BYKdb

Dataset for cluster orphancd of phylum fusobacteria

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bykdb|A0A1T4LVC1 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Cetobacterium ceti] (length=275 residues).
MELKSKRRVFFKEKANHEISESLRVIRTNLHFLDEKERGRTILVTSSTPREGKSFIAANYAMSIAITGKKVLLIDCDIRR
PRAHESFGKKVEKGLESILLGEKNSRDVILKEVEKNLDVLPTKYIKSNVTELFLGDRMKRVIEELRDEYNTIVLDTPPLV
VASDGAILSKYCDGVVFVVSYDQVSKSELEFSKKMLDNAGANLYGFVVNRVEKNGFSYGNYCYYNNNYTYYKDYYLDEER
GQSRSKPKSKMEKYMEKLKKAYRRELSGNQKGKKY
>gnl|bykdb|A0A349GTC6 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Fusobacteriaceae bacterium] (length=230 residues).
MFFNKEQDSHLAESLRILRTNLHFMEEKKNRIVIFTSTIPKEGKSTVSANYAMSVAMSGEKVLIVDCDIRRPRAHSSFGI
EVNKGLGEILLEKESLEDVILKDIEPNLDILPSTHLNHNVTELFLGNRMKNLLLELRKRYDLIVLDTPPLVISTDAVILS
EYSDGVVYVCGYDMVSKKQLVQSRKILDRAKANIYGVVVNKIDKDGYSYGNYGYYNYNYKYYDEYSKGEK
>gnl|bykdb|A0A369XZK7 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Psychrilyobacter sp. S5] (length=240 residues).
MDKQISSERKMFFKGDQDSHLAESLRVLRTNIHFMEEKENRIVVFTSTIPREGKSTIAANYAMSVAISGEKVLLVDCDIR
RPRAHSSFGIEITHGMGSVLLGDKKIEDVILKDIEENLDILPSKHLSQNVTELFLGNKMKDLLKALRGKYDLIVLDTPPL
VVATDAVILSEYADGVVYVCGYDMVSKKELLQSKDMLDRAGANIYGIVVNKIDKRGYSYGNYGYYNNNYSYYEEYIKGDK
>gnl|bykdb|A0A369XZZ5 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Psychrilyobacter sp. S5] (length=236 residues).
MAERNIFFKKGQNNQMAELFRILRTNIYFMGKKKNRVVVVTSTIPGEGKSTVASNYAMSVAIGKEKVLLIDCDIRKPRAH
SSFGIQINHGMGEVLSGEKKIDEVILKGVEKNLDILPSKHMDQNVSELFLGDRMRNILEKLRKKYDLIVLDTPPLMVVTD
ALILSQYGDGVLYVCGYDMVTKQEMNQAKKMLDSAGVTLYGVIVNRINKDGYSHGNYGYYNYKYKDYQDYFNGDKQ
>gnl|bykdb|A0A377GZU7 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Fusobacterium necrogenes] (length=274 residues).
MSKRKIFFIQEDNMEVTEAFRTVRTNLAFQNEKDIGRKIMITSSIPGEGKSTLAGNYGASLAIAGKKVLLIDCDIRRPRA
HESFGIKVERGLEAVLTENADPKSVILKDIIPNFDLLPTKHMKYNVTELFIGDKMKEVIAELENEYNTIILDMPPLAVAS
DAAILSKYVDGVVVVVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSDSDGNRK
KHIVKKPKSKFGRFMHAVKEQYKRQFSGDLKGKK
>gnl|bykdb|A0A414PP78 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Fusobacterium mortiferum] (length=274 residues).
MSKRKIFFIQEDNMEATEAFRTVRTNLAFQNDKEIGRKIMVTSSIPGEGKSTLAGNYGASLAIAGKKVLLIDCDIRRPRA
HESFGIKVERGLESVLTENVNPKDVIIKDLIPNFDLLPTKHMRYNVTELFIGDKMKEVISSLENEYNTIILDMPPLAVAS
DAAILSKYVDGVVVVVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSDSNGNRK
KHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK
>gnl|bykdb|A0A6N7VPP3 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Fusobacterium sp. FSA-380-WT-2B] (length=274 residues).
MSKRKIFFIQEDNMEATEAFRTVRTNLAFQNDKEIGRKIMVTSSIPGEGKSTLAGNYGASLAIAGKKVLLIDCDIRRLRA
HESFGIKVERGLESVLTENVNPKDVIIKDLIPNFDLLPTKHMRYNVTELFIGDKMKEVISSLENEYNTIILDMPPLAVAS
DAAILSKYVDGVVVVVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSDSNGNRK
KHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK
>gnl|bykdb|A0A7G9GVB4 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Fusobacterium sp. NSJ-57] (length=272 residues).
