BYKdb

Annotate results for A0A1C7I8G7

A0A1C7I8G7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C7I8G7
DOMAINcd40/229TSCTPNDGKSTVAYNLALALAESGRNTLLIDADMRKSVLVHRLRIEGAIKGLSHYLSGQE
ELGDVVYGTNKRNFFLLPTGIFPSNPTELLGNERLQKLLTGLKNTFAYIIIDTPPLGSVI
DAAVIAQVCDGSILVLAADNSSRAEAKGVVGQLKAANSNLLGVVLNKVDVHTGSYYGKKY
GGYYGNKYGG
SITEWalker A47/49GKS
SITEWalker A'67/74LLIDADMR
SITEWalker B148/154IIIDTPP
SITEY Cluster214/231YYGKKYGGYYGNKYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDKLEIKGEISLSSREREVYRTLRTNLEFTGVENRVIAVTSCTPNDGKSTVAYNLALALAESGRNTLLIDADMRKSVLVH
                                       TSCTPNDGKSTVAYNLALALAESGRNTLLIDADMRKSVLVH
                                              GKS                 LLIDADMR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLRIEGAIKGLSHYLSGQEELGDVVYGTNKRNFFLLPTGIFPSNPTELLGNERLQKLLTGLKNTFAYIIIDTPPLGSVID
RLRIEGAIKGLSHYLSGQEELGDVVYGTNKRNFFLLPTGIFPSNPTELLGNERLQKLLTGLKNTFAYIIIDTPPLGSVID
                                                                   IIIDTPP      
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
AAVIAQVCDGSILVLAADNSSRAEAKGVVGQLKAANSNLLGVVLNKVDVHTGSYYGKKYGGYYGNKYGGYY
AAVIAQVCDGSILVLAADNSSRAEAKGVVGQLKAANSNLLGVVLNKVDVHTGSYYGKKYGGYYGNKYGG  
                                                     YYGKKYGGYYGNKYGGYY
© 1998-2020Legal notice