BYKdb

Annotate results for A0A1C7E9H6

A0A1C7E9H6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C7E9H6
DOMAINcd51/234TSAAPGEGKSTTSANLATVFAQEGKNVLLVDGDMRKPTTHYTFHMPNTIGLSNVLTRQAT
VEDAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLISDLKKRYDVVIFDAPPVLSVTD
GQVLANKCDGAILVVNSGSTEKEMAAKAKEAIEASNSKLIGAVLNNFELAKDSYYYQYYG
NAEE
SITEWalker A58/60GKS
SITEWalker A'78/85LLVDGDMR
SITEWalker B158/164VIFDAPP
SITEY Cluster224/229YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKKQSLQQTARKVITHTTPKSFVSEQFRTLRTNVNFASPDLELRSIVVTSAAPGEGKSTTSANLATVFAQEGKNVLLV
                                                  TSAAPGEGKSTTSANLATVFAQEGKNVLLV
                                                         GKS                 LLV
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDMRKPTTHYTFHMPNTIGLSNVLTRQATVEDAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLISDLKKRYDVVIF
DGDMRKPTTHYTFHMPNTIGLSNVLTRQATVEDAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLISDLKKRYDVVIF
DGDMR                                                                        VIF
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
DAPPVLSVTDGQVLANKCDGAILVVNSGSTEKEMAAKAKEAIEASNSKLIGAVLNNFELAKDSYYYQYYGNAEE
DAPPVLSVTDGQVLANKCDGAILVVNSGSTEKEMAAKAKEAIEASNSKLIGAVLNNFELAKDSYYYQYYGNAEE
DAPP                                                           YYYQYY     
© 1998-2020Legal notice