BYKdb

Dataset for cluster tadcd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

223 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2A2XVF1      MSKRVDFPRRAFCEFRGIFVRFVFLFLIGMSVAAEPSNEYKLAPNDLLDFRVFQEPELDA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      VVRVSGDGQAIFPLVGGVAIAGASISEAIELIKSRYRDGYLKNPQVTLTVRSYAKKLFTI
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      --------------------------------------------------MSEENPNTGS
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      LGQVQQPGSYDIQSQIRGMSPLSVSRMVVSASSSLTRNAWRAVMKKPRSSSRREMSSPSA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ---------------------------------------------------------MRP
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      -------------------------------------------------MSMKMMSSPSP
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      -------------------------------------------------------MNPPA
A0A1D8AS58      -------------------------------------------------------MENAP
I6AQC1          -------------------------------------------------------MDSQA
W0ITH7          -------------------------------------------------------MDSQA
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------MLWWSR
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V2DJ66      -----MENSDSKTPAQDGASQNAPSSQGAKSVRKKRNSGYGYG--YNYSAYGNYGGYGGY
R7L5A9          -----MESSNN--------NNSQPDSAPTKVIKKKIVASYGSGGYGGYGGYGDYGGYGAY
A0A1J4XH17      ------------------------------------------------------MKDNHS
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      -----------------------MSSISHLPVQSWSPTAFIGFSQPSCTSGPVSLLLDNK
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      --------MPLNGTAGVSPGLALLWPWSPCACNGHSAAFSSGLIIPVNGNIGTVRLYRTD
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ---------------------MENTESKDNSGQKTVKRVIKKRIISDAAGAYGYGPGYGG
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------MDPSQSAQTQPN
A0A1H1MGC9      ------------------------------------------------MDTVPKAEKAQG
A0A2A2PYE8      -------------------------------------------------MSSESGEKQSQ
A0A2T6CN73      ------------------------------------------------MAAEQEKHAPGE
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      TNSSSSSGSASGTNNTSRGSQRRGYGGGGYGGNYGGGYGGGYGGNYGGGYGGGYGGGYGG
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ---------------------------------------------MKNDYVRGAPDPNSG
A0A2E9IN28      ---------------------------------------------MKNDYVRGGADPNTG
D5ENH7          ---------------------------------------------MKNDYVRGGADPNSG
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ----------------------------MRNTTESMVQDPQEEASKRKPNYHNYHSYHNH
A0A351MR11      -------------------------------------------MPSSYILRQRDDGNTSY
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------MKNEYVRGAPDPNAGGYA
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      -----------------------------------------------------------M
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ---------------------------------------------------------MSQ
A0A4Y8P842      -----------------------------------------------------------M
B3DZK9          -----------------------------------------------------------M
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      -----------------------------------------------------MGVFLFL
                                                                            

A0A2A2XVF1      SPYFKMLDPSRPPAEKRFGSVLPTIHSSLDEVGTALDLRRIYHLLLQRW-----------
A0A2V5UHJ2      MEQVNQPSPYFIRRTLRPENQTIDLHEFSVVEDQVLPLRDYWLIIKRHR-----------
A0A2V5PST3      PYNMRTYFPENDTQRPALPDSSESDYAYYGSEEERVQLLDYWKNLVKRR-----------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ----MAEPAGSSPTPPVPLGAAPSSSAADAPVEQRRSLRDYYVILRERF-----------
A0A1D8AZK8      ----MSVP--DSPPSSSAAQRAASLHGNDHQVVERRSLRDYYIILRERL-----------
A0A1V5QB01      -MENILRPPRPPTAGDAPAQPVSIGSPPPAKGFGIADLKHYFHIVVKRI-----------
A0A139SPN4      -----------------------------MPAGQSRSLRDYYVILRERF-----------
A0A1V6E7N1      -------------MADVSAKSTHHSPGKDEEVVERRTLRDYLIILRERL-----------
A0A2D9MYT1      -----------------MXQXPFNESREEGLFEESINLRHYWHIVLERR-----------
A0A258ANJ7      KASFNTMQPTSLSLPQSPMEMTQRLEADSESSSSFMNPAQLVDGMRRHS-----------
A0A139TLN4      -----------------MKSSSPKPDSLETEGGASVSLFPSPRALLARI--------IRN
A0A290QGD9      SPAPHGGPDQAPESPYGYGAYQQPP-----DGPQQRGFQDYVLILRERI-----------
A0A1D8AS58      KADKVQGPGEA-YPAYYGGGQGGYGVLGQGESQMHRSMQDYLLILRERV-----------
I6AQC1          KQPK---ASDG-RAEYGYGGYNEYPGYGN-EASGQRTLSDYLLILRERI-----------
W0ITH7          KQPN---PSDG-RAEYGYGGYNEYPGYGN-EASGQRTLSDYLLILRERI-----------
A0A1G3ZFT0      --------------------MNTLTHGKANQENIEIDFVALFHQLLEHK-----------
A0A1Z8ZMT6      -------MAKLRSTPEPVDSYYDEAQAEIKKSPGLFDLAYLLPRLIARW-----------
A0A2E8MCT7      -------MAKLRSAPGPVDSYYQETKADIKKSPGVFDLAYLLPRLIARW-----------
A0A290Q2Z2      RVWWWRPEKTSLLTGGEGNSLAARSMAHTHVSKEGASLADFFHLLRLRK-----------
A0A2A2RGK2      -------------MSTDKVIQPRPPESAPP--IESIDWREYFHAVIDRL-----------
A0A2A2XXF7      -------------MNKETDLKKPPSASPPPPSQEGIDWREYFHAVVDRL-----------
A0A2A2R5D6      --------------------------MAAPASEVSLHFLDYWRVIRNRA-----------
A0A2V2DJ66      YGGYGAYGGYGG-----YGYGTNPAASGEGAEAPNRTLRDYFMILRERL-----------
R7L5A9          GGGYGGYGGYGGSYGGYYGGYNSKNPAGEGG-VPNRTFRDYMMILRERF-----------
A0A1J4XH17      NKNEPEDQKSYGGYYNGYGSYSYGYGSGAYEENNQRNIKDYLLILRERV-----------
A0A3C1VJ32      ----------------------MDQVTTSAAPEARLHFLDYWRVIRIRK-----------
A0A2N9NTX7      ----------------------MDPIPVPPPQESKLHFLDYWRIIRIRK-----------
B9XK55          ----------------------MDPLKTSAPPEAKLHFLDYWRIIRIRK-----------
A0A4P5YMI6      ----------------------MEAEAISSQPETKLHFLDYWRIIRIRK-----------
A0A2E6T482      ----------------------MDKIPTTDQSSDKLHILDYWRILRVRF-----------
A0A3C0DQZ7      ----------------------MDKIPTTDQSSDKLHILDYWRILRVRF-----------
A0A1Z9CBK5      ----------------------MERNTGSDQSSDKLHILDYWRIIRVRI-----------
A0A2D6ZI96      ----------------------MERNTGSDQSSDKLHILDYWRIIRVRI-----------
A0A358KGZ3      ----------------------MEPTSRKENSSDKLHILDYWRIIRVRI-----------
A0A2E9ZQX4      ----------------------MEPTSRKENSSDKLHILDYWRIIRVRI-----------
A0A3D5JZU0      ----------------------MEPTSGKENSSDKLHILDYWRIIRVRI-----------
A0A2E6HCR0      ----------------------MDNNSGSEQSSDKLHILDYWRIIRVRI-----------
A0A1Z8WN04      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2D7L1N4      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2E2R937      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A520QQY4      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2D5MR66      ----------------------MDKTSGLEQSSDKLHILDYWRIIRVRI-----------
A0A2E0PDQ1      ----------------------MDKTSGSEQSSDKLHILDYWRIIRVRI-----------
A0A2E2ZZP9      ----------------------MDKTSGSEQSSDKLHILDYWRIIRVRI-----------
A0A2A2RGF2      -----------------MDAAPKPTDSAPATPENRLHFLDYWRIIRMRA-----------
A0A2G4I5Y6      -----------------MDAAPHQAEPAPATPENRLHFLDYWRIIRMRG-----------
A0A3M1I883      ----------------------MQSTSSSARPQTEFHFLDYWRIIRIRK-----------
A0A1V6JZ45      ----------------------MDATKPNPISDSQLHFLDYWRIIRIRK-----------
A0A520RRW5      -------------------MQTKPSQQPQQQSDSKLHFLDYWRIIRIRK-----------
A0A356NPK0      -------------------MQTKPSQQPQQQSDSKLHFLDYWRIIRIRK-----------
A0A2D7B5P5      -------------------MQTKPSQQPQQQSXSKLHFLDYWRIIRIRK-----------
A0A3D3XGB5      -------------------MQTKPSQQPQQQSDSKLHFLDYWRIIRIRK-----------
A0A2V6F8A1      ---------------------MEAPKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A2V5TNH4      ---------------------MEAAKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A2V5X5Q6      ---------------------METAKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A4P5QM05      ---------------------------MTESNEAKLHFLDYWRVVKLRL-----------
A0A4Q3C001      ---------------------------MIDSSEVKLHFLDYWRVIRVRA-----------
B4DB23          ---------------------------MNDSNEVKLHFLDYWRIIRLRM-----------
A0A6B3L938      --------MKKEIDPFSDDAVAEGSDAGSNVPVSNRSAAGLIQVALEKW-----------
A0A2V5URB2      EGPMKEISPHRARATMLLEDADLVSEPRLIESDEAPSLRDYWQIVRKHK-----------
A0A5R8KA81      -----------------MRKSPASSRKIQYDSTTAFTYSDIFHVLRDKA-----------
A0A5B5WU87      -------------MNDLSPKKESLDAVGAASVSLFPSPKAILGRIVRKW-----------
R7DZW0          -------------MKDLSPKKETLDVGGAAPASLLPSPRAIMGRIVRKW-----------
A0A2N8HID1      -------------MKDLSPKKESLDAGGAAPVSLLPSPRAIMGRIVRKW-----------
A0A2N8HS06      -------------MKDLSPKKESLDAGGAAPASLLPSPRAIMGRIVRKW-----------
A0A3R5R2M8      ------------------MNAAPNTTSPMEEEESSFSLDTVLVILRRFW-----------
A0A411SUQ6      SPGVQYFHTTFHPLSSMTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A2N8HZF2      ----------------MTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A354E720      ----------------MTKNTAPTPPGTENTEETALSLDTVLMILRRYW-----------
