BYKdb

Annotate results for A0A1C7CFH5

A0A1C7CFH5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C7CFH5
DOMAINcd41/233SSVEAGEGKSTTSVNIAISFASVGLRTLLIDADTRNSVLSGTFKSNEPYKGLSNFLSGNA
TLEETVCRTDIAGLDVISSGPIPPNPTSLLQNENFTHLLDVARSQYDYVIIDTPPIGLVI
DAVIVAHQADASLLVTAAGKIKRRFVTKAVEQLTQSGSQFLGVVLNKVDMTVDKYGTYGS
YGSYGDYGKKSEQ
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADTR
SITEWalker B149/155VIIDTPP
SITE-146/-148YDY
SITEY Cluster215/227YGTYGSYGSYGDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLLKLVNSKVNFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNIAISFASVGLRTLLIDADTRNSVLS
                                        SSVEAGEGKSTTSVNIAISFASVGLRTLLIDADTRNSVLS
                                               GKS                 LLIDADTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKSNEPYKGLSNFLSGNATLEETVCRTDIAGLDVISSGPIPPNPTSLLQNENFTHLLDVARSQYDYVIIDTPPIGLVI
GTFKSNEPYKGLSNFLSGNATLEETVCRTDIAGLDVISSGPIPPNPTSLLQNENFTHLLDVARSQYDYVIIDTPPIGLVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAVIVAHQADASLLVTAAGKIKRRFVTKAVEQLTQSGSQFLGVVLNKVDMTVDKYGTYGSYGSYGDYGKKSEQKSSHSRS
DAVIVAHQADASLLVTAAGKIKRRFVTKAVEQLTQSGSQFLGVVLNKVDMTVDKYGTYGSYGSYGDYGKKSEQ       
                                                      YGTYGSYGSYGDY             
      
....:.
QRRRKG


© 1998-2020Legal notice