BYKdb

Dataset for cluster orphancd of phylum armatimonadetes

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bykdb|A0A3C0CSI4 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=450 residues).
QEIDKLNSTRAELLQEYIPSSREVKKVDGQIEDAEQRLKKVAQTVLSTTTNSRNPLWENLLKDFSGSIAESSALDTKVQV
LNRCLVQREMDFKVLPELERELTTRIQNIAILERTYDMLSQKYYTLLLSEQSMLPNGILISKPRVPEAPSYPRTDRNIAL
FAMLGIMLSVVVAIVVDRMDIRVHDPSVMAGIADLPSLASIPFMDNEDAAYKQIGKLKHNSIFLESFRILRNNIMFSAID
NPLKVLAVSSPGPGEGKSTLAVNLAIAMAMDGKKVLLVDCDLRRPSIHNWMSLSREIGLTNVVKGLSNIKDAVCSTDIEN
VFCLPSGPLPPNPTEFLNSKHSRNIIKELSGMYDMLILDCPPCTGLSDVQVISTMADGVLLVVTINRTLKTYLHMALSTL
SQVKAPIIGYVLNMVDSRRQGYGYYYNYDYDEQGGRNKSKRRCCMPKSKN
>gnl|bykdb|A0A402CP56 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Capsulimonas corticalis] (length=713 residues).
MQSEPLLIESEESQPVMSPQDYVSILRRRRNTIVTTWILISAFGIIVTMATRNVYQATAKLLVDGPSMMVSQVESDNNLA
SLFNIGSEQTVDTKVEELQAGPLINTVDKLSNHAKLTVTAVKGTNVIDIVGESTDKVAAAAAPNTLIQLYLQTTAETDLQ
EVHKAQKFAQKQMTDAQARLDKANRALELLKQKHGFVDIAKSRDDQIARVSSLTQQLQQARAELAGARAQVSGLSNLVSA
EPATLDVQLRQTNTEIAEIKSKITQRELDRRQMTLPGGFTAKAPQVRALDSEIAGLKSQLAALPAVSTTMTSNPNTVREN
LRAKVASSEGDVASLEARVLETQTLLEQAKSELATYPSLEAPAEQYQNEHDTALASYQMYATTLQNLNLREQARHVSAHV
IEPAVVPTEPIRPKRLLNFLFAIIMGGVIGILMALLQEYLDDRLNSTEDAERLLGLPSLGRVPQLSRDDALLLSNMSGPH
PELEAYKTLRTNIHFAAIDTPFRSLQVTSSSPGEGKTTTATNLAYAMAADGKRVILIDTDLRRPSVHKHLDLAQTPGITE
LLVGDATLHEALQVSPNFPNLSVLAAGTIPPNPSELLNSQKFRTLVDQLSARFDIIIFDSAPVLAVADAQIVASQADGVV
LVVANGETRKAAAKQGLNLLRRARANVIGVAFNKMNVKDNMYYYRYTAETSTEALPGRNGHSTRQIETEGTKK
>gnl|bykdb|A0A7C2GZA4 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=710 residues).
MTQQKPTPKAGVPQHESDWLLYLWMISRRWPLLLLTTVIVLGAAIGYSRFVPPVYEANSLVRMRKSPPLQVFGTNQPTPE
EENLNLNTAAQLVTTYLTAQEAQELLQKPPLRDKVSQATREYLRLLAPQEILEFTRTTPIEPDLVRITVHHPLPEVAAAL
ANGLAEAFVQRLNRETRAEASNERQFIENQLKAIEGQLRQLDTTIAQVYRQLKAVDVSAETKSIIDAVRTYTADLLTVES
ELRSLNASIAKLRETAARQGPVISVEVLKEDPAVTELQRQLATLEVDRANLVARYTPEHPLVKEVDARIAALRQTISQRL
GRVVKGSETVPNPNYTTLQQHLMDLETRRLSAEARRQALLSLLQQTQKQIEQLPEDRRKIGELNRRLQVLEQAYTNLLGR
LQDAQIREASRLGNAMIADVATVPQRPVAPNLPRLLLLALLVGLAAGVVLALSLELSKATVETTEEVRHLLGAPVLGLIP
QTRQGLTQTQIVELMRSQRRTAETIRTIRSNLKFLSRKRPFRTLLISSAISGEGKTFLAAALGIAYANAGYRVILVDADM
RHPDMHRHFHLTDGIGLREVLDGTVTLDEALRAGPLPNLWLLPAGTPPPSPSELLDNPTMQRLLGALKERADIVLLDSPP
ILPVTDATVLAPIVDGMVLVISAGTPRAALLKAREQLELAEAPLLGVVMNKVTPKNTRGYYYYGYYDSVD
>gnl|bykdb|A0A7C2JN73 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=710 residues).
