BYKdb

Dataset for cluster tadcd of phylum lentisphaerae

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bykdb|A0A1G0YAS5 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium GWF2_57_35] (length=740 residues).
MNKFMEQPVQSGTGSAGIGGGSKKSFNVVDLKQYFFIVVKRIWLVALCFIVSLSVMVVILIRQIPEYQSVATLLLSRGLP
LPVRLKQEEMELILGDYIATQQRIIQSSLVINGARERLNLPGDEFNQKYRSLSVVPIWQTAIMAITVKGLDPVFCADFAN
ALAEEYLDFKAGERMDTSQATVISLTQQANRLHEELKKAEIQSLAFIRENSVVGIQERGNVAAEFLGSLSRQAATYRNQR
MLLEAQQPLLSQASDEVVLATLSYPIQIGTIPVPNSSMSTSSVNSVLGGGPESLIEYGVVEQPFWSALKRKKAVLEGQLV
SYRKKYKEEHPLVKETVSALQETDDALNVELEFALRQFYSQLESLSIREKSAERVEKEWEDQALEVSKKMQEYRNIQRNS
DRLQGLYDLVFNRLKEVDITLGIEPESVRIMERAKPPSSPITPRKLQSLFMAALVGLGIGLGLIFGLEYIDDSIRYPEEV
TQGLGIPFLGVVPSANWDPEDLRAHILANIDQKSGLAEAYRNVRSSLLLGKAKDRLKTLVITSAVPKEGKTTTCLNLAIS
LAQAGSRVLMVDADMRRGELHKFFGLEGGRGLADVLTGQAKPEAVIQRSGVPNLDLIATGPFPSNPAEIVLRPEMNSFLD
YARRTYDKVVFDCPPVMAVSEAAILASMVDGVITIVWAGHTSKKLAQLCARLIRERGAVILGCVLNNLEFSRVGYYYYST
YYGYYNYDYHYGKNEAGKRV
>gnl|bykdb|A0A1G0YCS8 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium GWF2_57_35] (length=706 residues).
MADSQQDTALHFLDYWRVIKSRKEIVMAVTLLIVITGVAVTFMQPKKYSSTVRILVREDSMDVDVFERQMIQGYNPFFLR
TQERILKSTPLLYAVIDNLNLQAVWGQQYNDDKSPITKEDALATLSSSIKIEQDRDTSLINISVTQEDRELAARIANEMA
AVYREQRLDVKRSELRRAIEVLDNEVQKQQEKVDQAESELERIRQEVGVSFLGQGFRADKVRLQQLEADRIASRVDMLVR
KARLNQLESLEGTELMNASSYVVMDQSIASIRQQLIDTEVALKLMLENMGVNHPDVKRLQAGVDELKKKLNESLVGLKIG
LNADYEVAKAKFDALEAELQAAKHSDIEDEKKKFLPFDRAERNVIIQRDILNALRARITQQGIEVEVPRTPVEVVEPAEP
ANKPSSPLVMLNILLSIFLGFGAGIGLAYFIEYLDTSVRTVDDVEQFLGLPVLGVIPQKIRPLIHEGPESPHGEPYRVLR
TNMQFSNKGIHGGAFAVISGGVGEGKSTTLFNLAYTCAQLGYKTIVVDSDLRRPVQHSILSMSNRIGLTNVLMKDSTLEE
CVKPTIVPNLSFLPSGRLPRSMMGIIDSQRMRELVKDLKSRYDYVFFDSPPIIGITDASILASEVDGVLLVVQYRKYPRV
ISSRAKRMVENVGGKLLGVVLNNINIMRDDYYYYYHASYTQYNPDGQEKVPAKTIAASADGKDSLF
>gnl|bykdb|A0A1G0YWH6 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium GWF2_52_8] (length=718 residues).
