BYKdb

Dataset for cluster orphancd of phylum candidatus-atribacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A3D3DCV6 [Bacteria] Bacterial tyrosine kinase [Candidatus Atribacteria][Candidatus Atribacteria bacterium] (length=248 residues).
MEVKKLSPKLKKLDKEFENIFIVQNDLKSPISEAFRTLRTNIRFSSLDKPLKTLLITSPIPEAGKSFVSVNLALTIAQNE
NKVILVDADLRRPVIHKIFEGNNKPGLTNILVEDKKIEEVIRRVSGIDPNLYYIPSGPIPPNPSELLGSNKMQEVIEELQ
KQADLILFDSPPVIAVTDTLVLANQVNGVVLVLDVGEVSRDVAKQAKILLEKVKAKILGVILNKVDMGSEGYYYYYYYDD
ERKKRRSQ
>gnl|bykdb|A0A7C2R115 [Bacteria] Bacterial tyrosine kinase [Candidatus Atribacteria][Candidatus Atribacteria bacterium] (length=235 residues).
MFVVQNDPKSPISEAFRTLRTNIKFSSLDKPIKTLLITSPIPEAGKSSISINLALTMAQDKYKVILVDTDLRKPTIHKIF
EQDNKTGLTNILVEDKKIKDVMRKMSDVDPNLYFIPSGPIPPNPSELLGSNKMKELLKELQEQADFVIFDSPPVIAVTDA
LVLATQVDGVVLVLNFGEVPREAAIQTKELLNKVKANILGVVLNKIDMEKEGQYYPYYYYYYYGDETKKKKQKRK
© 1998-2021Legal notice