B2UPB6          ----------------MTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A2A2XXW5      ----------------MEEQFQSQQGNSMSGADPSINLRQYWHVILERR-----------
A0A2V6JLK8      ----------------MGGSPPKGPTGMAHNEEVKLHFLDYWRVIRIRW-----------
A0A2W5Z1A5      ---------------------------MAETDEGKLHFLDYWRVVRVRW-----------
A0A2V6EA09      ---------------------------MAHNDEVKLHFLDYWRVVRVRW-----------
A0A2V6GQI7      ---------------------------MAHNDEVKLHFLDYWRVVRVRW-----------
A0A3C1HEJ2      ----------------MATPSNYLPGDEGPEASSAVDLPSARTLIEKAW-----------
A0A522ULD9      -------------------------MADKEAPEVGLHFLDYWRVVRSRK-----------
A0A1V6JU76      -------------MSYSYYTSQAAPPEASESSSSNLNLRHYWNIVLQRR-----------
A0A1Q6UHJ9      GYGGGYGGGYGGGGYGYGYGYGGGQGEGGSPERPNRTFRDYMMILRERW-----------
A0A2V2BXR0      -----------------------------------------MMILRERW-----------
A0A2D8V0G3      ------------------MEFQQSSQATETSVAENLNLRHYWHILLERR-----------
A0A348S017      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A3C1UUV7      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A350I3V2      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A520RGV5      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A3D3XF90      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A2D7B522      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A356NIC2      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A2U8DZK4      -------------------------MAYSDPVKESAPLPAFLQTLNLRK-----------
A0A2T6DFL8      -------------------------MANVHAAPVGASVAGFLQILRQRQ-----------
A0A1D8AWD4      -------------------------MPTLPSTKDSATLGDFVGLLRLRK-----------
A0A4Q1C9S2      -------------------------MAFSPVSKDSATLGDFVGLLRLRK-----------
A0A178IH18      -------------------------MARPDSSSETAALPEFFQVLRQRK-----------
A0A2T6DT99      -------------------------MASTHASREGASLADFFQLLRLRK-----------
A0A1G3ZT33      -------------------------MASIITSRDGGSLTDFFNILRLRK-----------
A0A3E1E2T2      -------------------------MAQPSASKDSATLADFLRLLRLRK-----------
B1ZMW1          -------------------------MVPTSASKDSASLADFMQLLRQRK-----------
A0A2N8HDG3      ----------------MPDTSAPPAVPPAEESESSLSLDVITGILLRRW-----------
A0A146GCJ0      --------MPKDDGENLTSKPAVNLSFRDDTHGDLFDSERWFNLLRSKA-----------
A0A2T6D6H8      --------MVNKGAENKDRKSAAQVTLLRELSGEVIDFERLLNLLRARA-----------
A0A3D1TI55      --------------------------MDEKQQDSSLHFLDYWRVIRARK-----------
A0A3R8IT45      DGR------YGYGYQEY--PGYGNENAAG-----HRTLGDYLLILRERI-----------
A0A1H1MGC9      SGEAYPYTYYGTSYSGYGSPGHGDNQ-------MQRSMQDYVLILRERA-----------
A0A2A2PYE8      NSSGYGYN-YGGNYAGYSAVGYGYGEGGGGGSHSQRTFQDYLLILRERI-----------
A0A2T6CN73      SGGGYSYG-TGGNYAGYSAAGYGYGD-AGESSTIQRTFQDYLLIVRERI-----------
A0A3E1ET42      --------------------------MREQLNESKMHALDYWQVIRNRW-----------
A0A2A2YDW8      ------------------------MQPQSSNSEAALHAVDYWQVIKNRY-----------
A0A352XLN9      ------------------------MQPQSSNSEAALHAVDYWQVIKNRY-----------
A0A3D0YP62      -----------------------MQPQNSQQNEASLHAIDYWQVLKNRY-----------
A0A3D3DV47      -----------------------MQPQNSQQNEASLHAIDYWQVLKNRY-----------
A0A2E5XJ49      --------------------MQNDLDRQSAASEASLHAVDYWQVLKNRY-----------
A0A2E6SBY8      --------------------MQNDPDRQPAASEASLHAVDYWQVLKNRY-----------
A0A2E5QMS4      --------------------MQNDPDRQTAASEASLHAVDYWQVLKNRY-----------
A0A2E7YXQ3      --------------------MQNDPDRQTAASEASLHAVDYWQVLKNRY-----------
A0A2E3H787      --------------------MRNGPDRQTSASEAALHAVDYWQVLKNRY-----------
A0A2E7AGN1      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A2E7AKY7      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A3D4CU34      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A2E8M146      --------------------MPNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A355S8S2      --------------------MPNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2D6DVN8      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A3C1W2R2      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2E3NAY6      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2E3II01      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A368B8C5      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A3R7RBB5      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2A2QX62      ------------------------MNPTTNTSEASLHAIDYWQVAKNRY-----------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      -----------------------MNTSAPQQNEAALHAVDYWQVIKNRY-----------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      GNYGGGYGGGYGRQRGGYGGGYGGGYGEGSSKDTEVSISTYVNMVRERI-----------
A0A139TV24      ---------------MPQPTVPPVSSPAPETPDSSLSLDIVAIILRRRW-----------
A0A2N8HT11      ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
R7DS70          ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
A0A2N8HNL6      ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
A0A6I1K459      -----------------MEPFEQPRAGDVSPEAGTLFNRNLWHAFMEKA-----------
A0A139TUL1      ----------------------MSIPVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HCB0      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HP04      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HRJ0      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A366HAG0      -------------------------MATPNNLELQRHALDYWQIIRNRL-----------
A0A3M1I8A3      ---------MAYQAYPQTAPADPVSLPPAGGAMGSMTLRHYWHVLLERR-----------
A0A4V0XS84      -------------------MNSKGNLTQSKSLADKIDFNEYWNVLRDQR-----------
A0A0R2XQ77      GYSGYG-GYG-SNSYSDGGYGAG---GYGAGGAPQRSFKDYFLMFRERV-----------
A0A2E9IN28      GYGGYGYGYGYGGGYGYGGYGAGGGYGEGGGGAPQRSFKDYFLMFRERI-----------
D5ENH7          GYGGYGYGYG-GGSYGYGGYGSGGG-GAGYEQGPQRSAKDYLLMFRERI-----------
A0A351WE84      ------METSEATRASLVILGCGVKFMADSQQDTALHFLDYWRVIKSRK-----------
A0A1V5QDZ6      -------------------------MEQQPSDSSGLHFLDYWRVIRSRK-----------
A0A4Y8P964      --------MSEEIQRIPDQNFPSGQIQDPNSNLTAIPSDPYYSFSTGQWLKDRLKEIYRY
A0A3D4HF88      GYHGYHGYGGHGGAGYGGYGYGYGDDYSTQHRQPPRTFRDYIFILRERI-----------
A0A351MR11      SGGYGGYGGYGAYGESRYGGYGSVPAPGYGQAAGVNPLANYMLMLRERM-----------
A0A6G6K641      --------------MRSKNSDIEDDEDDVKGSGEGLSWRVYYQALKERL-----------
A0A5B5WI95      -----------------MVNRPSPSPPVMEEEESNLSLDLALAILRRYW-----------
A0A2N8I9W1      -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
A0A4Q5IH27      -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
A0A2N8IBZ6      -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
A0A2N8IJW9      -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
R6J100          -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
A0A1V6J089      --------------------------MAEESQTTALHFLDYWRVIRDRK-----------
A0A3C1BZR1      --------------------------MAEESQTTALHFLDYWRVIRDRK-----------
A0A1H6KPB7      ----------------------MSSPAINQKSEASLHAGDYLQILRNRW-----------
A0A2E9ISN4      -----------MQIPNSTISESKPPTPADNDRETTTAFSNPWALVQLIF---------RH
B9XAX1          ---------------MKLRLSNEREIAEMTEVDRPLDVQEFLQTLIEKW-----------
A0A5R8KKM9      -------------------------MNPSPPQEHRQHALDYWQIIRNRL-----------
A0A139TS01      -----------------------MNAPDQQNGDPIVRNIDYIQVLKNRW-----------
A0A3E1EJT7      -------MNPPSPYARSSYAPVNPDFTDGEEPEDNDYLRRWWVMVLERK-----------
A0A317ZP96      GGYGYGSYGYGGGYGYGGAGYGYGGGYGGGGGGPQRSFKDYFLMFRERI-----------
A0A2D5WGA5      ----------------------MDKLPKTDQSSDKLHILDYWRIIRVRF-----------
A0A2E7SSH2      ----------------------MERKPGTEHSSDKLHILDYWRIIRVRI-----------
A0A349GXM8      -------------------MATPRPGGGVSTEENKIDFRIYLSVMLFRW-----------
A0A4P5YP61      ------------------MIQNRSESEFDQEAGSSVDLRQIYHVFLERI-----------
A0A6B2LYM4      SNNQYQSGGSQGGYYGGYYYGEGYSGYADSGNAPSRSLTDYLLILRERI-----------
A0A6D1VXB3      ---------MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSFSTGEWLKERFNEIYRY
I0JYY7          ---------MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSFSTGEWLKERFNEIYRY
A0A4R7S1J2      ------MSLSSLPPQGPTRLNLPKTFSQDLESEADFDWRGLLITAREKL-----------
A0A2A2XV69      ------------------------MMNSSDSNEIQLHFLDYWRVIRIRL-----------
A0A651H7X9      QPPHQEPESTRPTPHRYAYSDSGIDSSPYGEGGPQRSIKDYILILRERI-----------
A0A4Y8P842      SEELQKKPEDVLAVGSKEALPTEVLLSPYESSDLDWIKQKLWDIYRFRR-----------
B3DZK9          SEELQKKPKDNLTVGNKDVFQTEVLLSPYESSDLEWLKEKLWDIYRFRK-----------
A0A5E6MPC4      ----MEEIQPRPRESLGPLASGALPLEVSEEGSGWESVRSLLSDVNRYR-----------
A0A4V1SB02      -----------------------------------MNPLHYLYLFLRYS-----------
A0A3C1VB86      --------------MPNPDPLDLPPSLETSAPGSISDLHGVIRLLLDKS-----------
A0A146G2Q9      -----------------------MSLESPDSGEIKLHFLDYWRVIRVRL-----------
