BYKdb

Dataset for cluster orphancd of phylum thermodesulfobacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A496QKU4 [Bacteria] Bacterial tyrosine kinase [Thermodesulfobacteria][Thermodesulfobacteria bacterium] (length=305 residues).
MGKIADALDKARREPARKKDQLRPAGETRSREQKQARVQHEVSPKPVYPDTNVSKTDIQTGEEAGFVSEALQGPVDPKLV
VFHEPESPAAERFKVLRSQILYPKDGKDRRVILVTSAMEAAGKTMVACNLAVSIAQGVDPYALLIDTDIRKASVHRMLGF
EPAEGLSEYLQTDEPLSKYLIRTPMMKLTVLPAGRSVRNPAELLNSDKMRHLFEEARERYPDRFIIVDSPPVNLAAETSS
LAQNVDAVVFVVRYGYSNQDLIEEAIAKVGEDKVLGIVFNCFESTPGKYSYYKKKYPYYSSREQT
© 1998-2020Legal notice