MTQDRSFQDHDYDIPEEQQTHWREYVRVLWEWKWITITAVVIGATLGLIQNFKAVPVYQATTPVELEADTPRIVNFQDVA
ATDTRSSDYLNTKVQVLRSRSLAEKVVKTLALNGNPDFLPGAGENADFAGALQGCVSAQLRRGTRIIDITAEHTNPKMAA
LVANGVAQEFVKLNSENRLSASMDAIRWLSTQAEQYKTQLAKSEAAVQEYREKTRDVSLEDSYNIVLDKLKSMNTAFGNA
KMARMSTETEWKQVQALLDSGRDAALIPAIASDGEVETLHQSLTQKQIAVSVLRERYKDQYPAMIVALSEQKEIENKLKQ
ACVAAVEKIKARYAVAKAQEESLVEPLAEQEKQALELSRKLVEYNRLKRNAESDRQLYDSLLMRMKEAGVTGKLEFNNMH
IIDPARVPGAPCRPDKKRNLTYAIVMGLLAGLVLSYGAHFYDDKIKTCKDIESYLGMPLLCEVPRIENKSDSDRATIVST
DPLSLASEAFSSLRATIGATPNAKDIKVLMVTSTAPGEGKSLVASNMAIAFAHDNLRTLLIDADLRHPTLYKDFQIKTQT
VRGLSQYLMDGCKREDVILKSGIRDLDIIIAGKIAKNPAELLGSARMRELIEQERQRYDRIIIDTPPVAVVSDAIVLLPR
VQGIIFVTHFRKLRRDAVARAVKKLREMGAPLIGNVLNNIDLKKHGYYYYPYHGSYRYPYYHKKDGRRRMESEEESES
>gnl|bykdb|A0A7C5AHC4 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium] (length=774 residues).
MSDSKDLIPVGSNLPERDSAWRFQAPAIEIDNSDVSSFLRTYWHVLLKRRRTIAAVTFVATTLAAIYAFKSRPVYEAVSK
VAVEAETPQIQTVQDLYQSRPTDATYLATQVDILRSDDLAWKTIEQLHLDQNAQFNPAARGADLSSGSPDAVKAGLIQAF
KDRLKVDLLQGTSVIQVAYESFDPALAARVVNTLVGNYTEYNFLTKYDATRQASAWMEQRLDELKDKVEKSQQALVNYEQ
QHSIVDLGNRENVMEQRLGSLTQDLTEAQNDLAQKQSLYQLAEANPKQAGILVQDQLLQQLQQKYGDLQTDYVNALAQYG
PNFPKVVRLREQIREVSSLMDQEQKQVLERLRHDYLAALGREKILSAAVDQEKAEIGKASQLLIQENILKHEFQTNEDLY
DNLLMHVKNATVSAGLRANNVHVIDHALIPTHPVPPKQGVDIAVGFLVGLMLGITIAFAEEGLDNSVKNAEDVERYIPAP
ALAVIPAAASVEPHRGWLAGGAKASPLRDVEVALTVAKAPTSPLAEAFRTLRTSVLLSTAPRPPQTVLVSSAQPGEGKTS
TALNLALSLAQRGGQVLIVDADLRKPAVAGALGLKEKKGLCGVLTGAYSLDEALVRIENLNGLWVLASGPHPPNPAELLS
SPTMEQLLKDLCGRFNHIVIDSPPLLALTDAIVLSALVDGVVLVVESGVTPRNALVRSFRMLQDAGARVLGTVVNKMDLR
VDGYYGYSYRRYYGSDYFKEKSDVVTTAVAAPADFASGTPQSRPSERPRPDVQE
>gnl|bykdb|A0A7C6UGI3 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium] (length=704 residues).
MAEEAQTTTLHFLDYWRVIRDRKEVILAVALLTIVTGTAYTLMMPQKFTAVTQLEVLEDSMDVDPFYDRQSSRLGYNPFF
LMTQQKIMTSRPILTQVIRNLNLQRVWGLQLNEDKSPITAELALQILTRNLRVEQDRDTTLMNISVKSEDPKLAADIANE
IANVYRDRRLNAKRREIQRAIDAMSNEVRKQQERVEEAEMELERIRQEQGIALIGKGMASYRIETASLSMLQSERSAARV
EMLVRKARLDQLEDLEGEKLMDAAAYIVQDPTLLGIRQQLIDSQVSLQLMIKNGVMGENHPEVLRLRGAVDELQRQLDSA
LTGLKAGIKADYEVARQKFEALEEELNRIKASDIASEGENYLPFDRAERNVSIQRDILTALRARITQTGIEVEVPRTTVD
IIEEAEPPTKPSSPLVVLNIFLSVVLGLMAGVALAFFVEYLDVSIKTVDEVEKYLDLPVLAVIPQQSRPLTEAGQSSGQG
ESYRALRTGLMLLARETKHKILAVISGGVGEGKSTTLFNLGYVYAEQGSKVLIVDTDLRRPVQHKMVGLNNRIGVANVLT
GEMKADEVIQQTGVPNMDMMPSGRLRRGSMGIMNNIRLRELLDTVKDNYDIILLDSPPILGVTDAAILSSEADGVLLVVQ
YRKYPKIISLRAKRMIENAGGHLVGAVLNNINIMRDDYYYYYHYTTKKYYGSTRHEQLEDAAEV
© 1998-2021Legal notice