A0A2T6D3Y2      -----------------------MSFESPDSGEIKLHFLDYWRVIRVRL-----------
A0A2V2SDV4      ----------------------MDPIKAAAPQDSKLHFLDYWRIIRIRK-----------
A0A2V5PK75      ----------------------MDPLKVPASQETKLHFLDYWRIIRIRK-----------
A0A1V6DME1      ----------------------MDPLKTTPPPETKLHFLDYWRIIRIRK-----------
A0A3D3DIJ3      ----------------------MDPLKVAPPQEAKLHFLDYWRIIRIRK-----------
A0A2D5VY59      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A2D8UZZ4      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A353DV86      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A2E5EPT8      ---------------------MEYQSNGPTSSDNRLHFLDYWRILRLRK-----------
A0A6I1K583      -----------------MDAASNYATPAAGTPENRLHFLDYWRIIRMRG-----------
A0A350EWA4      -----------------------MDSFKQDQPTASLHFLDYWRIIRIRK-----------
A0A5B5WZ91      -----------------------MNAPDLQNGDPIVRNIDYIQVLKNRW-----------
A0A2N8HD92      -----------------------MNSQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8HIT2      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A354EBD3      -----------------------------------VRNIDYLQVLKNRW-----------
A0A355VEB2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8IMT3      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
R6K1U5          -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8IWC2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8I441      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8I3A6      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A410SCC4      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A3R5VEW0      -----------------------MSVQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A411SSG2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
B2UKW3          -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A1M6RLZ4      ----------------------MQQNNSLNPSEASLHAVDYWQIVKNRY-----------
A0A354T7G8      --------------------------MNETGSEFQKHAMDTWQVVKNRI-----------
A0A2S7U4L6      ----------------------MQPNNSLNTSDATLHAVDYLQILKNRY-----------
A0A512MBZ2      --------------------------MSEAGKDIQAQAIDSWQIIRNRF-----------
A0A2E8MEZ0      ------------------------MQGTNFRNADDAPSVDYWQVVKNRY-----------
A0A4Q2YKS3      -----------------------MQSPSTQQSEAALHAVDYWQVIKNRY-----------
A0A6B3LBV6      ---------------MANPPYFNPNRFQQNSQESGPQVGDYWQVIRNRY-----------
A0A2E3EC33      ---------------------------MAKQSETKLHALDYWQVIRNRY-----------
A0A2E4GN01      ---------------------------MAKQSETKLHALDYWQVVRNRY-----------
A0A1Z8XU55      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2E1RQR9      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2E3ISQ4      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2D6W6F4      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2D8Z5A8      VEKTSECSYFADSKFILNSPQIKYIXTMAKQSETKLHALDYWQVARNRY-----------
                                                                            

A0A2A2XVF1      -WVITLLVGVSMMAATGYV-MRQPKIYESRAVLQVQQSEQQVVNIDG------------V
A0A2V5UHJ2      -WLILSCALALFIGATLYT-FTRTPLYTADATLLIERKAPQILKLQDARAD--------S
A0A2V5PST3      -RIIIQIFIIFLLVGAYFT-FTATPVYKATATLKIEPINPMVTGVTGVGESGA------R
A0A2V5PXM3      --------MVAAIGTTTYL-LRAPKIYASKLVLQVEQEEQKILNIQ------------RV
A0A139SU05      -WIALPLALLVSLVIGYYQ-ARQTPMYASTAIIQFERPETVVTTQT-------------V
A0A1D8AZK8      -WIALPVALLVSLSVGYYK-AQETPMYSSVATMQFERPERVVQNEQ-------------V
A0A1V5QB01      -WLVALCFVLSLTVMVAIL-VRQVPVYRCRVTLLMSKGVPMPYSLR--------------
A0A139SPN4      -WIALPLALLVALGIGYYQ-ARQTPMYASTAIIQFERPETIVTTQG-------------V
A0A1V6E7N1      -WIALPIALLVAVGIGYYQ-SRATPLYQSRATLRFEKPDRIVATEG-------------V
A0A2D9MYT1      -WLVAATFLVVIILTAFYL-FSATPIFSATTRLQIDRETENALRME------------SF
A0A258ANJ7      -WIPITLSLFGLILGYAYF-KRQKPVYEAVSVAQFGSEQSSLLGLN------------SM
A0A139TLN4      WYWCLLSLCICLPLAYLYA-ARLPFVYGKATTVLIKNDYP--------KESVATTVLATS
A0A290QGD9      -WYILAVFLVIFSCVLVYT-LTQTKIYQSRSLIQILRRDPAVLKVQ------------SV
A0A1D8AS58      -WYIVLVFALVFSAAVIFT-FTRVPRYTSVASVQVFRNDPVVMQVQ------------SV
I6AQC1          -WYIVVVFLVIFSSALVYT-FSQTKIFSSSATVQIMRRPAMTLPTP------------EL
W0ITH7          -WYIVVVFLVIFSSALVYT-FSQTKIFSASATVQIMRRTAVTLPTQ------------NP
A0A1G3ZFT0      -WLIAVIIAISLMGGKYYA-SKQIPVYNPDVLIQVESNRGVSGLTIGLPGM--------G
A0A1Z8ZMT6      -HWILIGSLLGVVLGVITI-RMSVPEYRSTATVRVKSQNSGSMGNS--SDSDDIDLQSLE
A0A2E8MCT7      -HWILIGILLGVVLGVINI-RMSVPEYRSTATVRVKSQNSGSMGNS--SESEDIDLQGLE
A0A290Q2Z2      -ALIFLILSLVVITTVVVT-AFLPKWYLSTLNVRVEKPEGEVKLFQ-------------A
A0A2A2RGK2      -WIVILCVILGGIYAGFTL-SKIETTYRARAVLFIEQDQARILDPRFSQ----------V
A0A2A2XXF7      -WIVILCVVVGGIYAGVTL-SKVETTYRARAVLFIEQDKSRILDAKMEQ----------V
A0A2A2R5D6      -AIIVTVLLLTLMTGYVVTVYVMQKMYDAKAQLRVYKEKSDVEFMG------------NS
A0A2V2DJ66      -WYIIVTFIVIFSGIALYT-LRITPLYTSASSVLIFREAAAPIDGPGSSDR--------T
R7L5A9          -WYIIVTFFIIFAGVLLYT-FRITPIYTSAASVQILRDSDSPIDGPGSTER--------S
A0A1J4XH17      -WLLVFVFAIIFLGSIIYL-IKATPIYEAEAMLQILRDDTTVLGVR------------SV
A0A3C1VJ32      -AIIITVFLITAIIATAVT-LILPESYASTARIKVENEGGIVSGMGNSP----------A
A0A2N9NTX7      -TVILAVFLLVVITATVVT-FILPPKYKSMARIKIERDQTDIPSLTQQQ----------G
B9XK55          -TVILAVFLLVVITATIVT-FILPEQFSSTARIKVEGDTTDVPGITQTP----------N
A0A4P5YMI6      -MVILTVFLLVVITTTAVT-YVLPKTYMSSVRIDVQKDVSDVQ-FSGMS----------E
A0A2E6T482      -VTILLVFLLTAVTTTVVT-FLLPRTYMSLSRISVEKDSSDIAPLLGMQ----------A
A0A3C0DQZ7      -VTILLVFLLTAVTTTVVT-FLLPRTYMSLSRISVEKDSSDIAPLLGMQ----------A
A0A1Z9CBK5      -ATILLVFLLTAITTTVVT-VMLPSTYMSLSRIAVEKDTSDIAPLMGVQ----------A
A0A2D6ZI96      -ATILLVFLLTAITTTVVT-VMLPSTYMSLSRIAVEKDTSDIAPLMGVQ----------A
A0A358KGZ3      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPLLGMQ----------A
A0A2E9ZQX4      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPLLGMQ----------A
A0A3D5JZU0      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPLLGMQ----------A
A0A2E6HCR0      -ATILLVFLLTAITTTVVT-FLIPPTYMSISRIAVEKDTSDIAPLMGVQ----------T
A0A1Z8WN04      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGAQ----------S
A0A2D7L1N4      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGAQ----------S
A0A2E2R937      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGAQ----------S
A0A520QQY4      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGAQ----------S
A0A2D5MR66      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGVQ----------A
A0A2E0PDQ1      -AIILVVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGVQ----------A
A0A2E2ZZP9      -AIILVVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGVQ----------A
A0A2A2RGF2      -LLIFVVFALVVGTTALLT-HNMEPTFMSTVRMDVQKDVGDISSLMPQQ----------Q
A0A2G4I5Y6      -LLIFVVFALVVGTTAVLT-HSMEPTYMSTVRMDVQKDVGDITSLMPQQ----------Q
A0A3M1I883      -MVILAVWLLVVLTTLAVT-FVLKPTYASTVRIEIEKDATDIPTIGGQQ----------R
A0A1V6JZ45      -TVILAVFLLVVLTTTAVT-FVLKPTFMSTARIEVEKQPTDFDPFLRPQ----------V
A0A520RRW5      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPLMGLQ----------A
A0A356NPK0      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPLMGLQ----------A
A0A2D7B5P5      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPLMGLQ----------A
A0A3D3XGB5      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPLMGLQ----------A
A0A2V6F8A1      -TVILAVFLLVVLTTTAVT-FILPESWSSMVRIAVEKDISDISPLGITQ----------N
A0A2V5TNH4      -TVILAVFLLVVLTTTAVT-FILPESWSSTVRIAVEKDVSDINPIGFAQ----------N
A0A2V5X5Q6      -TVILAVFLLVVLTTTAVT-FILPESWSSTVRIAVEKDVSDINPIGFTQ----------N
A0A4P5QM05      -GLILLTFFLVMVSAEVYV-YFLPRQFYSHVTVEIKPDVFDRLNEV-----------GTQ
A0A4Q3C001      -GLITLVFLLVMITAGVTT-YFMPRQYLAKVSMVVKPDSTKGVSIF-----------ESS
B4DB23          -GLILLTFFLVMVTAGVTT-YFLPKKYYSKVTMEVKQDKSDLVQTF-----------GPG
A0A6B3L938      -WMIVIFAALGYVAALYYL-SIKEPTTKARAVVEVTTKELQLVGQG-----------DAE
A0A2V5URB2      -WKILACFLAAVVITAIIV-FSMTPIYTATATLLIERKAPQVVKIQ----------QVLS
A0A5R8KA81      -WLIVLCLLVAAFIVAAML-VRSVPLYQSRVVVQVEQSETKVLDSV-----------QEV
A0A5B5WU87      -YWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYP--------KESVAATVLATS
R7DZW0          -YWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYP--------RESVAATVLAST
A0A2N8HID1      -YWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYP--------RESVAATVLAST
A0A2N8HS06      -YWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYP--------RESVAATVLAST
A0A3R5R2M8      -FLIILAAIAGGSLAFYLA-GRQNYVYQKTASVMMRDAKSGTDASS--ERIM-------S
A0A411SUQ6      -FIIILAALAGGTAAYYLA-GKQNYIYQKTASVLMRDAKTGSDASS--ERIM-------A
A0A2N8HZF2      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASS--ERIM-------A
A0A354E720      -FIIILAALAGGTAAYYLA-GKQNYIYQKKASVLMRDSKTGSDASS--ERIM-------A
B2UPB6          -FIIILAALAGGTAAYYLA-GKQNYIYQKTASVLMRDAKTGSDASS--ERIM-------A
A0A2A2XXW5      -WLIVATWSVCIIAGVLYA-FQATPMFRAIARLQIDPENQGVLNLN-------------S
