BYKdb

Dataset for cluster orphancd of phylum thermodesulfobacteria

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A496QKU4 [Bacteria] Bacterial tyrosine kinase [Thermodesulfobacteria][Thermodesulfobacteria bacterium] (length=305 residues).
MGKIADALDKARREPARKKDQLRPAGETRSREQKQARVQHEVSPKPVYPDTNVSKTDIQTGEEAGFVSEALQGPVDPKLV
VFHEPESPAAERFKVLRSQILYPKDGKDRRVILVTSAMEAAGKTMVACNLAVSIAQGVDPYALLIDTDIRKASVHRMLGF
EPAEGLSEYLQTDEPLSKYLIRTPMMKLTVLPAGRSVRNPAELLNSDKMRHLFEEARERYPDRFIIVDSPPVNLAAETSS
LAQNVDAVVFVVRYGYSNQDLIEEAIAKVGEDKVLGIVFNCFESTPGKYSYYKKKYPYYSSREQT
>gnl|bykdb|A0A6G7PUV0 [Bacteria] Bacterial tyrosine kinase [Thermodesulfobacteria][Thermosulfuriphilus ammonigenes] (length=280 residues).
MGKIADALEKFNREKKTPLSTHSIHPEGPPKKEGAGGKDPSEASTSVPGTGALDPRLIVFTQPRSLASEHFKLLRARLIN
PRQGPVPRVVMVSSAMDKEGKSFVAANLAASVAQSLEYHALLIDCDLRKPSAHIYYGQNNDEGLSDYLQGRTPLPRLLKR
PPVEKLSLLTAGPPPNKPSDLLSSARMADLIEEVRSRYPDRLVILDTTPVQLTSEPVNLARFVDTVIFVVRYGKSKRELV
EDSIERLGRGKILGVVFNAFEIPPRKYSYFRSKKYYGYYG
>gnl|bykdb|A0A7C7RKI0 [Bacteria] Bacterial tyrosine kinase [Thermodesulfobacteria][Thermodesulfobacteriaceae bacterium] (length=276 residues).
MSKLEKALEKAKQTRDTGTDADTVVSGRPAPAGPVCLDPDYVHTRICKLDEASMQKEGLLSPYCHPVIMEQFNLVKSKLI
DRMNPDGYRSLLVASPKQDDGKTLTAVNLAISLTRDKTRTVMLIDTDFRRPSVTGYFGIEDGRGLYDHLSESVPLSELLI
NPGIPRLTILPAGTIKDHPADFLSGPAMHSFVTEVKKRYTDRFIIFDSPPLLAFSDGFELSSYVDGVLMVIRSQKTTSED
LKHALEILKGRRIFGTILNRVSKNGLPIKDYKKYYK
© 1998-2021Legal notice