BYKdb

Annotate results for A0A1C6T1J1

A0A1C6T1J1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C6T1J1
DOMAINtad1/134MDLYRQLRLVRRHWWIVLVTLMVALGTTALVTIRSEPRYVASVTFFVTTPSEGVAAAYQG
GLFLQQRIKSYADLLVSDRLAQSVVAEGQVGLTAEQIQGRVSTSTETGTVLLRASVTDTD
QTRALKLTELLSAK
DOMAINcd266/454TSALQGEGKTTMSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDGGVGLTDVLVGDVQ
VGDVVQRWGDKSLLVLPSGSTPPNPSELLGSKAMADLLLGLRESADIVIIDTAPLLAVTD
GVVVAVQSDGALLVSQQGRTSRTQVAAAARALHAVSVRLLGCVLNMAKVPKADAYQYEAY
RVVAGLGTP
SITEWalker A273/275GKT
SITEWalker A'293/300LLVDADLR
SITEWalker B373/379VIIDTAP
SITEY Cluster440/445YQYEAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLYRQLRLVRRHWWIVLVTLMVALGTTALVTIRSEPRYVASVTFFVTTPSEGVAAAYQGGLFLQQRIKSYADLLVSDRL
MDLYRQLRLVRRHWWIVLVTLMVALGTTALVTIRSEPRYVASVTFFVTTPSEGVAAAYQGGLFLQQRIKSYADLLVSDRL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQSVVAEGQVGLTAEQIQGRVSTSTETGTVLLRASVTDTDQTRALKLTELLSAKFVDLVQKVETPPSGEPGPIKIEIVSG
AQSVVAEGQVGLTAEQIQGRVSTSTETGTVLLRASVTDTDQTRALKLTELLSAK                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRVSASPVSPQPLRNFTIGGLLGLVAGVALAVLRGMADVRLRDAAGLQRVTGSPLLGEIPLDTAARTAPLIVGEAATSAR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDGGVGLTDVL
                         TSALQGEGKTTMSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDGGVGLTDVL
                                GKT                 LLVDADLR                    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGDVQVGDVVQRWGDKSLLVLPSGSTPPNPSELLGSKAMADLLLGLRESADIVIIDTAPLLAVTDGVVVAVQSDGALLVS
VGDVQVGDVVQRWGDKSLLVLPSGSTPPNPSELLGSKAMADLLLGLRESADIVIIDTAPLLAVTDGVVVAVQSDGALLVS
                                                    VIIDTAP                     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQGRTSRTQVAAAARALHAVSVRLLGCVLNMAKVPKADAYQYEAYRVVAGLGTPSVPADRATSGRHAEHAAAGVSDRTQE
QQGRTSRTQVAAAARALHAVSVRLLGCVLNMAKVPKADAYQYEAYRVVAGLGTP                          
                                       YQYEAY                                   
      
....:.
LTRLPR


© 1998-2020Legal notice