BYKdb

Dataset for cluster orphancd of phylum aquificae

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A662CMM0 [Bacteria] Bacterial tyrosine kinase [Aquificae][Aquificae bacterium] (length=276 residues).
MEKLLRLPVLGVVPSITLKKRKKEEKADGLLIDFYAVNSPKSPAAEAFRMVRTSLMLAAAGQPPKTVLVTSPQVGGGKTL
IALNLAAAYAQMESRVLLVDCDLRRARLHRVLNVKANPGLSNYLAGRVDLGQIVHQVDGILGDGVTIDFISAGTVPPNPV
ELLNSKSFVHLLELLRERYDHIVMDSPPLVGFADALVLSRLVDGTILVLRNQQTPKPAAKYARDRLFQVGGNILGVVVND
VRVERGAYYYGKYSGYYYYYSKYYSYGSSPELPGKS
© 1998-2020Legal notice