARVVNTVAEVFIDKHRESKNAMTREASVWLQQRLEDLRGKLEESEERLQSYQA
ADNLTIEPVINTQFAKVKFESRSPEIAARVVNTVAEV                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQGLVDVQGVQSLASQGLNEITTDLIQARKELKQAESLRDLVTNREYDINALASLPEVLNHGVIQDVKRAEVAAAARVSE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSQRYGPMHPNMIAARQQLGSVQQKLRTEIRQLISGIENDFEAAQANVAALERELDTAKQDFRELDRKDTRHNELKREVE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANRQLYNAFLTRYKETSETTGYEGANARLIDEALPPQAPSKPRRLLLIAAAFMGSLIGGLGLAFVYEAFNDSVQTAVTVQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKLGQQLLGMFPKVSTKSGNRFRLSTFIRAAHTPFAEAVRTLRTNFVLKHVDNPAKVVVVTSSVAGEGKTTVAENMALAL
                                                            TSSVAGEGKTTVAENMALAL
                                                                   GKT          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQMEKVVLVDADLRRPSVGKDFGLAVYMPGLSNLINGSNSLAECTYFDERRGLDILPSGVVPHNPQELLGKPQLAEVIKS
AQMEKVVLVDADLRRPSVGKDFGLAVYMPGLSNLINGSNSLAECTYFDERRGLDILPSGVVPHNPQELLGKPQLAEVIKS
      VLVDADLR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAEKYDRVIIDTPPIQVVSDALMVSRLADSTVYVVKANGESQAFVKTGLDRLIATGAKVDGVVLNQVESPAMSGYFGDYQ
LAEKYDRVIIDTPPIQVVSDALMVSRLADSTVYVVKANGESQAFVKTGLDRLIATGAKVDGVVLNQVESPAMSGYFGDYQ
       VIIDTPP                                                            YFGDYQ
       730       740       750   
....:....|....:....|....:....|...
GYEGGYGAGAVYGAGGMPPGMRSRKEPDLELEG
GYEGGYGA                         
GYEGGYGAGAVY                     

© 1998-2020Legal notice