BYKdb

Annotate results for A0A1C9VLY1

A0A1C9VLY1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C9VLY1
DOMAINtad42/238DRIDLKTIWRALARRKRTILGVTALCTLAAGVYTLQMTPQYKSSALLQIDRAAQKVVGFN
AEVEVDEGPLADQLQLRTQIELMKSRSLAERVIDELGLYKPDAPATPAAPPAQVKASGDG
PTDQALAFLGNAWLRLRALVASPAPGDEGTLSRAATVARFQQSLSVEPIRNSRLVQIQVL
NPDPQLAATIANAMSQA
DOMAINcd577/766TSCGKSEGKSTTALALAINFAQLGQQVLLIDADMRKGGLHKMLGVVNDRGLSNLLSGDRD
LDASVRHTTVDKLALITAGPVPPNPVELLAGPRLGQLLEKAQALGYEQIVIDGPPLLGIA
DAIVLGNQIQNIVLAIKAGGTRKESIKDALRRLRNAGLSPMGVVFTHARNEHTSDYAYAA
YYGHGYSHGE
SITEWalker A580/582GKS
SITEWalker A'604/611LLIDADMR
SITEWalker B685/691IVIDGPP
SITEY Cluster752/762YAYAAYYGHGY
SITEWalker A584/586GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASHDQHPLPAGPGPSALALRREAALSELMATQVEAGARTDDRIDLKTIWRALARRKRTILGVTALCTLAAGVYTLQMTP
                                         DRIDLKTIWRALARRKRTILGVTALCTLAAGVYTLQMTP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYKSSALLQIDRAAQKVVGFNAEVEVDEGPLADQLQLRTQIELMKSRSLAERVIDELGLYKPDAPATPAAPPAQVKASGD
QYKSSALLQIDRAAQKVVGFNAEVEVDEGPLADQLQLRTQIELMKSRSLAERVIDELGLYKPDAPATPAAPPAQVKASGD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPTDQALAFLGNAWLRLRALVASPAPGDEGTLSRAATVARFQQSLSVEPIRNSRLVQIQVLNPDPQLAATIANAMSQAFI
GPTDQALAFLGNAWLRLRALVASPAPGDEGTLSRAATVARFQQSLSVEPIRNSRLVQIQVLNPDPQLAATIANAMSQA  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATNIERKLHSSIYARQYLEEQIRQTKAKLEESERVINAYAKDNEILNLGDKGSAAIQTFVDFSTALAKAEQDRIRAETLY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQVKLNPESAPQAVTNEAIRAYKEQRARLEAEYAKNRSTFKPEYPAMVAARAQIAELDARIKTEVNNILASIEGQYVAAK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTEDQLRSKVAGSRSEVLSVQDRSVDMNLLSRELDTNRQVYDSLLQRLKEVNVMAGITANNVSIVDEASPPLFPANPNIK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNLGLGVVLGLFLGMLAALLREQMDDSLKNANDIEARYQLPLLGLIPFTRPERGRKDAVALLAHHEPRSTFAESYRSMRT


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALQFSTADGAPQRFMVTSCGKSEGKSTTALALAINFAQLGQQVLLIDADMRKGGLHKMLGVVNDRGLSNLLSGDRDLDAS
                TSCGKSEGKSTTALALAINFAQLGQQVLLIDADMRKGGLHKMLGVVNDRGLSNLLSGDRDLDAS
                   GKS GKS                 LLIDADMR                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRHTTVDKLALITAGPVPPNPVELLAGPRLGQLLEKAQALGYEQIVIDGPPLLGIADAIVLGNQIQNIVLAIKAGGTRKE
VRHTTVDKLALITAGPVPPNPVELLAGPRLGQLLEKAQALGYEQIVIDGPPLLGIADAIVLGNQIQNIVLAIKAGGTRKE
                                            IVIDGPP                             
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIKDALRRLRNAGLSPMGVVFTHARNEHTSDYAYAAYYGHGYSHGERPAPPPARPDPPQGAVPLPAGTRVEPTLDPYSAT
SIKDALRRLRNAGLSPMGVVFTHARNEHTSDYAYAAYYGHGYSHGE                                  
                               YAYAAYYGHGY                                      

© 1998-2020Legal notice