BYKdb

Dataset for cluster orphancd of phylum balneolaeota

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bykdb|A0A345UMN6 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Candidatus Cyclonatronum proteinivorum] (length=798 residues).
MELENNERRKSMRSNGASEDPFNPGAIPGEEDDQNDPFDPQLILYSLWDGKWIILACVVILGALGYYYTQTLPNQYRTTG
LFLIENQRADRGLNLFEFTRARNLTWDEVGTEMQFIVNSHELAENVGRRLIQELVNPVTGDTLPMLRQNGLGFMPEEQVL
QRLARRLPNRISLHQIDQMNLVEIRTTSFDPQEAAFIANFYIEEYRILDETITRSNLTSAASYLEQLEERNTMTLGEQDE
QIRMFLDSDWTLITDEQGTAAAQELRGLFREAEELRFRKVAVSDFLDRLREEKDMVLNMLYDGATDNDMELVNAFEQAIL
DLRLQAESFYIEQPQLRTNPEGNSVLSQILRRIDYLEGLRDERLESQRDRVRDRQGLDQASLASYLTDIRSEIRSNEARL
VDMQLREDFIAERVDDIQSDMSSIMERSAELQRLRRNQVISEELYLNLLKRLQETQIAIQSEVSRVREIRAASVPSSPFS
PNRLRNYILSLILGFGLGAGIVLLRNLLDDLIHDPGQLRNAGFNVIGVIPDFTDYINTHFKNTERLPIRGRSVDVNLISL
IDPISAGAEAYRRLRTSIEFSNADREYQTLVVTSSKPGEGKSLTSINLALTYAQFGKRTLVIDCDLRKPTIHKKLGLDKS
PGLTDILFDKDTLENCLIDASTDNFFVITAGNSIPNPAETMGSKRMQELLSSLKKEFDIIILDTPPLLVVSDAMPLAVAT
DATVLVSKMDETELSILKETRQDLRNLGVNIAGSVLNAYDTNSVKSYYKYNYKYNYKYKYDYAYKDYKLDYTDQPDQK
>gnl|bykdb|A0A356WWN1 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneolaceae bacterium] (length=331 residues).
MNLWERTQFGMGRPLDYAVVPNNPIKPQKKLWVLIGFLLGGILGVGFIFIKEALDDTIKSSDALRSYKVPFLGNIPDYNI
IDSFDPGQKQYVQGKPVSNQLLTFLDHISPISEAYRRLRINTIYANPDKDYKVLMVTSSTKGEGKSTIAANLAVTFAEAE
KSVLIIDLDLRRPTMHKIFGENKEPGIVEMLFDTAGFDSTINPTIAPNVDLLTVGKKTPEPASVLDSRRLKDVIDKLKDK
YDHIILDTAPYGIISDSASLLRLTDGIIVVSRFATTTHKELEFTLNGLKQLNAEIVGLVLNAFDPKKSSDYYTNYYYYKR
AYSDYYEEDKA
>gnl|bykdb|A0A3D2IJ12 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneola sp] (length=435 residues).
NEILKVKRQIKDRTNNLLSSGSDLYLSFIGSGDGTLTQRIAEISQKLIELKVEQAQLKTQENIISKRYAEVNNRLEDLPD
EIIQLARLKRNVRVNEEMYLQVSSQFAEMSLWEKTQFGLGRPLDYAVPAKEPVKPKKKIIVVVGFFMGCVLAVGFVLVRE
MLNDTITSTDALKEFQKPVLGAIPDFSVIGELDPNERQYIGKKSVSNQLITLFDHISPISEAYRRLRINVVYANPDKDYK
ILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPGLSDALFDSTIDARLSTVAPNVDLITV
GHKTPEPASVLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLIDGLIVVSRFNVTTKRELKFTLEGLEHLNAD
VLGIVLNAFDPKKSTDYYTNYNYYKRTYSEYYKYR
>gnl|bykdb|A0A3D4V2H8 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneola sp] (length=301 residues).
