BYKdb

Annotate results for A0A1C7IDI4

A0A1C7IDI4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C7IDI4
DOMAINcd39/230TSCTPNEGKSTVATYLASAMAQAGKRVLLIDGDLRKSLFTGNFEITDEVKGMAHLLSGQA
SLEEVICNTDQAGLDVVFSGPVPPNPTELLGDKAFKNMIKKCREMYDYVFIDSPPLGSVI
DSAIIAESCDGSIIIIEAEVISYRFVQEIKEQLEKSNCPILGTILNKVDVRGQKYYSRYY
GKKYGYGKYYKY
SITEWalker A46/48GKS
SITEWalker A'66/73LLIDGDLR
SITEWalker B147/153VFIDSPP
SITE-144/-146YDY
SITEY Cluster213/233YYSRYYGKKYGYGKYYKYGHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTIKLKMKKLDYETNESYKTLRTNLQFCGEDKKVIVMTSCTPNEGKSTVATYLASAMAQAGKRVLLIDGDLRKSLFTGN
                                      TSCTPNEGKSTVATYLASAMAQAGKRVLLIDGDLRKSLFTGN
                                             GKS                 LLIDGDLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FEITDEVKGMAHLLSGQASLEEVICNTDQAGLDVVFSGPVPPNPTELLGDKAFKNMIKKCREMYDYVFIDSPPLGSVIDS
FEITDEVKGMAHLLSGQASLEEVICNTDQAGLDVVFSGPVPPNPTELLGDKAFKNMIKKCREMYDYVFIDSPPLGSVIDS
                                                                  VFIDSPP       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIIAESCDGSIIIIEAEVISYRFVQEIKEQLEKSNCPILGTILNKVDVRGQKYYSRYYGKKYGYGKYYKYGHYGKEERER
AIIAESCDGSIIIIEAEVISYRFVQEIKEQLEKSNCPILGTILNKVDVRGQKYYSRYYGKKYGYGKYYKY          
                                                    YYSRYYGKKYGYGKYYKYGHY       
  
..
NH


© 1998-2020Legal notice