A0A2V6JLK8      -VLVLLAFLLVLITAAIFT-YFQPREYKADVFVEVKSTAENPRIFG-----------QGD
A0A2W5Z1A5      -VLILLAFSLVLITAAVVT-YFQPREYQSSAFIEVRSTAQNPHIFS-----------QID
A0A2V6EA09      -GLISLAFFLVLITAAIVT-YFQPREYKASAFIEVKSTAENPRIFG-----------N-D
A0A2V6GQI7      -GLISLAFFLVLITAAIVT-YFQPREYKASAFIEVKSTAENPRIFG-----------N-D
A0A3C1HEJ2      --VVVLCLLAAGFITYGYL-KRAPVIYASTVTLKVEEQSQKILSGL-----------QEG
A0A522ULD9      -EIVLAVALLVIITVTAWT-MTLPRMYETEVKVSLKEDQADVEVFG------------PG
A0A1V6JU76      -WLVIATFVSVFVLCLVYL-FKAPRIYSATARLQIDRESAASLNLN-------------E
A0A1Q6UHJ9      -AYILITALIILAGVILYT-LRVTPIYMSVSRVQILRDSDVAIEGPGSTDR--------S
A0A2V2BXR0      -AYILITALIILAGVILYT-LRVTPIYMSVSRVQILRDSDVAIEGPGSTDR--------S
A0A2D8V0G3      -WLVITTFISVVILSVLYL-YRAVPIYQAKTVLQINKESTSIMDVG------------SQ
A0A348S017      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA------------TP
A0A3C1UUV7      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA------------TP
A0A350I3V2      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA------------TP
A0A520RGV5      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA------------TP
A0A3D3XF90      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA------------TP
A0A2D7B522      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA------------TP
A0A356NIC2      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA------------TP
A0A2U8DZK4      -ALILLILALVVITTIAVT-AFLPKWYRSKASIRVLKIGTTSAVFQ-------------A
A0A2T6DFL8      -WLIALILALVVVTTIGVT-AFLPKGYRATTKVRVERPDGQVKLFQ-------------A
A0A1D8AWD4      -GLIFLVLGLVLLTTLGVT-ALLPKWYLSTAKISVQKPESEVKLFQ-------------A
A0A4Q1C9S2      -GLVFLVLALVVLTTLGVT-ALLPKWYLSTTKISVQKPESEVKLFQ-------------A
A0A178IH18      -FLILLVMALVVGTAAVVT-ALLPKWYLSTINIRVEKPEGKV-VFE-------------N
A0A2T6DT99      -ALIFLILSLVVVTTAVVT-ALMPKWYVSTLNVRVEKPEGEVKLFQ-------------N
A0A1G3ZT33      -ALIFLILALVLLTTLGVT-ALLPRWYLSTVAMRVEKPESEVKLFQ-------------A
A0A3E1E2T2      -SLILLILSLVVITTVAVT-AFLPRWYLATAKIRVEKPESEVKLFQ-------------A
B1ZMW1          -ALIALILGLVLITTIVVT-AFLPRWYLATTKIRVEKPEGEVKLFQ-------------A
A0A2N8HDG3      -YWILLFALIGGGAAYYLT-GRQNYIFEKTASVIMRESSKESTSDRIK-----------V
A0A146GCJ0      -WLIAAVAVVVVIGAAAYA-FRLPKIYESRALLQVEQLAQKVVDIA--D----------V
A0A2T6D6H8      -WLVIVVAVIFFAAAFAYA-LRSPKIYESRALIQVEQASQNVVDID--D----------I
A0A3D1TI55      -EIIITVSVLIILTVFIIT-LIMPEKYRASVRITIDQYRPDIELVD-------------R
A0A3R8IT45      -WYIVVVFLVIFSSALVYT-FSQTKIYRAMATAQILRKTATMFSQS--RE---------M
A0A1H1MGC9      -WYIVLVFALVFSAATIFT-FTRVPQYQSVASVQVFRRDPVVM-QV--QG---------V
A0A2A2PYE8      -WYIVVVFLVVFSSSLVYT-LSDTKIYQSSATVQIFRRDPTVM-QV--QQ---------V
A0A2T6CN73      -WYIVVVFLVVFSSALVYT-LSKPKIYESTATVQIFRRDPTIM-PG--QQ---------V
A0A3E1ET42      -GVILLTFFLIALASLVII-ALLDKKYQSTTRFRVLL-----------SSAIDPFQTNEI
A0A2A2YDW8      -GVILITLLLVFMTAAVIT-YVMPRKFESRAVVQVNP-----------SNRFGTAFGDDN
A0A352XLN9      -GVILITLLLVFMTAAVIT-YVMPRKFESRAVVQVNP-----------SNRFGTAFGDDN
A0A3D0YP62      -GVILLTFLLVFLTAAVIT-YVMPKKYESAALVEVKP-ISDIDPVGMRGGGIGTPM----
A0A3D3DV47      -GVILLTFLLVFLTAAVIT-YVMPKKYESAALVEVKP-ISDIDPVGMRGGGIGTPM----
A0A2E5XJ49      -GVILLTFLLIFMTAAVIT-YVIPKQYESTALVQVNHSFVELDPL---NGVAGAPMTGAS
A0A2E6SBY8      -GVILLTFLLIFMTAAVIT-YVIPKQYESTALVQVNHSYIELDPL---NGAAGPPMTGAS
A0A2E5QMS4      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---NGAAGHPMTGAS
A0A2E7YXQ3      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---NGAAGHPMTGAS
A0A2E3H787      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---NGAAGRPMTGAS
A0A2E7AGN1      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---NGSVGQPMTGAS
A0A2E7AKY7      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---NGSVGQPMTGAS
A0A3D4CU34      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---NGSVGQPMTGAS
A0A2E8M146      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A355S8S2      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A2D6DVN8      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A3C1W2R2      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A2E3NAY6      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---NGSVGQPMTGAS
A0A2E3II01      -GVILLTFVLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A368B8C5      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A3R7RBB5      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A2A2QX62      -GVILLTFLLVFMTALVIT-YVMPKKYESTAVVQVRPKGAGAVMM---PGTEPRGQ--YE
A0A4Q3BWH6      --------LLVFMTALVIT-YVMPKKYESTATVQVRPMGTGTQVI---PGVTDNRS--ME
A0A3N5WCF1      -GIILLTLLLVFMTAAVIT-YVMPKKYESQAVIEVKPRMPGMSPL---GAAMTETSGGGR
A0A4Q3C1K5      ---ILLTLLLVFMTAAVIT-YVMPKKFESEATIEVKPRSAGISPL---GPGFSDNQ--NL
A0A2G4G428      -WWLVLSVLIFFTLSLVYT-YNMMPEYKASGRLRVFRLAPNISGSN--TAA--------E
A0A139TV24      -YWILFCALLGGTAAYYMA-ATQNYVFEKTASVMMREASKD-SSTD--RIM--------V
A0A2N8HT11      -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDSSSSD--RIK--------V
R7DS70          -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDSSSSD--RIK--------V
A0A2N8HNL6      -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDSSSSD--RIK--------V
A0A6I1K459      -WLVVCIMAAAAAAGIWTS-NRTPPVYQSRAVMFFDFGEQKVLNIE--D----------V
A0A139TUL1      -LWILAAALLGGAGAYFIF-ARQGYLYEKTARIMLRDDKQKNSQVS--EIIL-------S
A0A2N8HCB0      -PWILACALLGGGLAYFIS-ARQGYLYQKTARIMLRDDKQKNAQVS--EIIL-------S
A0A2N8HP04      -PWILACALLGGGLAYFIC-ARQGYLYQKTARIMLRDDKQKNAQVS--EIIL-------S
A0A2N8HRJ0      -PWILACALLGGGLAYFIC-ARQGYLYQKTARIMLRDDKQKNAQVS--EIIL-------S
A0A366HAG0      -GLILASFIFIFAVAAVLT-YIMPRKFRGRVEMVIERKLDDARVVG--NANL-------Q
A0A3M1I8A3      -WLVIMVLILSVAASVGYV-VKAPRIFRATVRLQIDPESETGVNLR--DG---------F
A0A4V0XS84      -YLIVATFICVFASCVFYL-YKAPRIYQATVSLQVDKDSDNALSGI--KG---------V
A0A0R2XQ77      -WYLIVAFFIIFSGSILYT-FNKTKVYTAVATVQLLRDDPSAMA-S--AE---------M
A0A2E9IN28      -WYLIVAFFIIFSGSILYT-FNKTKIYTAAAQVQLFRDDASALGKG--AE---------M
D5ENH7          -WWMIVAFFIIFSGAILYT-FNKTKVYTAVAQVRLLREDPAAMGDQ--VD---------L
A0A351WE84      -EIVMAVTLLIVITGVAVT-FMQPKKYSSTVRILVREDSMDVDVFE--R----------Q
A0A1V5QDZ6      -EVILAVLLLVVVTGTSFT-LTLPKKYMADARILVRDDSLDVDVFE--R----------Q
A0A4Y8P964      KAIVLISFLLILLFTIIFT-FTQQPVYQGVTTVKINFNKSEVLPYK--SVGE-------D
A0A3D4HF88      -WFFLVIFLIVFLGSVLYT-FNTTPLFTAGATVQVLRDPVNPLGAG--AED--------I
A0A351MR11      -WYLVLTVLVFVTAALIYT-VNATPEYRASGRLKVYKYAPNITGRG--AG---------E
A0A6G6K641      -WLIILFAIAGVVYAAYQS-NKAVPIYASRAVLQFESPRRIMPLDT-------------V
A0A5B5WI95      -FIIMLAAVAGGMLAFYLA-GRQNYVYQKTASIIMRDAKSGTDASS--DRIM-------S
A0A2N8I9W1      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASS--ERIM-------A
A0A4Q5IH27      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASS--ERIM-------A
A0A2N8IBZ6      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASS--ERIM-------A
A0A2N8IJW9      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASS--ERIM-------A
R6J100          -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASS--ERIM-------A
A0A1V6J089      -EVILAVALLTIVSGTAYT-LMMPKKYTALTQIQVREDAMDVDPFY--QRD--------I
A0A3C1BZR1      -EVILAVALLTIVTGTAYT-LMMPKKFTATTQLEVREDAMDVDPFY--ERQ--------A
A0A1H6KPB7      -KEAVLVFVLVFVAAAVAT-YLMPPSYTSVINFEIKKPGAIVSLSR--GAER-------V
A0A2E9ISN4      WSWLVCSVVLCTLLGGLYA-YLATPIYRATARIEILNDSRVETR---------------A
B9XAX1          -WLIVLVTCAVTLPAFWWV-RNVPVGYQARAVLQVEQEEQRLVGIE--E----------V
A0A5R8KKM9      -GLIFLCFLLVFAAAAVIT-HVMPRKYRAVVEIELKRQLKDTNVFG--QL---------N
A0A139TS01      -KEVFLVFMLVLVISLVVT-LLMPPSFRATSKFQIKRPRPVMGIGT--GEDV-------V
A0A3E1EJT7      -WYALAAFVVIVAGVSAYT-FLSTPIYAGQVTVQVLKHGSQVMRVA--D----------V
A0A317ZP96      -WYLIVAFFIIFSGSILYT-FNKTKVYTSAATVQLLRDDPSALGDT--VE---------M
A0A2D5WGA5      -INIMLVFLLTALTTTLVT-FLLDKTYMSQSRISIEKDTSDIAPLL--GMQ--------T
A0A2E7SSH2      -ATILLVFLLTAITTTAVT-FLIPATYMSLSRIAVEKDTSDIAPLM--GMQ--------A
A0A349GXM8      -QLIALCFLYTMLGAVAYL-YLAPKTYESNTKIMIYRDPLLTVSNE--GAQ---------
A0A4P5YP61      -WAVLLVLTLTTFLGGLYV-VRSPKIYSATLTLQVEQESKIVDLTK-------------F
A0A6B2LYM4      -WWLVVSIFVVFLGFALYT-FNAPKLYRAAASVEILRQKDQVFQIQ--D----------I
A0A6D1VXB3      KAVVVISFLLILLFTILFT-FTQKPVYRGVATIKINFNKSEVLPYK--TVGE-------D
I0JYY7          KAVVVISFLLILLFTILFT-FTQKPVYRGVATIKINFNKSEVLPYK--TVGE-------D
A0A4R7S1J2      -WLLILLPLIGAAVSYGYL-KQAKPVFSSNATLEVEEKQRVVDVKE-------------V
A0A2A2XV69      -PLIVLVFLLVVITTGVVT-YFLPKQYESSVTMQVNQNDTYLQVFD--DR---------G
A0A651H7X9      -WYIIIIFLAVFSAALIYT-LTRPKVYEAVASVEILRTSPVVLQVQ--D----------V
A0A4Y8P842      -QALLF-FLVVLFIVLLFT-FTQKPIYRGESLVKVNSTKAEVVPYK--QVSN-------D
B3DZK9          -QALLF-FLVCLFVVFLFT-FSQKPIYRGESVVKINSTKSEVVPYK--QVSN-------D
A0A5E6MPC4      -GAALLFFAAVFLLTVVAT-FSQKPIYEGIAVVKIGTGAESSSIVP--YRQIGQDQIGQE
A0A4V1SB02      -WLIILIVAIMMGGTWAWL-SKQSPVYASRAVLQVDMDEGNLVNIE--GL---------D
A0A3C1VB86      -WLIVSCLVLALLAAAVYV-ERAPRVYAATTTVQVEQADAKVVKVE--QV---------V