MTQQKPTPKAGVPQHESDWLLYLWMISRRWPLLLLTTVIALGAAIGYSRFVPPVYEANSLVRMRKSPPLQVFGTNQPTPE
EENLNLNTAAQLVTTYLTAQEAQELLQKPPLRDKVSQATREYLRLLAPQEILEFTRTTPIEPDLVRITVHHPLPEVAAAL
ANGLAEAFVQRLNRETRAEASNERQFIENQLKAIEGQLRQLDTTIAQVYRQLKAVDVSAETKSIIDAVRTYTADLLTVES
ELRSLNASIAKLRETAARQGPVISVEVLKEDPAVTELQRQLATLEVDRANLVARYTPEHPLVKEVDARIAALRQTISQRL
GRVVKGSETVPNPNYTTLQQHLMDLETRRLSAEARRQALLSLLQQTQKQIEQLPEDRRKIGELNRRLQVLEQAYTNLLGR
LQDAQIREASRLGNAMIADVATVPQRPVAPNLPRLLLLALLVGLAAGVVLALSLELSKATVETTEEVRHLLGAPVLGLIP
QTRQGLTQTQIVELMRSQRRTAETIRTIRSNLKFLSRKRPFRTLLISSAISGEGKTFLAAALGIAYANAGYRVILVDADM
RHPDMHRRFHLTDGIGLREVLDGTVTLDEALRAGPLPNLWLLPAGTPPPSPSELLDNPTMQRLLGALKERADIVLLDSPP
ILPVTDATVLAPIVDGMVLVISAGTPRAALLKAREQLELAEAPLLGVVMNKVTPKNTRGYYYYGYYDSVD
>gnl|bykdb|A0A7C2MZ04 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=619 residues).
FEQILCKTADPLDIEGCILTRAAQIERRTPSVPKEEEDFEQDIQGRLIEDTGLIELFAEARSPRRAQDAANAAALLVVWQ
NERLRKEEARNTVRFIRNQLEAPGGVKQQLAEADEKLASFQREKAFLDANEQIRALMQQMVELSNRQWQGNLRLTDLRTR
LAATRQRLGQEPSTLVSPTIYENPTVQEIKKQLVTAEADLLALQAQFTDEHPRVQSALARVESLRERLRQEAARIESVQR
LPNPVHQELYKNVALLSADIVGQEAQMRALEETLRSIRQQMLAVPELEKQLTRLLRQRQALEKRYLFLMERLQEAELTQA
VKLGNARVVELAQLPGKRVKPRRILNMLMGTVLGALLAIGFALLLEQIDRRVPSAQQASEWLNAPLLGSIPAVRDGAESP
VLNQPAAVEAFRNLRTTLRLSSQSAPIHALMVTSPSPGDGKTFVSRHLAVSIAQSGQRVVLIDADLRLSMQHRFEGIPLS
PGLSNILLGESKLEECLRQAGVDNLWLLPAGDVPPNPTELLESARMEEILAQLREQYDMLIMDVPPVEMFADARVLALHS
DAILMVLQPGATLRDAALHAVETIHTVPEARFLGIVANRVPVSTNSYGPYYPSVRRRGS
>gnl|bykdb|A0A7C2X570 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=708 residues).
