BYKdb

Annotate results for A0A1C9W5R8

A0A1C9W5R8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C9W5R8
DOMAINtad16/192GGLDLRRYWQAILSRKWMILGLTATITVVAMLVVAGMPSRYQATATLMFELDQGNLVSVE
ELYDTGTQRREYILTQTEMLQSRDLAERVIRKLDLLNNEEFDPSLREVSSGIWGWLPFVG
KNQSVDSVERSRIEQVTSAFLKRLSVAPKRSTHLVDISFTARSPELAADIANAVGAE
DOMAINcd542/731TSSVPGEGKTTVAENLAFALGQVEKVLLVDADLRKPVVGIDFGVDREQPGLTDMIEGTAA
IDDCIHRDENGGIDIIPAGRLCDDPQKLLVSPRFDEMIKVLARSYDRVIIDTPPVQAVSD
ALIIARSASSVLFVVKHDDVNKRVVIKGLSRLEQTGAPVAGVVLNHVDTSKNAAYAEEYY
GYDYGRQPGG
SITE-731/-733GKS
SITEWalker A'568/575LLVDADLR
SITEWalker B649/655VIIDTPP
SITEY Cluster716/725YAEEYYGYDY
SITEWalker A549/551GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKKNPFEGEDLMDEGGLDLRRYWQAILSRKWMILGLTATITVVAMLVVAGMPSRYQATATLMFELDQGNLVSVEELYDT
               GGLDLRRYWQAILSRKWMILGLTATITVVAMLVVAGMPSRYQATATLMFELDQGNLVSVEELYDT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTQRREYILTQTEMLQSRDLAERVIRKLDLLNNEEFDPSLREVSSGIWGWLPFVGKNQSVDSVERSRIEQVTSAFLKRLS
GTQRREYILTQTEMLQSRDLAERVIRKLDLLNNEEFDPSLREVSSGIWGWLPFVGKNQSVDSVERSRIEQVTSAFLKRLS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAPKRSTHLVDISFTARSPELAADIANAVGAEYIASQSEARAQFTNRASSWLNERLDTLRVKLEQSEAELLAFREQEDLV
VAPKRSTHLVDISFTARSPELAADIANAVGAE                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DISGVLSLAEQDLNEATTQLQEMRRELRQVGSIHEQVEALEGNELALANLPDVLNNPMIQEIKRNEAQASRNVAEVSRRY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPKHPIMIAANNELTMVRDQLRSEVRNLADAIDSRYQTAQARVRAQEQEVARAKENYQQVSRKAVRHGELQQQAEINRQL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FNTFLTRVNETREASGFDMAPARLADPAVAPNEPSEPNKRVIVSAVLALALMLSVGLAFVLDFLRVGVRNPEDVEVYLHQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLMGLLPDVQKVSGQRLDLRAFFDPDQYTFAESVRTLRTGIVLSQFGGKEGKDSKGQVLAVTSSVPGEGKTTVAENLAFA
                                                             TSSVPGEGKTTVAENLAFA
                                                                    GKT         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGQVEKVLLVDADLRKPVVGIDFGVDREQPGLTDMIEGTAAIDDCIHRDENGGIDIIPAGRLCDDPQKLLVSPRFDEMIK
LGQVEKVLLVDADLRKPVVGIDFGVDREQPGLTDMIEGTAAIDDCIHRDENGGIDIIPAGRLCDDPQKLLVSPRFDEMIK
       LLVDADLR                                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLARSYDRVIIDTPPVQAVSDALIIARSASSVLFVVKHDDVNKRVVIKGLSRLEQTGAPVAGVVLNHVDTSKNAAYAEEY
VLARSYDRVIIDTPPVQAVSDALIIARSASSVLFVVKHDDVNKRVVIKGLSRLEQTGAPVAGVVLNHVDTSKNAAYAEEY
        VIIDTPP                                                            YAEEY
       730       740       750    
....:....|....:....|....:....|....
YGYDYGRQPGGKSEARRAPSVELEQVVESSEEKT
YGYDYGRQPGG                       
YGYDY                             

© 1998-2020Legal notice