BYKdb

Annotate results for A0A1C7FFY0

A0A1C7FFY0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C7FFY0
DOMAINtad14/201ESVDFGKYIVLLKRSWLKITLFTTLVTVLAALFALSIAPTYQATATLLIESNTSKAVSIE
EVVGIDSTQQEYYLTQFEILKSRRIAERVIAQLNLEKNKEFNPYIEPKQSFKSFVKEKVL
ALPMFKSEEAKVELTAEEQATKIRYAVLAHFQSKLLISPIRKTQLVRITFESLDPQLAAD
IANAVGEA
DOMAINcd544/733SSSLPNEGKTTCSINLALAFSKVENTLLIDCDLRKSAVAERFGHKRYKPGLTNHLLMNTD
LDECFFVDERSGLTVLAAGMPTQNPQELLSSERFAQLLHQLSERFDKVIIDTPPALVVSD
SMIISKITGKVVVVLRASSTRVATLRNTISRFMSHDVQFEGLLLNQISEGKGKQDYVYGD
YIHHLDKVPQ
SITEWalker A551/553GKT
SITEWalker A'570/577LLIDCDLR
SITEWalker B651/657VIIDTPP
SITEY Cluster719/724YVYGDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKLLSDEKTSIEGESVDFGKYIVLLKRSWLKITLFTTLVTVLAALFALSIAPTYQATATLLIESNTSKAVSIEEVVGIDS
             ESVDFGKYIVLLKRSWLKITLFTTLVTVLAALFALSIAPTYQATATLLIESNTSKAVSIEEVVGIDS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQQEYYLTQFEILKSRRIAERVIAQLNLEKNKEFNPYIEPKQSFKSFVKEKVLALPMFKSEEAKVELTAEEQATKIRYAV
TQQEYYLTQFEILKSRRIAERVIAQLNLEKNKEFNPYIEPKQSFKSFVKEKVLALPMFKSEEAKVELTAEEQATKIRYAV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAHFQSKLLISPIRKTQLVRITFESLDPQLAADIANAVGEAYILEGLDARLDATEHASSWISGRMAQLQEQLKRSENTLI
LAHFQSKLLISPIRKTQLVRITFESLDPQLAADIANAVGEA                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFLANEKLVDDSGIDVQASTVINDLILRLSEVTDRRIQLESAYSTLSSGGSLAITDVSSVPEISKHPQVTNLRGLLANAK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REQTEFSKTYGPKHEKMIAVSAKRANLEEQLNQLIRQLVGGIGKELQAVRSQERLISRELDNRKQEFQNLTVKKRQYEAL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LREEETNRNILNIFLNRQKETTATGDFDSRNARFTDEALAPQSPAKPNKKLIVGLAMIAALLLSISVVLLLDAFNNTITS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKHCEDKLGIIPLGGIPKLNKFKKRVMGSDVFFSEKFMTFNESIRSARTALALANKNNKFITISSSLPNEGKTTCSINLA
                                                               SSSLPNEGKTTCSINLA
                                                                      GKT       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAFSKVENTLLIDCDLRKSAVAERFGHKRYKPGLTNHLLMNTDLDECFFVDERSGLTVLAAGMPTQNPQELLSSERFAQL
LAFSKVENTLLIDCDLRKSAVAERFGHKRYKPGLTNHLLMNTDLDECFFVDERSGLTVLAAGMPTQNPQELLSSERFAQL
         LLIDCDLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHQLSERFDKVIIDTPPALVVSDSMIISKITGKVVVVLRASSTRVATLRNTISRFMSHDVQFEGLLLNQISEGKGKQDYV
LHQLSERFDKVIIDTPPALVVSDSMIISKITGKVVVVLRASSTRVATLRNTISRFMSHDVQFEGLLLNQISEGKGKQDYV
          VIIDTPP                                                             YV
       730       
....:....|....:..
YGDYIHHLDKVPQAQQS
YGDYIHHLDKVPQ    
YGDY             

© 1998-2020Legal notice