MTQQKPTPKAGVPQHESDWLLYLWMISRRWPLLLFTTVIALGAAIGYSRFVPPVYEANSLVRMRKSPPLQVFGTNQPTPE
EENLNLNTAAQLVTTYLTAQEAQELLQKPPLRDKVSQATREYLRLLAPQEILEFTRTTPIEPDLVRITVHHPLPEVAAAL
ANGLAEAFVQRLNRETRAEASNERQFIENQLKAIEGQLRQLDTTIAQVYRQLKAVDVSAETKSIIDAVRTYTADLLTVES
ELRSLNASIAKLRETAARQGPVISVEVLKEDPAVTELQRQLATLEVDRANLVARYTPEHPLVKEVDARIAALRQTISQRL
GRVVKGSETVPNPNYTTLQQHLMDLETRRLSAEARRQALLSLLQQTQKQIEQLPEDRRKIGELNRRLQVLEQAYTNLLGR
LQDAQIREASRLGNAMIADVATVPQRPVAPNLPRLLLLALLVGLAAGVVLALSLELSKATVETTEEVRHLLGAPVLGLIP
QTRQGLTQTQIVELMRSQRRTAETIRTIRSNLKFLSRKRPFRTLLISSAISGEGKTFLAAALGIAYANAGYRVILVDADM
RHPNMHRRFHLTDGIGLREVLDGTVTLDEALRAGPLPNLWLLPAGTPPPSPSELLDNPTMQRLLGALKERADIVLLDSPP
ILPVTDATVLAPIVDGMVLVISAGTPRAALLKAREQLELAEAPLLGVVMNKVTPKNTRGYYYYYDSVD
>gnl|bykdb|A0A7C6TC25 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=614 residues).
ALSVTIEEPDILAISVEHTDPGRAALIANVIQDAYIQQNTALARSETTSAKQFLESQMEVLKQDMQRIEGEIRRFKARHN
IPDSVAQAAAATAPMSESGVSLVETQMAVLAAEAELAGLRRRLASVSPTRRVQRAVEDPVLDGLRQAVVETEVELARAQS
RYADTHQRVLAIKDELERLRGLVQERAAQATVTEVEEPNPLYIALEERIREGEIQVEVQRARAEALASAAAKQDPATPGK
DPKAFMELVALGRAKEIAERTYGQLLEQLQQVRLNEAQQQGTARKVDIAEVPERPVHPTPQRTLAIAALLGLVAGLSLAL
LQELADTGVRDPDELLMRTGISSLGFIPATRDTGRTIKIAARSPRSPITESFRTIRSNLKFAHLDSPLHTMMVTSAGAGE
GKSFTATNLAIVLAQAGVDTLLVDADLRRPTLHRIFGIQRTPGLTTVLTGETPLHEAIQATDVANLRIIPSGSVPPNPAE
LLDSRRMRQLIEEMKEIAEIVIFDTPPALVVTDAVVLSPRVDAMVLVVEQGRVTSRALAEIRRMVEQARGKIAGAVFNKV
KSGASGYYHYNYYRYYYYGDRSPGDGQQHPPAAPLTAVDNGRDLSRSKGPDEEA
>gnl|bykdb|A0A7C7KXP9 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=270 residues).
MDRITKALELAREKRAAVGGGHAAALQPAVLAGDMTHGLVREVEISPEFLREQKVIAGFKDQPLADSYRLLRTRLLQRMR
QNGWTTLGITSTAPNAGKTLTAINLGVAIAMDSNHSVLLVDVDLRKPDVHKVLGVTPEYGLVEYLTSNISLADVLISPGI
ERFVFLPCVEKTQGTSELLATKKMAHLVAQMKVQSPSRIVIFDLPPILVGDDVVAFSSNLDAVLIVVEDGKTDSRHLARA
AELLDGTHLIGAVLNKSREPVAEHYGHYGY
© 1998-2021Legal notice