MHKIFFVDEDNIEVTEALRTLRTNLSFLDDKEKGRTILFSSSIPAEGKSFVAANYAASIAIADKKVLLIDCDIRRPRAHE
SFGIKVQKGLESVLTNNTPVDEVIIKDIMPNLDLLPTKHMKNNVTELFVRDRMKTILEEIKNDYDVVVLDTPPIAVASDA
VILSKNVDGVVIVIGYDQVAKRELEFTKEMFTNAGANLYGFVVNGVDKSGLSYGNYGYYNNYYTYYEDYYMDDDNHKVRK
KVKTPKNKIKRFIYNIKSAYIKHFSGDIRKRR
>gnl|bykdb|A0A7X1HJ52 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Cetobacterium sp. 8H] (length=245 residues).
MSQNLFFNDDNIQLSESLRVIRTNLFFLNNKEAGRVILITSSVPKEGKSLLAINYAYSIAITGKKVLLIDCDLRCPRLNE
AFNLNFNHGLESLLANNLEHEKIVIKNISKNLDFIPSKTVTSNPTELFLNDKFLTLLNTVKNNYNTIIIDTPPLTIASDA
AILSKLSDGVVYVVAYDEVSAEDLKFGKELLKNAKANIYGFVVNKAEKNIGNYGRKYPYDYESSKDSKKSIFSLNFIKTF
FGGRE
>gnl|bykdb|A0A7X1HM01 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Cetobacterium sp. 2G large] (length=244 residues).
MSQDLFFDNNIQLSESLRVIRTNLFFLNNKDFGRIILVTSSVPKEGKSVLAVNYAHSIAITDKKVLLIDCDLRNPRLDEA
FNLKFNFGLESLLFNDLDIEKIIIKNISKNLDFIPSKVVASNPTELFLNDKFLTLLNKIKNDYNTIIIDTPPLTVASDAA
ILSKVSDGVIYVVAYDEVNAEDLKFGKELLRNAKANIYGFVVNKAEKNIGSYGRNYSYYGDSSKNSKKSKFSLNFIKKFF
GGGE
>gnl|bykdb|A0A7X1HNF5 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Cetobacterium sp. 8H] (length=275 residues).
MEKSKRQLFFKDSENHEMNEALRVIRTNLHFLNEKEEDRIVLVTSTTPKEGKSTIASNYAMSIAITGKKVLLVDCDIRRP
RAHESFGVNFKMGLESVLTGKTVINDVILKDVEKNLDILPTRYMAHNVTELFLGDKMKTLLEGLKGEYNTIVLDTPPLIV
ASDAAILSKHCDGVVYVVAYDQVAKRELEFGKTMLENAKANLYGFVVNRVDKNGLSYGNYGYYNNNYSYYKDYYTEEGEN
LSRTYVPKKGFKGFVEKLKRDYKRQLSGDQKGKRW
>gnl|bykdb|A0A7X1HR52 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Cetobacterium sp. 2G large] (length=276 residues).
MENRTKRQLFFKDADNHEMNEALRVIRTNLHFLNEKESERTVLVTSTTPKEGKSTIASNYAMSIAITGKKVLLIDCDIRR
PRAHESFGVSFNSGLESVLSGECQVDDVILKNIEENLDILPTRNVAHNVTELFLGDKMKTLLDRLKKEYNTIVLDTPPLI
VASDAAILSKHCDGVVYVVAYDQVAKRELEFGKTMLNNAKANMYGFVVNKVDKNGLSYGNYGYYNNNYSYYKDYYTEEGE
ALARAYKPQKGFKGFIEKLKRDYKRQLSGDQKGKRW
>gnl|bykdb|A0A842IYV3 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Cetobacterium sp. 2A] (length=238 residues).
MKKEESQRRLFFKGDKEDQVAESFRLLRTNIHFMDEKTNRVVIVTSTIPKEGKSSVASNYAMSEAIAGKKVLIVDCDIRR
PRAHTSFGIQVTKGLADVLAGNAKIEDVILKDVENNLDLLPAKHFQGNVTEMFLSKNLSKQLDTLRALYDLIILDTAPLT
VATDAVLLAEHGDGVIYVVGYDMVTKKELEHAKKLLHRAKANLYGVVMNKVDKTGYSYGNYGYYNYNYRYYNDYITEE
>gnl|bykdb|U7VC77 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Cetobacterium somerae ATCC BAA-474] (length=279 residues).
MEEMMDRSKRQIFFKDANNHEMNEALRVIRTNLHFLNEKEVARTVLVTSTAPKEGKSTIASNYAMSIAITGKKVLLVDCD
IRRPRAHESFGVSFDKGLESVLAGECEVENVILKDVEKNLDILPTRNVAHNVTELFLGDKMKALLKDLKGEYNTVVLDTP
PLIIASDAAILSKHCDGVVYVVAYDQVAKRELEFGKTMLNNAKANIYGFVVNKVDKNGLSYGNYGYYNNNYSYYKDYYTE
EGEALARAYKPQKGFKGFIEKLKRDYKRQLSGDQKGKRW
© 1998-2022Legal notice