A0A146G2Q9      -PLIILVLLLVVITAGVVT-YFMPKQYASTVTMQIRQNDKVLQVFG--Q----------G
A0A2T6D3Y2      -PLIILVLLLVVITAGVVT-YFMPKQYASTVTMQIRQNDKVLQVFG--Q----------G
A0A2V2SDV4      -AIILAVFLLVVITTVVVT-FIYPESFSGTARIRVERDQSDISGVL--QGQ--------A
A0A2V5PK75      -TVILAVFLLVVITATLVT-FILPESYSSKARI----DSPDISGIA--KRM--------P
A0A1V6DME1      -TVILAVFLLVVLTATLVT-WILPVSYSSEARIKVDRDVSDIPGMT--QTP--------L
A0A3D3DIJ3      -TVILAVFLLVVITATLVT-FILPESYSSKARIKIDRDQTDISGLA--DRS--------T
A0A2D5VY59      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPLI--GM---------Q
A0A2D8UZZ4      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPLI--GM---------Q
A0A353DV86      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPLI--GM---------Q
A0A2E5EPT8      -GVIFVNFIFVVLVATFVT-YLLPKTYKSTVRMDVKKDTASDIELL--GGT--------P
A0A6I1K583      -LLIFVVFALVVGTTAVLT-HWMEPTFMSTVRMDVQKDVGDISSLM--PQ---------Q
A0A350EWA4      -TVILAVFLLVVLTTTLVT-FLLPESYSSTVTIEVKKDSSTLDRIG--GP---------T
A0A5B5WZ91      -KEVFLVFMLVLVISLVVT-LLMPPSFRATSKFQIKRPRPVMGIGT--GEDV-------V
A0A2N8HD92      -KEVFLVFLLVLVISVVVT-FLMPPAYQTRCQFQIKLPKPVMEIGQ--GGDV-------V
A0A2N8HIT2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMEIGQ--GGDV-------V
A0A354EBD3      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
A0A355VEB2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
A0A2N8IMT3      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------I
R6K1U5          -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------I
A0A2N8IWC2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
A0A2N8I441      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
A0A2N8I3A6      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
A0A410SCC4      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
A0A3R5VEW0      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
A0A411SSG2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
B2UKW3          -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDV-------V
A0A1M6RLZ4      -GIILLTFILVVVTAAVIT-YVMPKKYESVAQIEIKPLGIKTDTVL--GQD--------T
A0A354T7G8      -GLITLCFILIFAAAAILT-YIMPRKYRGHVEMTIERITQDINVFD--RNR--------G
A0A2S7U4L6      -GIILLTFILVVLTAAVIT-YVMPKKYEAIAVVKINPLGTNNQVLG--S----------G
A0A512MBZ2      -GLICLSFLLVFATAAIIT-YIMPRKYRGRVEMKIERLQNKVQVFN--RDTSDMLA---G
A0A2E8MEZ0      -GVILLTFLLVFMTAAVIT-SVMPRKYESSSVVQVHPSVLLMTPFL--GGSQMTP----G
A0A4Q2YKS3      -GVILLTLLLVFMTAAVIT-YVMPKKFESSAVIEVKPRGQILSPFG--ERGSEAS----G
A0A6B3LBV6      -EVILLSLLLVLITAGFIT-VMMEEKYESTVVVQLT------DISQ--MGGDLTNTLTEG
A0A2E3EC33      -TVILLTFFLVIMTAAVIA-YLRPPEYLGRVQIQVQREARDLEVFR--ETGSVGNL---G
A0A2E4GN01      -SVXLLTFFLVXMTAMVIA-YLRPPEYLGRVQIQVQREARDLEVFR--ETGTVGNL---G
A0A1Z8XU55      -SVILXTFALVFMTALVIA-YLRPSEYLGRVXIQVQRVARDIEVFR--ETGSVGNL---G
A0A2E1RQR9      -SVILXTFALVFMTALVIA-YLRPSEYLGRVXIQVQRVARDIEVFR--ETGSVGNL---G
A0A2E3ISQ4      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVFR--ETGSVGNL---G
A0A2D6W6F4      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVFR--ETGSVGNL---G
A0A2D8Z5A8      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVFR--ETGSVGNL---G
                                                                            

A0A2A2XVF1      SQENPSSPDFINTVVQSITSRNLMLRVIDA------------NKLRT-------------
A0A2V5UHJ2      VDYNDYNNEFYKTQYEILKSRALAERVVRD------------EGLES-------------
A0A2V5PST3      TAEGGGPYDYYQTQYKLLASSALAARVIAD------------LRLDS-------------
A0A2V5PXM3      QQEDPQSLEFLKTVEQTFESRSLFERVLDT------------NNLAT-------------
A0A139SU05      MDATIRNELDLNTYIHQLTSNRVRTRVLES------------LTPEE-------------
A0A1D8AZK8      VDTSVRSDVDLNTYIQILTSGRLRTMVSQS------------LTPEE-------------
A0A1V5QB01      QVESQPMGDYLATQQLIIQSGQLISRARAR------------LNKPA-------------
A0A139SPN4      VDASIRNEIDLNTYIHQLTSNRVRTRVLES------------LTPEE-------------
A0A1V6E7N1      TRPEVQSEFDINTYLEILKSDKLRQRVVNS------------LSPQE-------------
A0A2D9MYT1      VMEGAREQDYLQTQYKNLQSRSLMEMALEETLQNAMILDGLKAGRRN-------------
A0A258ANJ7      STPGLGDEKSVNTLIQAAKSREVIGRVISE------------LNLTQ-------------
A0A139TLN4      NGIVNTASTNLDNEIFLLSSYSLMEEVVRK------------LKLDVTYWKKSGFRKEEI
A0A290QGD9      TDNDVRSLEDLNTIVQILESGTIIQKVSDR------------LTGEK-------------
A0A1D8AS58      VNNEIRSAEDLNTQVKVLESLAIVQRVADR------------LTGAD-------------
I6AQC1          LPTNVISTEDMNTMVKIFESPTIIQKVSER------------ITGDE-------------
W0ITH7          IDNNVLSTEDMNTMVKIFESPTIIQKVSER------------ITGDE-------------
A0A1G3ZFT0      GGSGPSLGSPAAIQIALIKSRYILTPVIQS------------LHLNT-------------
A0A1Z8ZMT6      AAEDIRSDFDRTELFLAVASDPTVRNLANL------------IPPEA-------------
A0A2E8MCT7      AVEDIRSDFDRTELFLAVASDPTVRNLANL------------IPPDP-------------
A0A290Q2Z2      QSSGYYDPYFLQDQFKIMQSAKVLYPVIEN------------LGLND-------------
A0A2A2RGK2      RDEQIRSIDMINTVVDLIRSYPFSQRVSAR------------LKLDQ-------------
A0A2A2XXF7      RDEQIRSIDMINTVVDLLRSYSFAQRVSAR------------LKLDQ-------------
A0A2A2R5D6      RTDAPFDLVFFTSEISTIQSKKILNPVIEK------------LGLQK-------------
A0A2V2DJ66      RNDKVLSVEDFNTQVKILESNEVIRAVRSR------------LKEDD-------------
R7L5A9          RNNVIMSMEDFNTQVKLFESAEIVKAVKSR------------MKEDE-------------
A0A1J4XH17      ESNEVRTSEDLNTQIKVLESSTLAKAVADR------------LQKEN-------------
A0A3C1VJ32      ATSFGYDPYFIQTTFEIMQSQLVLSNVIAT------------MNLNV-------------
A0A2N9NTX7      SFSP-YDPYFMQTEFELMKSEVVLDKVIKN------------LNLNE-------------
B9XK55          YSGH-YDPYFIQTEFEVIQSEVILDRVIEG------------LNLNE-------------
A0A4P5YMI6      -SKA-YDPFFVLTQFEKLQSTAVIYPVITD------------LGLRE-------------
A0A2E6T482      GPTA-FDPYFIQTEFEKIQSQKVLDKVVEK------------CDLTN-------------
A0A3C0DQZ7      GPTA-FDPYFIQTEFEKIQSQKVLDKVVEK------------CDLTN-------------
A0A1Z9CBK5      TQSS-FDPXFISTEFEKIQSQVVLDAVVES------------CELQE-------------
A0A2D6ZI96      TQSS-FDPXFISTEFEKIQSQVVLDAVVES------------CELQE-------------
A0A358KGZ3      TQSS-FDPYFISTEFEKIQSQKVLDEVVKS------------CELRE-------------
A0A2E9ZQX4      TQSS-FDPYFISTEFEKIQSQKVLDEVVRS------------CELRE-------------
A0A3D5JZU0      TQSS-FDPYFISTEFEKIQSQKVLDEVVKS------------CELRE-------------
A0A2E6HCR0      AQSS-FDPYFISTEFEKIQSQIVLDAVVRS------------CELRD-------------
A0A1Z8WN04      SQSS-FDPYFISTEFEKIQSQIVLDAVVET------------CELRE-------------
A0A2D7L1N4      SQSS-FDPYFISTEFEKIQSQIVLDAVVET------------CELRE-------------
A0A2E2R937      SQSS-FDPYFISTEFEKIQSQIVLDAVVET------------CELRE-------------
A0A520QQY4      SQSS-FDPYFISTEFEKIQSQIVLDAVVET------------CELRE-------------
A0A2D5MR66      SQSS-FDPYFISTEFEKIQSQIVLDAVVAT------------CELRE-------------
A0A2E0PDQ1      AQSS-FDPYFISTEFEKIQSQIVLDAVVSS------------CELRE-------------
A0A2E2ZZP9      AQSS-FDPYFISTEFEKIQSQIVLDAVVSS------------CELRE-------------
A0A2A2RGF2      -QGG-FDPYFVMTQFEILQSKEVLYKVIDD------------LKLVP-------------
A0A2G4I5Y6      -QGG-FDPYFVMTQFEILQSKEVLYKVIDE------------LKLVQ-------------
A0A3M1I883      -DPS-FDPYFMATEFEKIQSMSVLMPVIHSPTNAAGEKLPPDRQFIP-------------
A0A1V6JZ45      -QNQ-FDPYFIQTEFEKIQSKPILYKVIES------------LDLRK-------------
A0A520RRW5      -AQQ-HDPYWVLTEYEKIQSKKVIHPVINA------------LGLNH-------------
A0A356NPK0      -AQQ-HDPYWVLTEYEKIQSKKVIHPVINA------------LGLNH-------------
A0A2D7B5P5      -AQQ-HDPYWVLTEYEKIQSKKVIHPVINX------------LGLNH-------------
A0A3D3XGB5      -AQQ-HDPYWVLTEYEKIQSKKVIHPVINA------------LGLNH-------------
A0A2V6F8A1      -STQ-YDPFFLQTEFEKIRSQKVLYKVIDN------------LKLNE-------------
A0A2V5TNH4      -NSA-YDPFFIQTEFEKIRSRKVLYKVIEN------------LKLNE-------------
A0A2V5X5Q6      -NSA-YDPFFIRTEFEKIRSRKVLYKVIEN------------LRLNE-------------
A0A4P5QM05      TSSGRIDPQFVATQIQVLKKAEILNPVIEK------------LNLVK-------------
A0A4Q3C001      A-QRSYDPAFVATEFHTLRKSDILYPVIDQ------------LELVK-------------
B4DB23          QFRQTYDPQFVATQFQILQKTEILYPVIER------------LDLIK-------------
A0A6B3L938      RDSMIFRDEIIGTIASKITGQGQFVKVIQR------------PEVQA-------------
A0A2V5URB2      ESIEADERSYYESQYEMLKSRSLAAEVIKG------------QGLDR-------------
A0A5R8KA81      NPQDLRMNDLLATIMENLKNRDLLLRVVRR------------AELGK-------------
A0A5B5WU87      NGIVNTVATNLDNEMFLLSSHSLLETVVRK------------LKLDVTYWKKDKFRKVEV
R7DZW0          NGIVNTGATNLDNEIFLLSSHSLLKTVVRN------------LKLDVTYWKKNGFRKVEI
A0A2N8HID1      NGIVNTGATNLDNEIFLLSSHSLLKTVVRN------------LKLDVTYWKKNGFRKVEI
A0A2N8HS06      NGIVNTGATNLDNEIFLLSSHSLLKTVVRN------------LKLDVTYWKKNGFRKVEI
A0A3R5R2M8      ELGIDSGAANLANESFVLKSTAIMQKVVED------------LKLNTSYWQAQDFREIDL
A0A411SUQ6      ELNIDPNAANLANESLVLKSTALMNKVVED------------LNLNTSYWQKKDFRELDL
A0A2N8HZF2      ELGIDSGAANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFREIDL
A0A354E720      ELNIDPNAANLANESLVLKSTALMNKVVED------------LNLNTSYWQKKDFRELDL
B2UPB6          ELNIDPNAANLANESLVLKSTALMNKVVED------------LSLNTSYWQKKDFRELDL
