BYKdb

Annotate results for A0A1C7EGR0

A0A1C7EGR0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C7EGR0
DOMAINcd51/237TSASHSEGKSTTSSNLAIVFAQEGKRVLLIDADMRKPTMHQTFKISNSKGLSNVLVRRVS
LKMAIQDSGIENLDLLPSGPIPPNPAELLSSSNMDLLFENALDTYDMLIFDTPPVLSVTD
SVILANKCEGTILVLNSGKTERAHALKAKDAITASKKTRLLGTVLNNVQVDKDFDYAQYY
IRPRSEK
SITE-188/-190GKT
SITEWalker A'78/85LLIDADMR
SITEWalker B158/164LIFDTPP
SITEY Cluster226/230YAQYY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVKKKIKPEVKNRKLIAFTNPRSRVSEQFRTLRTNIHFTVPGGKVRSLVVTSASHSEGKSTTSSNLAIVFAQEGKRVLLI
                                                  TSASHSEGKSTTSSNLAIVFAQEGKRVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADMRKPTMHQTFKISNSKGLSNVLVRRVSLKMAIQDSGIENLDLLPSGPIPPNPAELLSSSNMDLLFENALDTYDMLIF
DADMRKPTMHQTFKISNSKGLSNVLVRRVSLKMAIQDSGIENLDLLPSGPIPPNPAELLSSSNMDLLFENALDTYDMLIF
DADMR                                                                        LIF
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
DTPPVLSVTDSVILANKCEGTILVLNSGKTERAHALKAKDAITASKKTRLLGTVLNNVQVDKDFDYAQYYIRPRSEK
DTPPVLSVTDSVILANKCEGTILVLNSGKTERAHALKAKDAITASKKTRLLGTVLNNVQVDKDFDYAQYYIRPRSEK
DTPP                                                             YAQYY       
© 1998-2020Legal notice