BYKdb

Annotate results for A0A1C7FTC7

A0A1C7FTC7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C7FTC7
DOMAINtad22/161EGMTIVDLLSILRKHIITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATYNSSNDSANS
SEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAFVNI
AVTDADPSTAARIANGVAAS
DOMAINcd294/481TSAGASEGKTTTSVNIAAALAEDGSRVLLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAA
VKDVIQRYWKPNLHIIPAGPKPPNASTLLNSPLMTTLVANAMQQYDYIIIDTAPMVVAND
AVIFMKQGGTLEMVCCRDHTLKRDLREIASELETLDMPVTGVIINCAKENKKALENSNYY
YYSNSSPA
SITEWalker A301/303GKT
SITEWalker A'321/328LLIDADLR
SITEWalker B401/407IIIDTAP
SITE-398/-400YDY
SITEY Cluster472/475YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAENEVNRYSQSQSQTPVPAHEGMTIVDLLSILRKHIITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATYNSSNDSAN
                     EGMTIVDLLSILRKHIITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATYNSSNDSAN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAFVNIAVTDADPSTAARIANGVAA
SSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAFVNIAVTDADPSTAARIANGVAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKPSSPKWSLNLLAGILGGLIIGILAALLKDVLSKKIQDESDVTDIVDAP
S                                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIGRVVKDDILTGSSPVVVSEPGSPIAEDFRRIRTNLSFSTPVEGTNCRLIVVTSAGASEGKTTTSVNIAAALAEDGSRV
                                                     TSAGASEGKTTTSVNIAAALAEDGSRV
                                                            GKT                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKPPNASTLLNSPLMTTLVANAMQQYDY
LLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKPPNASTLLNSPLMTTLVANAMQQYDY
LLIDADLR                                                                        
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIIDTAPMVVANDAVIFMKQGGTLEMVCCRDHTLKRDLREIASELETLDMPVTGVIINCAKENKKALENSNYYYYSNSSP
IIIDTAPMVVANDAVIFMKQGGTLEMVCCRDHTLKRDLREIASELETLDMPVTGVIINCAKENKKALENSNYYYYSNSSP
IIIDTAP                                                                YYYY     
       490
....:....|
AEKNRKNRKS
A         

© 1998-2020Legal notice