A0A2A2XXW5      MALGNSDQNYLTTQYRNLESRSLILAVMNK------------LKLET-------------
A0A2V6JLK8      PNQPIHDPQLAPTVYQVIQRTGILYPVIEQ------------LKLQD-------------
A0A2W5Z1A5      PSQPVHDPTLAPTVFQVIQRTGILYPVIDE------------LKLQE-------------
A0A2V6EA09      LHQPVHDPELAPTVFQVIQRTGILYPVIDD------------LKLQD-------------
A0A2V6GQI7      LHQPVHDPELAPTVFQVIQRTGILYPVIDD------------LKLQD-------------
A0A3C1HEJ2      VRDDGERPEDLKTIIETLKSRAVIERVIET------------NHLAT-------------
A0A522ULD9      GAAFSYNPYFLRTQFEIIQSRQILYKVVDN------------LNLTK-------------
A0A1V6JU76      VVMSMTDQDYLQTQYRNLLSRSLLEIVIKR------------EKINE-------------
A0A1Q6UHJ9      RNNTVLTIEDFNTQVKILESNEIIKAVKSR------------MKEDE-------------
A0A2V2BXR0      RNNTVLTIEDFNTQVKILESNEIIKAVKSR------------MKEDE-------------
A0A2D8V0G3      VVFNSNDQEYLQTQYKNLLSRSLIESVITD------------LELKQ-------------
A0A348S017      IVFNSNDQEYLQTQYKNLLSRSLIESVVRD------------LGLDE-------------
A0A3C1UUV7      IVFNSNDQEYLQTQYKNLLSRSLIESVVRD------------LGLDE-------------
A0A350I3V2      IVFNSNDQEYLQTQYKNLLSRSLIESVVRD------------LGLDE-------------
A0A520RGV5      IVFNSNDQEYLQTQYKNLLSRSLIESVVRD------------LGLDE-------------
A0A3D3XF90      IVFNSNDQEYLQTQYKNLLSRSLIESVVRD------------LGLDE-------------
A0A2D7B522      IVFNSNDQEYLQTQYKNLLSRSLIESVVRD------------LGLDE-------------
A0A356NIC2      IVFNSNDQEYLQTQYKNLLSRSLIESVVRD------------LGLDE-------------
A0A2U8DZK4      QSNDYYDPYFVQDQLRTIKSPKIINPVIER------------LKLNE-------------
A0A2T6DFL8      QTSPSYDPVFLQDQFKIMQSEKILYPVIER------------LDLNR-------------
A0A1D8AWD4      QSNTYYDPYFIQDQFRIIQAEKILYPVIES------------LGLNE-------------
A0A4Q1C9S2      QNNSYYDPYFIQDQFKIIQSEKIIYPVIDA------------LGLNA-------------
A0A178IH18      QANNYYDPYFLQDQFKVIQSPKILNPVIEN------------LGLNR-------------
A0A2T6DT99      QQSAYYDPYFLQDQFKIMQSAKILYPVIER------------LQLNE-------------
A0A1G3ZT33      QSSSYYDPYFLQDQFKTIQSDIILKPVIEI------------LNLNA-------------
A0A3E1E2T2      QSSSSYDPYFLQDQFKILQSEKILYPVIKN------------LKLST-------------
B1ZMW1          QSSSYYDPYFLQDQFKIMQSEKILYPVIEN------------LGLNT-------------
A0A2N8HDG3      DLGMDSGAANLANESFILRSSTVMRSTVED------------LALNISYWKQQDLRQIDL
A0A146GCJ0      SQENPQSTDFLKTVVEALKSRKLLARVVKA------------EGLDK-------------
A0A2T6D6H8      ARENPQTTDFVNTVVQALTSRKLMLRVVKA------------TGLDH-------------
A0A3D1TI55      GRQSQYDPYFYLTQFELIRSRPVLTGVIRD------------MNLQE-------------
A0A3R8IT45      LDSTMFSTEDINTMVKVFESSIIIQKVSER------------ITGEE-------------
A0A1H1MGC9      VDNEIRSAEDLNTQVKVLESFAIVQRVADR------------LTGED-------------
A0A2A2PYE8      VDTDIRSAEDLNTQIKVIESVTMIQRVAER------------ITGDD-------------
A0A2T6CN73      VDTDIRSTEDLNTQVKVIESEAIIESVASR------------ITGQE-------------
A0A3E1ET42      SNRSAYSGNWLETEFKTVTAHETLSLVIKK------------LNLDQ-------------
A0A2A2YDW8      NSQIQMTPQFFATQFEIIRSQMTLRRVVDK------------LRLTN-------------
A0A352XLN9      NSQIQMTPQFFATQFEIIRSQMTLRRVVDK------------LRLTN-------------
A0A3D0YP62      -TR-----QFMNTQFEIIVAPETLGRAIDK------------IQLET-------------
A0A3D3DV47      -TR-----QFMNTQFEIIVAPETLGRAIDK------------IQLET-------------
A0A2E5XJ49      PSH-----AYIYNQFKIIESEKTLARVVER------------LDLTT-------------
A0A2E6SBY8      PSH-----SYIQNQFKIIESEKTLARVVER------------LDLXT-------------
A0A2E5QMS4      PSH-----AYIQNQFKIIESEKTMLRVVER------------LDLTT-------------
A0A2E7YXQ3      PSH-----AYIQNQFKIIESEKTMLRVVER------------LDLTT-------------
A0A2E3H787      PSQ-----AYIQNQFKVIESEKTLLRVVER------------LDLTT-------------
A0A2E7AGN1      PSH-----AYIQNQFKIIESEKTLSRVVET------------LDLTT-------------
A0A2E7AKY7      PSH-----AYIQNQFKIIESEKTLSRVVET------------LDLTT-------------
A0A3D4CU34      PSH-----AYIQNQFKIIESEKTLSRVVET------------LDLTT-------------
A0A2E8M146      PSH-----AYIQNQFKIIESETVLNRVVES------------LDLTT-------------
A0A355S8S2      PSH-----AYIQNQFKIIESETVLNRVVES------------LDLTT-------------
A0A2D6DVN8      PSH-----AYIQNQFKIIESEKTLLRVVEQ------------LDLPT-------------
A0A3C1W2R2      PSH-----AYIQNQFKIIESEKTLLRVVEQ------------LDLPT-------------
A0A2E3NAY6      PSH-----AYIQNQFKIIESERTMSRVVER------------LDLTT-------------
A0A2E3II01      PSH-----AYIQNQFKIIESERTMSRVVER------------LDLPT-------------
A0A368B8C5      PSH-----AYIQNQFKIIESERTMGRVVER------------LDLTT-------------
A0A3R7RBB5      PSH-----AYIQNQFKIXESERTMGRVVER------------LDLTT-------------
A0A2A2QX62      MTS-----TFFPTEFEVIKAQKTLDSAIEN------------LDLVN-------------
A0A4Q3BWH6      NGA-----TFLPTEFAVIKAQKTLDAAIEN------------LDLVN-------------
A0A3N5WCF1      MSP-----QFFGTEFEKIKSRNSLAKVVDN------------LQLVN-------------
A0A4Q3C1K5      MTP-----QFFGTEFEKIKSYNSLSKVVAK------------LELMS-------------
A0A2G4G428      SNFSITSADDFYTAVESMRSSTIIEAVSRQ------------LTTAE-------------
A0A139TV24      ELGVDSGAANLANESFILRSSTVMRHTVED------------LKLNVSYWKKRDLRQIDL
A0A2N8HT11      ELGMDSGAANLANESFILRSSTVMRNTVED------------LTLNVSYWKQQDLRQIDL
R7DS70          ELGMDSGAANLANESFILRSSTVMRNTVED------------LTLNVSYWKQQDLRQIDL
A0A2N8HNL6      ELGMDSGAANLANESFILRSSTVMRNTVED------------LTLNVSYWKQQDLRQIDL
A0A6I1K459      DKREKGGVDLLNTIANNIRSSGIIKRVVTA------------HNLTR-------------
A0A139TUL1      DLGVRAGEANLANESYVVQSSEVMGRVVKG------------LELGVSYWEKRNIRKVEL
A0A2N8HCB0      DLGFKPGEANLANESYVVKSSEVMGRVVKG------------LGLDVSYWEKRNIRKVDL
A0A2N8HP04      DLGFKPGEANLANESYVVKSSEVMGRVVKG------------LGLDVSYWEKRNIREVDL
A0A2N8HRJ0      DLGFKPGEANLANESYVVKSSEVMSRVVKG------------LGLDVSYWEKRNIREVDL
A0A366HAG0      DDNLASTDSFLKTQFEIITKRRTLDRVVDK------------LDLLE-------------
A0A3M1I8A3      GGVSRMDPEYLQTQYKNLLSRSLLERVVKA------------ERLEQ-------------
A0A4V0XS84      VVQNRQDPDYLQTVAKNLKSRTLMKALIAD------------LKLDE-------------
A0A0R2XQ77      EMNQIRSSEDLNTQISVLNSGAIVQGVERR------------LQDDE-------------
A0A2E9IN28      EQNQIRGAEDLNTQISVMESATIIKGVEQR------------LQDEM-------------
D5ENH7          AQDSIRTAEDLNTQISLLNSSKIIQQVERR------------MSEEQ-------------
A0A351WE84      MIQGYN-PFFLRTQERILKSTPLLYAVIDN------------LNLQA-------------
A0A1V5QDZ6      IPQAYN-PFFLRTQYEVIQSRKVLYQVVEN------------LDLQK-------------
A0A4Y8P964      QAGLFDYENYFKTQVEILKSRSLAQRVVER------------LDLDE-------------
A0A3D4HF88      TKEEIRTSEDLNTQIKILESLAIVNSVADR------------IKGAE-------------
A0A351MR11      ELYAIMSADDFNTAIEVMKSSGIIEAVERR------------LTTSE-------------
A0A6G6K641      QQDDLSNEQSLNTLIETLNSRTMLQRVAIR------------LKLDR-------------
A0A5B5WI95      ELGIDSGAANLANESFILKSTAVMKKVVED------------LKLNTSYWYSQDFRKIEL
A0A2N8I9W1      ELGIDSGAANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFREIDL
A0A4Q5IH27      ELGIDSGAANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFREIDL
A0A2N8IBZ6      ELGIDSGAANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFREIDL
A0A2N8IJW9      ELGIDSGAANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFREIDL
R6J100          ELGIDSGAANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFREIDL
A0A1V6J089      NRMGYN-PFFLMTQEKILKSKPVLTTVIRN------------LNLQK-------------
A0A3C1BZR1      SRMGYN-PFFLMTQEKIMKSRPVLTAVIRN------------LNLQK-------------
A0A1H6KPB7      LQNNAS-ENYIPTQFEILVSDMNLMAVSKK------------LNLAQ-------------
A0A2E9ISN4      TTQYDRQERSLSRQMLLLNSNRLHQQVR--------------ANLAE-------------
B9XAX1          SRQDLRTGEMLNTIVQNVKNTKVLGRVVRN------------IGLAT-------------
A0A5R8KKM9      QNNNLAGDGFLKTQLEIIQKPKTLERVVEK------------LKLLE-------------
A0A139TS01      ASSNIT-DNYIPMQYSVLTSSEVLKVVSKK------------LNLAA-------------
A0A3E1EJT7      VDSNITSEPDFNTQIKVLESLTILQNVANR------------LTPDE-------------
A0A317ZP96      EQNQIRSAEDLNTQISLLESGTIIQGVEQR------------LQDDM-------------
A0A2D5WGA5      GPTAFD-PYFIQTEFEKIQSQKVLDKVVEK------------CELED-------------
A0A2E7SSH2      TQSSFD-PYFISTEFEKIQSQVVLDEVVKK------------CDLKK-------------
A0A349GXM8      -------WTSLHTHTYMLNNEKLHERVMNK--------------LAE-------------
A0A4P5YP61      KPDEQTTTEILKTFEQTIVSRPVLERVAAT------------NQLTK-------------
A0A6B2LYM4      VRQEVANAEDFNTQIKILESLNIVQAVDER------------LKGNL-------------
A0A6D1VXB3      QAGLFDFENFFKTQVEILKSRSLAQRVVER------------LDLDE-------------
I0JYY7          QAGLFDFENFFKTQVEILKSRSLAQRVVER------------LDLDE-------------
A0A4R7S1J2      TDKDWANTEAMNTLAATMRSSTFLERLIDR------------EKLQT-------------
A0A2A2XV69      GGRGFD-PRFITTQFEIIQRKEILYPVIEA------------LGLEQ-------------
A0A651H7X9      LDPTIRTTEDFNTQVRRMESISLIQRVASR------------LTGEE-------------
A0A4Y8P842      EPGLFDWETFFKTQCEIIKSRSLAQRVVER------------LDLDE-------------
B3DZK9          EPGLFDWETFFKTQCEIIKSRSLAQRVVER------------LELDE-------------
A0A5E6MPC4      SANAFEYDTFFRTEIEILKSRAMAERVVDR------------LNLEE-------------
A0A4V1SB02      STPIKG-TDQLNTVVQSLTSNKVLLAVANH------------TNYGK-------------
A0A3C1VB86      SEDMRS-QETLNTVAQKLSNLALLTQVLEE------------NHLLP-------------
