BYKdb

Dataset for cluster orphancd of phylum aquificae

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A662CMM0 [Bacteria] Bacterial tyrosine kinase [Aquificae][Aquificae bacterium] (length=276 residues).
MEKLLRLPVLGVVPSITLKKRKKEEKADGLLIDFYAVNSPKSPAAEAFRMVRTSLMLAAAGQPPKTVLVTSPQVGGGKTL
IALNLAAAYAQMESRVLLVDCDLRRARLHRVLNVKANPGLSNYLAGRVDLGQIVHQVDGILGDGVTIDFISAGTVPPNPV
ELLNSKSFVHLLELLRERYDHIVMDSPPLVGFADALVLSRLVDGTILVLRNQQTPKPAAKYARDRLFQVGGNILGVVVND
VRVERGAYYYGKYSGYYYYYSKYYSYGSSPELPGKS
>gnl|bykdb|A0A7C0Y829 [Bacteria] Bacterial tyrosine kinase [Aquificae][Thermosulfidibacter takaii] (length=385 residues).
MIRSALERQKKKTAELRQKAIDYNILKREVETNRRIYELLLQRSKEMDVEASVRSTSIRPIDRASIPLSPYKPRKMLNLL
LSLIVGLMGGVFLAFFLEYLDNTIKTPDEVEKLLRLPVLGVVPSITLKKRKKEEKADGLLIDFYAVNSPKSPAAEAFRMV
RTSLMLAAAGQPPKTVLVTSPQVGGGKTLIALNLAAAYAQMESRVLLVDCDLRRARLHRVLNVKANPGLSNYLAGRVDLG
QIVHQVDGILGDGVTIDFISAGTVPPNPVELLNSKSFVHLLELLRERYDHIVMDSPPLVGFADALVLSRLVDGTILVLRN
QQTPKPAAKYARDRLFQVGGNILGVVVNDVRVERGAYYYGKYSGYYYYYSKYYSYGSSPELPGKS
© 1998-2021Legal notice