BYKdb

Annotate results for A0A1C7C3G8

A0A1C7C3G8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C7C3G8
DOMAINtad1/135MTPLLKALLSRWYIVVAGILLGCAAAMALSATVTPQYRATTKLWVSVGGDAESSALELAQ
GSNAAQQRIRSYLDLVSQPIVLEPVIEELGMSTSADALARAVSATSPTGSVVMEVSVTSP
DPQRAAALAEAVARS
DOMAINcd274/460TSSRPSEGKTTTIANLAVALAEGGLRTVVIDADLRRPNLANVMGVEGSVGLSDLLIGRAE
LEDVLQPWGTAGLQLLPAGTIPPNPSELLGSPAFGALIEAVSEDFDYVLVDTPPLGSVSD
AALVSASVQNVLLVVASGRVRRADVSASIEALRTVGSTVQGAVVTMTRSRAGKDRYTEYA
YSAQPVV
SITEWalker A281/283GKT
SITEWalker A'301/308VVIDADLR
SITEWalker B381/387VLVDTPP
SITEY Cluster449/454YTEYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPLLKALLSRWYIVVAGILLGCAAAMALSATVTPQYRATTKLWVSVGGDAESSALELAQGSNAAQQRIRSYLDLVSQPI
MTPLLKALLSRWYIVVAGILLGCAAAMALSATVTPQYRATTKLWVSVGGDAESSALELAQGSNAAQQRIRSYLDLVSQPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLEPVIEELGMSTSADALARAVSATSPTGSVVMEVSVTSPDPQRAAALAEAVARSFTEVVQQRLDANANADGNAGAGTGV
VLEPVIEELGMSTSADALARAVSATSPTGSVVMEVSVTSPDPQRAAALAEAVARS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVTETSPPTVPTTPTEPRTTANAALGALAGGAVGVLAAFLWWSLDTKVRGRDEIQSTWDLAVLGDIGFDQEATKRPLILR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DERASVRAEAFRSLRTNVQFLASRPEGARTVAVTSSRPSEGKTTTIANLAVALAEGGLRTVVIDADLRRPNLANVMGVEG
                                 TSSRPSEGKTTTIANLAVALAEGGLRTVVIDADLRRPNLANVMGVEG
                                        GKT                 VVIDADLR            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVGLSDLLIGRAELEDVLQPWGTAGLQLLPAGTIPPNPSELLGSPAFGALIEAVSEDFDYVLVDTPPLGSVSDAALVSAS
SVGLSDLLIGRAELEDVLQPWGTAGLQLLPAGTIPPNPSELLGSPAFGALIEAVSEDFDYVLVDTPPLGSVSDAALVSAS
                                                            VLVDTPP             
       410       420       430       440       450       460       470    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
VQNVLLVVASGRVRRADVSASIEALRTVGSTVQGAVVTMTRSRAGKDRYTEYAYSAQPVVRGSAQRMRKRGSTA
VQNVLLVVASGRVRRADVSASIEALRTVGSTVQGAVVTMTRSRAGKDRYTEYAYSAQPVV              
                                                YTEYAY                    
© 1998-2020Legal notice