A0A146G2Q9      GVQGLD-PRFLATQFEIIQRKEILYPVIDA------------LGLDR-------------
A0A2T6D3Y2      GVQGLD-PRFLATQFEIIQRKEILYPVIDA------------LGLDR-------------
A0A2V2SDV4      FPSSYD-PYYINTEFELIQSEVILQPVITK------------LDLNK-------------
A0A2V5PK75      TA-GYD-PYFIQTEFETIQSERVLGKVIDK------------LELND-------------
A0A1V6DME1      LP-GYD-PYFIQTEFEVIQSERILSNVVHQ------------LNLSV-------------
A0A3D3DIJ3      LA-GYD-PFFIQTEFELIQSELILGKVVAD------------LDLNT-------------
A0A2D5VY59      MSQQHD-PYWVLTEFEKIQSKVVLHPVIDA------------LELRN-------------
A0A2D8UZZ4      MSQQHD-PYWVLTEFEKIQSKVVLHPVIDA------------LELRN-------------
A0A353DV86      MSQQHD-PYWVLTEFEKIQSKVVLHPVIDA------------LELRN-------------
A0A2E5EPT8      QGPDFD-PFFILTQFERLQSAEVLYPVIEK------------MNLGR-------------
A0A6I1K583      QQGGFD-PYFVMTQFEILQSKEVLYKVIDD------------LKLVQ-------------
A0A350EWA4      AVQGFD-PYFLQTEFEKIQSKTVLYQVITN------------LNLAD-------------
A0A5B5WZ91      ASSNMT-DNYIPMQYSVLTSSEVLKVVSKK------------LNLAA-------------
A0A2N8HD92      ATSNVT-ANYIPMQYSVLTSTEVLKIVSKK------------LNLAA-------------
A0A2N8HIT2      ASSNVT-ANYIPMQYSVLTSTEVLKVVSRK------------LNLAA-------------
A0A354EBD3      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A355VEB2      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A2N8IMT3      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
R6K1U5          ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A2N8IWC2      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A2N8I441      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A2N8I3A6      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A410SCC4      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A3R5VEW0      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A411SSG2      ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
B2UKW3          ATSNVT-ANYIPMQYSVLTSAEVLKVVSRK------------LNLAA-------------
A0A1M6RLZ4      SGRLMT-RQFFATQFQLIESEENLKRAAIR------------CQLPE-------------
A0A354T7G8      DSLAFT-QEYIKTQFETITKPSTLYPVIQS------------LDLAK-------------
A0A2S7U4L6      SSALMT-RQFFGTEFKKIESDENLKRAAEL------------VQLPQ-------------
A0A512MBZ2      SD------VFVKTEFESINKPETLYPVIEK------------LDLQK-------------
A0A2E8MEZ0      STMTA---RYMENEFETITAPETLAEAAEN------------IDLPR-------------
A0A4Q2YKS3      MDRMT--PRFFETEFEKIKSSKSLEKVVNN------------LDLVK-------------
A0A6B3LBV6      QKMFAS-RNFIANQFERMTSQQVLQRVVRDE------------DLVQ-------------
A0A2E3EC33      TESLPY-MTFMQTQFEIIQSRETLKEVINNGKDSLGQP----LDLXA-------------
A0A2E4GN01      SESLPY-MTXMQTQFEIIQSRETFKEVINNGKDSLGRP----LXLME-------------
A0A1Z8XU55      SEQLPY-MTFMQTQFEIIQSRETLKQVISKGKDSAGNP----LDLKK-------------
A0A2E1RQR9      SEQLPY-MTFMQTQFEIIQSRETLKQVISKGKDSAGNP----LDLKK-------------
A0A2E3ISQ4      SEQLPY-MTFMQTQFEIIQSRETLKEVIKNGENSAGNL----LDLKK-------------
A0A2D6W6F4      SDQLPY-MTFMQTQFEIIQSRETLKEVIKNGVDSAGNL----LDLKK-------------
A0A2D8Z5A8      SDQLPY-MTFMQTQFEIIQSRETLKEVIKNGVDSAGNL----LDLKK-------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      --------------------------------------------------HPLFGGGKTN
A0A2V5PST3      ----------------------------NKIFTGASITSDNPIKRVRSWILGTLNSLISP
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------PKQLIGETGLSETNVIERLHQISKAGFFGL
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      YDRSPIAVHFSERGNPAEAGFRVIPVSDTEFRLESGVNDSRPERETGVFGREI-------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      -----NLSPSHPQSRWSRILSRSQPEAEMTLFTFPPEDNRPYYLVSEKGNKISLFDSNHQ
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      --------------------------------------------------------LEKV
A0A2V5URB2      ------------------------------------------------------NPQFTG
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      YEDSPIAVQFTPEGGAADARFCVVPLSGKEFRLEKDEKDRGGQETGTFGKEVRFDSLTFI
R7DZW0          YQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFI
A0A2N8HID1      YQDSPIAAQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFI
A0A2N8HS06      YQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFI
A0A3R5R2M8      YRNSPILAVFEEIGSNRSCRISVTPVGEQSFILAYSNSREEPAFLKGEYGQPISLPFATV
A0A411SUQ6      YHATPLLVHFEQIDKQRACTLHITPLDEKRFTLGHPNDQGELILLEGFYGKPLTLPFATI
A0A2N8HZF2      YKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVI
A0A354E720      YHASPLLVNFEQIDKQRACTLHITPLDEKRFTLGHPNNQGELILLEGFYGKPLTLPFATV
B2UPB6          YHATPLLVHFEQIDKQRACTLNITPLDEKRFMLGHPNDQGELILLEGFYGKPLTLPFATI
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A2N8HDG3      YRDSPITVTFDGIAENRFCNVDITLQEGNTLVLTYHDINGNPVQEKGTFHSPIHLPFATV
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      YRESPVEVIFENIPSDRSCSFDITLKGDSALSLTYQGSDGKPVQLEEELKKPVHLPFATI
A0A2N8HT11      YKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATV
R7DS70          YKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATV
A0A2N8HNL6      YKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATV
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      YHTTPLKVEFGEEVDFQPCSLAVTPLNGREFSLSYREKGGRETALAGKFGIPLELPFATV
A0A2N8HCB0      YHTTPLKVEFSEEAAFQPCSLAVTPLNGREFSLSCREKEGGENVLHGKFGVPLKLPSATV
A0A2N8HP04      YHTTPLKAEFSEEVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLPFATV
A0A2N8HRJ0      YHTTPLKAEFSEQVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLPFATV
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      YNSSPILAVFEEIGKQRSCSFSITPRGEQNFILAYTTSQKKTTTLEGTYGQSIALPFATV
A0A2N8I9W1      YKTSPLLVHFERIDKQRACTLHITPLDEKRFMLSHYNNQGESVQLEGFYGKPLTLPFAVI
A0A4Q5IH27      YKTSPLLVHFERIDKQRACTLHITPLDEKRFMLSHYNNQGESVQLEGFYGKPLTLPFAVI
A0A2N8IBZ6      YKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVI
A0A2N8IJW9      YKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVI
R6J100          YKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVI
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ----------------------------NPAFVAPGAKPTEIQLADKLRG-KVRAVLRRG
A0A2V5UHJ2      DAAKEGLVAGFWKELKNWAKGFMPATPTPSTPDPIPLSTRLAGSYLL----MLEVRPVVS
A0A2V5PST3      VAKFFRESRQESAESDTPDAAARGGNLVDRQETDKNKPVVSRGLVGHYMS-FLQVNSIEK
A0A2V5PXM3      -------------------------DPRFLKIDDGAPRPTREKLVTRLSK-MVDAKLRKG
A0A139SU05      ------------------------VAIIQRPYLKSQAPGEPLPPLAAMLG-LLSIDPVRN
A0A1D8AZK8      ------------------------IKILQRPYLKDLAPGANPPPVGGLLG-SMAPQSVRN
A0A1V5QB01      -----------------------------------------EEVSRTITR--ISVAPVGK
A0A139SPN4      ------------------------IAIIQRPYLKSQPPGEPLPPLAAMLG-LLSIDPVRN
A0A1V6E7N1      ------------------------VKILQRPFLTKLSPGATPPSAGAALG-SMVPSPVRN
A0A2D9MYT1      TGYAGGDAPALSREENRPLATGLFAFPPKPKDGEEPEDLTYEEQLKRLSD-AVSVSPIRL
A0A258ANJ7      -------------------------LPSFSGGHPADSKEARDNAIFMVSS-MIRISLRKD
A0A139TLN4      ----------EFCSHTFTVEKTPRFDSRSLDAPVIVRKTFIKNAAIALIG-GLTVNKASG
A0A290QGD9      -------------------------LAQFMAPYLKGGSGDPLTPAEVLFK-NRRVIPRRM
A0A1D8AS58      -------------------------LELFMAPFKSPGAEVPITAAEVVYL-NRKIVPVRL
I6AQC1          -------------------------LRRFMQPYEKGRFGDPLTPLEVLGE-NRSIVPFRM
W0ITH7          -------------------------LRRFMQPYEKGRFGDPLTPLEVLGQ-NRSIIPFRM
A0A1G3ZFT0      RILEGKIGERLANQDKSIQLQINQISARAGTKFTLMQYPINDRMVRSMAR-RITIDDPEK
A0A1Z8ZMT6      -----------------PSIMEVFTAKKAEEKKVFAEAPAPEQLAGIISG-WTSSEVRRG
A0A2E8MCT7      -----------------PSIMGIFTAKEPVKKKVFADAPEPEQLSGMISG-WTSSEVRRG
A0A290Q2Z2      ---------------------------KIGRSIGAYAPLATDETYNYLLKKMLRVESPRG
A0A2A2RGK2      ------------------------DPRFLSAVGISAKDATNDRTAGALSG-MVGVIYRPQ
A0A2A2XXF7      ------------------------DPRFLAAAGISARDASPDRVAAALSS-MSASVYRLN
A0A2A2R5D6      ----------EW-----------------GTRLFGGSNLPMDKAFVLLNN-RVDVNVQRN
A0A2V2DJ66      ------------------------LRKLMAPYKDMFTFGPRKTEEEILQM-NRRVIPERM
R7L5A9          ------------------------LKRFIAPYHNMFTFGIRKSEEELLMD-NRSIIPQRM
A0A1J4XH17      -------------------------LTDVFLAPYSVSNKSKEAIAEILFH-NRKIVPERS
A0A3C1VJ32      ----------EW---------------GKK--YNNGETLKTTETMEILKQ-RMGLVPVRN
A0A2N9NTX7      ----------EW---------------G-K--LEGGAPLKKQQTIDKLKR-MMDPRQVRN
B9XK55          ----------AW---------------K-Q--YNNGQKLKTSQSRAQLKR-MMELHPDRN
A0A4P5YMI6      ----------KW---------------AQR--YGSPVPLLDTEAYGVLTK-RLDLRQVRN
A0A2E6T482      ----------KW---------------DPN---EKG--LDLIKAREILKK-TIDVRQYRN
A0A3C0DQZ7      ----------KW---------------DPN---EKG--LDLIKAREILKK-TIDVRQYRN
A0A1Z9CBK5      ----------KW---------------KEH---YGGEELDEVRARKHLEK-VIDVSQYRN
A0A2D6ZI96      ----------KW---------------KEH---YGGEELDEVRARKHLEK-VIDVSQYRN
A0A358KGZ3      ----------KW---------------KKH---YGGKQLTDVEARKHLEK-VIDVSQYRN
A0A2E9ZQX4      ----------KW---------------KKH---YGGKQLTDVEARKHLEK-VIDVSQYRN
A0A3D5JZU0      ----------KW---------------KKH---YGGKQLTDVEARKHLEK-VIDVSQYRN
