BYKdb

Annotate results for A0A0S7WF54

A0A0S7WF54 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S7WF54
DOMAINtad26/206REVNLRDYWKVIRKRQWTIIAFFLIVVVTTAVGTFTMSPIYRGTATIQINKENPQIVDFK
EIFAVNTMDRDYYQTQYKLLESRNLARRVIDLLGLAEHPEFLSKPQSPLQRWRSRITNSL
AALFSSSDGDSSENDRESLLISGFLNRVKIEPMRNTRLVRIHFDSHYPELSSLVPNTLAT
Q
DOMAINcd552/740SSPNPAEGKTTTAINTAIALSQTGARVLVVDSDMRKPRVHSILGEENGAGLSNFLSGNTE
LKSIIKKSDIPNLYYIPAGPVPPNPSELLGSKLFKATMQFLGEKFDHIVFDSPPVLGFAD
ATILSASVDGIILVVQGGKTPRETLQRAKDILHQVNAKILGVVVNRVDIGRSDYGYYYYR
YHYYYGKEG
SITEWalker A559/561GKT
SITEWalker A'579/586LVVDSDMR
SITEWalker B659/665IVFDSPP
SITE-625/-626YY
SITE-689/-691GKT
SITEY Cluster725/736YGYYYYRYHYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRQAPSDEHYQIPPPGYYGSPFQEEREVNLRDYWKVIRKRQWTIIAFFLIVVVTTAVGTFTMSPIYRGTATIQINKENPQ
                         REVNLRDYWKVIRKRQWTIIAFFLIVVVTTAVGTFTMSPIYRGTATIQINKENPQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVDFKEIFAVNTMDRDYYQTQYKLLESRNLARRVIDLLGLAEHPEFLSKPQSPLQRWRSRITNSLAALFSSSDGDSSEND
IVDFKEIFAVNTMDRDYYQTQYKLLESRNLARRVIDLLGLAEHPEFLSKPQSPLQRWRSRITNSLAALFSSSDGDSSEND

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RESLLISGFLNRVKIEPMRNTRLVRIHFDSHYPELSSLVPNTLATQYIQQNLETRFVATEQAKEWLTGQLEVLKAKVERA
RESLLISGFLNRVKIEPMRNTRLVRIHFDSHYPELSSLVPNTLATQ                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEALQAFASKHGIVSLEEKENITMQRLTELNEALTKAESDRIAKEALYKQASEQDYDSLPPILENTLIQDLKQAYIQLDA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYMRLGETFKPEYPEMVRLKNQMDTIQRRLDAEAGRIIAGIRSDYQASLRRESLLRETFQRQKAKAMQMKQRAIQYNILK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
READTNRDLYNALLQRMKEAGVSAAITASNIQIVDGAELPTEPFKPNKRLNLLLATVVGLFLGFGLAFFFEYLDNTVKTP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDVEQLIQLPSFGMIPEIAYERRRRLDEGNSYPVELVTFAHPKSMLSEAYRNVRTSILLSFSEKPPKRIAISSPNPAEGK
                                                                       SSPNPAEGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTTAINTAIALSQTGARVLVVDSDMRKPRVHSILGEENGAGLSNFLSGNTELKSIIKKSDIPNLYYIPAGPVPPNPSELL
TTTAINTAIALSQTGARVLVVDSDMRKPRVHSILGEENGAGLSNFLSGNTELKSIIKKSDIPNLYYIPAGPVPPNPSELL
T                 LVVDSDMR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSKLFKATMQFLGEKFDHIVFDSPPVLGFADATILSASVDGIILVVQGGKTPRETLQRAKDILHQVNAKILGVVVNRVDI
GSKLFKATMQFLGEKFDHIVFDSPPVLGFADATILSASVDGIILVVQGGKTPRETLQRAKDILHQVNAKILGVVVNRVDI
                  IVFDSPP                                                       
       730       740       750        
....:....|....:....|....:....|....:...
GRSDYGYYYYRYHYYYGKEGKRKKLPYTSDRESNSQQI
GRSDYGYYYYRYHYYYGKEG                  
    YGYYYYRYHYYY                      

© 1998-2021Legal notice