BYKdb

Annotate results for A0A0A6P8E3

A0A0A6P8E3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A6P8E3
DOMAINtad19/193DEIDLRVFWHIFIKHKWTIFLLTSLIGILTTIVVFSLQPIYRSTAVLLIESDKANVISIK
EIYGIESFGKEYYQTQLEILKSWTLVEKVVKKLNLVSHPVYNQKKEESFLRNWLPSSWLS
PEVPLTAEKKRDAIIASLRDQLTISAIRNSRLVTISCDSSDKQLAAKVPNTLADL
DOMAINcd542/732TSSVPGEGKTTFSTNQALALGQMEKTLLIDADMRRPSIGKAFGLTKAPGLAELVAGTRKL
DECIHHLGEDQKVNLDVIPSGKVPPNPLELLSSPRFKTLLEKLSKEYAYIVIDTAPTMLV
SDALVLAKVATKVLYVVKADATPHQVVLDNLKRLRRVDAPVDSIVLNQIQTQKTSKYYYY
GKYGYYKNYYK
SITEWalker A549/551GKT
SITEWalker A'568/575LLIDADMR
SITEWalker B651/657IVIDTAP
SITE-648/-650YAY
SITEY Cluster718/741YYYYGKYGYYKNYYKSYYGGGHGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKQEPVDNERLTSQSDEDEIDLRVFWHIFIKHKWTIFLLTSLIGILTTIVVFSLQPIYRSTAVLLIESDKANVISIKEI
                  DEIDLRVFWHIFIKHKWTIFLLTSLIGILTTIVVFSLQPIYRSTAVLLIESDKANVISIKEI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YGIESFGKEYYQTQLEILKSWTLVEKVVKKLNLVSHPVYNQKKEESFLRNWLPSSWLSPEVPLTAEKKRDAIIASLRDQL
YGIESFGKEYYQTQLEILKSWTLVEKVVKKLNLVSHPVYNQKKEESFLRNWLPSSWLSPEVPLTAEKKRDAIIASLRDQL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TISAIRNSRLVTISCDSSDKQLAAKVPNTLADLYIESDLEAKLEMTNKAASWLTERVEGLRQNLSNSEKTLQEYMERKNL
TISAIRNSRLVTISCDSSDKQLAAKVPNTLADL                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INVEGVKSVAKKQIEETASNLVNARQEYAQANSVYRQVKALRGKGSEAYESIPAVLNNGLVQSLKQAELDAERKVSELSE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYGQRHPKIIAATSDLEKAKANTARQIQRVVEGLTKEYEVALANVKALERVLDDNKRKIKELNRKEYELKKLERDVAVNR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLYNMFLTRFKETDASQDVQSLQSTIGRLIDLALVSNWPYKPKKRMIVAISLLLGFIFSTMLAFSLEYLDNTIKDGEDVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKLGLPMLGSLPKLKLSNTEEFEPLWKFLKEPKTAFAESVRTLRTGAILSCLESEEKIFVITSSVPGEGKTTFSTNQALA
                                                             TSSVPGEGKTTFSTNQALA
                                                                    GKT         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGQMEKTLLIDADMRRPSIGKAFGLTKAPGLAELVAGTRKLDECIHHLGEDQKVNLDVIPSGKVPPNPLELLSSPRFKTL
LGQMEKTLLIDADMRRPSIGKAFGLTKAPGLAELVAGTRKLDECIHHLGEDQKVNLDVIPSGKVPPNPLELLSSPRFKTL
       LLIDADMR                                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEKLSKEYAYIVIDTAPTMLVSDALVLAKVATKVLYVVKADATPHQVVLDNLKRLRRVDAPVDSIVLNQIQTQKTSKYYY
LEKLSKEYAYIVIDTAPTMLVSDALVLAKVATKVLYVVKADATPHQVVLDNLKRLRRVDAPVDSIVLNQIQTQKTSKYYY
          IVIDTAP                                                            YYY
       730       740      
....:....|....:....|....:.
YGKYGYYKNYYKSYYGGGHGYYNSDS
YGKYGYYKNYYK              
YGKYGYYKNYYKSYYGGGHGY     

© 1998-2020Legal notice