PKKKIIVVVGFFMGCVLAVGFVLVREMLNDTITSTDALKEFQKPVLGAIPDFSVIGELDPNERQYIGKKSVSNQLITLFD
HISPISEAYRRLRINVVYANPDKDYKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPG
LSDALFDSTIDARLSTVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLIDGLI
VVSRFNVTTKRELKFTLEGLEHLNADVLGIVLNAFDPKKSTDYYTNYNYYKRTYSEYYKYR
>gnl|bykdb|A0A6C1NYF2 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneolaceae bacterium] (length=808 residues).
MNQKHPHEDLPSLSEIREILLSGKWWIISIFLFAATATYLYVSTLTPEYEARSTIFVDLSQQNEIPGFGAGDQRSAAAMS
ERLAADIAIVQRSSDLAEQVARRLISVGFSPFDGEQLPILIQYVDPDTANNSLTTRFNRMLGTSTDNPANYVMLDVPRVA
RRIPRHITIMPIRGVPNMFDIIAVSSNPGEASLLANIYAEEYARYDRDRSREKIRATLQYLQTLERDQHQSLRSYETQIR
KFLETDYSLVTDPAGQRAAEQLSDLYRQIDETQHQINTTRRLLEILKKEEEDTRQLLSVSRSTNIDQQITVIRSRILDLQ
IQAEDYYIERPELRQFPERNANLNAIVSRIQSLEASIERLNREVSENIQRGVMSQENLTTMLQQLRQDYNREDANLQALE
ERLIFLRNQANEFQGNVYSSLEKSHRLSDMERDRRINEELYTRLLTTLQETQIAERAELGRVRIVSEAGIPGAPARPNKL
LLMVLGMGLGLALSIGILFVKRMMDNTIHTPEELRQRGFNVLSAIPNMEAYKGLVKPAHKLKPVNGLKADARLVVLHEPL
SPVSESYRRLRTNLLFSNVDKPVKSILITSSIPGEGKSLTAVNLAVVMAQAGKRTLLVDADLRKPAATNLLGLPAEPGLS
DTLFRNGGLTIDEFTTPIDNLYVLPSGKPISNPSEFLGSKRMDEFIDAISASFDIVIFDSPPLQLVTDASILANKVDATI
IVAQGDETTWQILENTRQYLQDVGVYVAGVVLNRFNFKSSTGYSRYGYEITYGKTYGASGNGNGSIGKRKTGKADSKPAG
LVQSKQSV
>gnl|bykdb|A0A6M1T8Y1 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneolaceae bacterium YR4-1] (length=778 residues).
MKATKSTFSQDLFDPKKIVPLVQRHVWSILIFTILSVLVTYYTVNNYLLPVYQSKGTLIITTNENTLPGSGGARGGVGSG
VGDIVSRSFTSNFGNPVQNAIYLFRAQDLSDQVAKDLIASFDSTNYQGYTTLWLKYPEDSTIISLDRASSRIRNGLSVKT
VEPTGQRFEPNLLEISYQSYSPKEAAKVVNLALETFQEKSLEQKQKSASRALSFLQEKKLEANAQLDDAEERLVNFKDEN
QLVAIDEQASNSVNSLSELQAEKQTLEIELESINTSINNYEQQVEAIKPGLKDQFTNAIGPTISRFQDRLADLKTRRFVI
LSQNPQLKENPDSEPELRRLNQQIKEVEEEIQKLSEGLLNDTQGFTDTGDGNLAEELSNIRQNLIGLRLNKNQYESQIEV
LNERIKDAESFLDSYPDKQVKLARLEAEVERHKQYLSNLISQESEIALWQQTQNSSGTIVDRANPRYSPVKPNKILWLGF
AAMVGIILPIGLLILKNGFSTIINSSEQLKYFPYPLLSVIYDHSLIKTNSWFSSNDSDVKGTGISKSVVFYHYIDTPVAE
SYRKIVSQLLYTNPDSIPKSILITSSGKGEGKTTLTANLGAAFAEIDKKVLIIDCDFRRPAVHKLFSIDNSDGINEVLFE
GSKLSGAIKESGIEGLSLLPTGGKPMSPANLLASDKFKEMIKVVCPNYDIILFDTPPHGLVSDVASLLNLTDSVIVAAKF
GETKINVLSHTLDDLDNNEETNLSLVLTAYKPDKSYDSYETKGLHTYRYSQYYEYEKV
© 1998-2021Legal notice