A0A2E6HCR0      ----------EW---------------KDD---NGGEPLTELVARKRLEK-VIDVSQYRN
A0A1Z8WN04      ----------EW---------------KDD---NGGESLSELRARKLLEK-VIDVSQYRN
A0A2D7L1N4      ----------EW---------------KDD---NGGESLSELRARKLLEK-VIDVSQYRN
A0A2E2R937      ----------EW---------------KDD---NGGESLSELRARKLLEK-VIDVSQYRN
A0A520QQY4      ----------EW---------------KDD---NGGESLSELRARKLLEK-VIDVSQYRN
A0A2D5MR66      ----------EW---------------KDD---NGGEALTELRARKRLEK-IIDVSQYRN
A0A2E0PDQ1      ----------EW---------------KDD---NGGELLTELRARKRLEK-VIDVSQYRN
A0A2E2ZZP9      ----------EW---------------KDD---NGGELLTELRARKRLEK-VIDVSQYRN
A0A2A2RGF2      ----------RW---------------DQK--YRLGQ--SKVKAYEVLTK-LIDPRQVRN
A0A2G4I5Y6      ----------RW---------------DQK--YRLGQ--SKLKAYQVLTK-LIDPRQVRN
A0A3M1I883      ----------AW---------------SKRLGLRDGELLNEQEAYQYLLR-NMEVKQSRN
A0A1V6JZ45      ----------TW---------------GQR--LKN--AVSEPEAYLLLRR-NLDVRQSRN
A0A520RRW5      ----------KW---------------MER--FKTDTPLTTNETFQVLKN-SIDVDQYRN
A0A356NPK0      ----------KW---------------MER--FKTDTPLTTNETFQVLKN-SIDVDQYRN
A0A2D7B5P5      ----------KW---------------MER--FKTDTPLTTNETFQVLKN-SIDVDQYRN
A0A3D3XGB5      ----------KW---------------MER--FKTDTPLTTNETFQVLKN-SIDVDQYRN
A0A2V6F8A1      ----------RW---------------GER--YNNGVALSKAETFDVLKG-KIDVRQTRN
A0A2V5TNH4      ----------RW---------------GGR--YNNNIPLKTPETFDILQG-KIDVRQTRN
A0A2V5X5Q6      ----------RW---------------GER--YNNNIPLKTPETFDILHG-KIDVRETRN
A0A4P5QM05      ---------------------------ELS---PPGQTMPLQWVTEILSR-SMVVQEQRN
A0A4Q3C001      ---------------------------YYS---GDGPPLPKQTVLRLLNA-DLVLQEVRN
B4DB23          ---------------------------EFS---PPGQRLPLQQVYIQLRN-SMKLNEVRN
A0A6B3L938      IPPPLSLKPKYW----------RDESSREF---QSAAETSETDFLELLYS-GISVSNQRG
A0A2V5URB2      QARHKNFAAELWSRATAWLNSLSSQPVTAN---APDVYGINSQLIDAYQG-MVEIEPLKR
A0A5R8KA81      ------------------------DMTFPE---VRDYIMTEPELVDALES-EIDITIRKG
A0A5B5WU87      VEKTPRFSEAAL---------------NVP---VIVRKTSVRNAAVGLRS-GLTVKKANG
R7DZW0          VEKTSKFDESSL---------------NVP---VIVRRTSVKNAAMGLGS-GLTVRKASG
A0A2N8HID1      VEKTPKFDESSL---------------NVP---VIVRRTSVKNAAMGLGS-GLTVRKASG
A0A2N8HS06      VEKTPKFDESSL---------------NVP---VIVRRTSVKNAAMGLGS-GLTVRKASG
A0A3R5R2M8      SIHPTSVMNADWNGQTVIIRHVPSQ----------------DTARALLANFSVARPDAKD
A0A411SUQ6      SVHPTSLMTDAWNGKTVIVRHSPVL----------------ETANALLRGLTITRPDSKE
A0A2N8HZF2      SIHPTSLMTDAWNGKTVIVRHSPVL----------------ETANALLRGLTITRPDSKE
A0A354E720      SVHPTSLMTDAWNGKTVIVRHSPVL----------------ETANALLHGLTITRPDSKE
B2UPB6          SVHPTSLMTDAWNGKTVIVRHSPVL----------------ETANALLRGLTITRPDSKE
A0A2A2XXW5      ---------------------------------DDERYTKSVDKVTAVTK-DIKIVPIRL
A0A2V6JLK8      ----------KW----------------AR---D-GRPPSREIAYQMLRN-RLDVDEVRN
A0A2W5Z1A5      ----------KW----------------AN---HSAGPLSREQTYAILRG-KLEVDEVRN
A0A2V6EA09      ----------KW----------------GK---DLGRP-SREQTYKLLLS-RLDVEEVRN
A0A2V6GQI7      ----------KW----------------GK---DLGRP-SREQTYKLLLR-RLDVEEVRN
A0A3C1HEJ2      -----------------------DPRVVEP---EIQGILSRAKLVARVSD-LIAPRLRPA
A0A522ULD9      ----------EW-------------GKKFN---EDKSPINRSLAFSILSG-ALRVQPYRD
A0A1V6JU76      ----------------------------------DSRYRDSPDVARALAE-DIRINPIRL
A0A1Q6UHJ9      ---------------------IVRFMAPFN---DMFTLGPRKTEEELLAE-NRTIAPERM
A0A2V2BXR0      ---------------------IVRFMAPFN---DMLTLGPRKTEEELLAE-NRTIAPERM
A0A2D8V0G3      ----------------------------------DEVFKGAENIVNAVRD-CITISPIRL
A0A348S017      ----------------------------------EGRYAQSQNVINAVRN-DISISPVRL
A0A3C1UUV7      ----------------------------------EGRYAQSQNVINAVRN-DITISPVRL
A0A350I3V2      ----------------------------------EGRYAQSQNVINAVRN-DITISPVRL
A0A520RGV5      ----------------------------------EGRYAQSLDVINAVRN-DITISPVRL
A0A3D3XF90      ----------------------------------EGRYAQSLDVINAVRN-DITISPVRL
A0A2D7B522      ----------------------------------EGRYAQSLDVINAVRN-DITISPVRL
A0A356NIC2      ----------------------------------EGRYAQSLDVINAVRN-DITISPVRL
A0A2U8DZK4      -----------------------KLAAVLE---IPGPLPVDFTYDYLIKKRIVSVESPKT
A0A2T6DFL8      -----------------------KIAALKD---SPAAFPSAVTYAILTRK-MLRVESQRA
A0A1D8AWD4      -----------------------ILGKQLN---DGVALPSAITYRYLISK-MLRVEAPRA
A0A4Q1C9S2      -----------------------ILGKQLN---NGAPLPSAITYKYMLDK-MVRPDAPRA
A0A178IH18      -----------------------RIAALLG---ASAPYPTDVTYEYLTKK-MLRVEMPRN
A0A2T6DT99      -----------------------KLAASQG---SSVPLPTDVTYLLLVNK-MIRIETPRG
A0A1G3ZT33      -----------------------VLGKMLN---NGEPLPTSITAQYLLRK-MLRVESQRS
A0A3E1E2T2      -----------------------VLAPALD---SPEPLPDAITYHYLLQK-MLRVESQRS
B1ZMW1          -----------------------RLAPLLG---ATGPLPSAMTYRYLLNK-MLAVESQRS
A0A2N8HDG3      TVYPTSNMTETVPGTTITVRRTPVN----------------AAADQLLAN-FTVMRPDAK
A0A146GCJ0      ----------------------DPDFAPPR---KDGSPYSEIELVDKLAQ-KIDVQLIRG
A0A2T6D6H8      ----------------------NPEFAPPR---SNGGKYTDIELADRLAS-KVSAKLRRG
A0A3D1TI55      ----------VW-----------GR--QFN---DNQEEMDLESTISRLRS-MVETVQVRG
A0A3R8IT45      ----------------------LKKFMEPY---EKGRFGDPLTPLEVLGQ-NRKIVPLRL
A0A1H1MGC9      ----------------------LKAFLAPY---QKSAASSPPSPAEIIFR-ERKIVPVRL
A0A2A2PYE8      ----------------------LRAFLAPY---ER-AGTDITYVAEILAK-NRKIIPQRL
A0A2T6CN73      ----------------------LREFLAPY---DT-GAPEKPSVARLLKL-NRRVIPQRL
A0A3E1ET42      ----------TW-------------------------GLTFDEALTKLER-MIETETERG
A0A2A2YDW8      ----------RW-------------------------NVTEEDALMTLTG-IVQAQNIRG
A0A352XLN9      ----------RW-------------------------NVTEEDALMTLTG-IVQAQNIRG
A0A3D0YP62      ----------SW-------------------------GQDRKTVIDVLRQ-IVRTTQRRG
A0A3D3DV47      ----------SW-------------------------GQDRKTVIDVLRQ-IVRTTQRRG
A0A2E5XJ49      ----------RW------------------------SGYDRDMALLKVKK-ILKTEQIRN
A0A2E6SBY8      ----------RW------------------------SGYDRDMALLRVKK-ILKTEQIRN
A0A2E5QMS4      ----------RW------------------------RGYDRDMALVKLKQ-ILKTEQIRN
A0A2E7YXQ3      ----------RW------------------------RGYDRDMALVKLKQ-ILKTEQIRN
A0A2E3H787      ----------RW------------------------RGFDRDMALLKLKS-ILKTEQIRN
A0A2E7AGN1      ----------RW------------------------SGFDEDMALIKLKS-ILKTEQIRN
A0A2E7AKY7      ----------RW------------------------SGFDEDMALMKLKS-ILKTEQIRN
A0A3D4CU34      ----------RW------------------------SGFDEDMALIKLKS-ILKTEQIRN
A0A2E8M146      ----------RW------------------------NGFDQNMALLKLKS-ILKTEQIRN
A0A355S8S2      ----------RW------------------------NGFDQNMALLKLKS-ILKTEQIRN
A0A2D6DVN8      ----------RW------------------------NGFDRNMAVLKLKS-ILKTEQIRN
A0A3C1W2R2      ----------RW------------------------NGFDRNMAVLKLKS-ILKTEQIRN
A0A2E3NAY6      ----------XW------------------------NNFDRNMALLKLKS-ILKTEQVRN
A0A2E3II01      ----------RW------------------------NGFDRNMALLKLKS-ILKTEQIRN
A0A368B8C5      ----------RW------------------------NNFDRNMALLKLKS-ILKTEQVRN
A0A3R7RBB5      ----------RW------------------------NNFDRNMALLKLKS-ILKTEQVRN
A0A2A2QX62      ----------RW-------------------------NSDRESVRGTLRG-IVSAQNIRG
A0A4Q3BWH6      ----------RW-------------------------NTDLESVRGILKG-IVEAQDIRG
A0A3N5WCF1      ----------RW-------------------------NVDKEAALGILKG-IVGTQNIRG
A0A4Q3C1K5      ----------KW-------------------------GVDKDTAIKILKG-IVQTQNLRG
A0A2G4G428      ---------------------KKEVLAPYQ---SGNIFSGPLSEQEVFSR-QRSIMPQRQ
A0A139TV24      TVYPTSHMPETIPGTTITVRRVPIN----------------AAADQLLAN-FTVKRPDAK
A0A2N8HT11      TVYPTSNMPETVSGTTITVRRIPVN----------------AAADQLLAN-FTVTRPDAK
R7DS70          TVYPTSNMPETVSGTTITVRRIPVN----------------AAADQLLAN-FTVTRPDAK
A0A2N8HNL6      TVYPTSNMPETVSGTTITVRRIPVN----------------AAADQLLAN-FTVTRPDAK
A0A6I1K459      -----------------------HP--YFT---GGTNTLTESQVMAAVGG-MLDARLRRF
A0A139TUL1      TVRTTSHFSS-------------GSIGRPI---FVERLSVKEACAQMLGR-LSVTRPDSK
A0A2N8HCB0      KVCPTSYFSS-------------GSMGRTI---FVERVSVKEAAAGMLGR-LSVTRPDSK
A0A2N8HP04      NVCPTSYFSS-------------GSMGRTI---FVERVSVKEATDGMLGR-LSVTRPDSK
A0A2N8HRJ0      NVCPTSYFSS-------------GSMGRTI---FVERVSVKEATDGMLGQ-LSVTRPDSK
A0A366HAG0      ----------KW-----------NL--KSK-----------QAAAGKLIG-NLDAQSSIK
A0A3M1I8A3      -----------------------DPRYSKE-----------MDIVAALAK-DITVTPIRM
A0A4V0XS84      -----------------------DIRYSRA-----------KDLIKVLSE-DLTVAPIRA
A0A0R2XQ77      --------RERFMAPYADVLSFTGP----------------LSPAALLAQ-NRRIMPQRG
A0A2E9IN28      --------RERFMAPYTDALSLSGP----------------LTPLEILGR-NRSIMPKRM
D5ENH7          --------RKKFMQPYEGAFSFSGP----------------LTASEILGK-YRKIMPQRM
A0A351WE84      ----------VW-----------GQ--QYN---DDKSPITKEDALATLSS-SIKIEQDRD
A0A1V5QDZ6      ----------VW-----------GE--EVN---DDGSPLPLERAHAMLSR-SLKVEQFRD
A0A4Y8P964      --------HPDWLGLKKPSITKHSK-NSSE---EEETSSIINSYTKRILD-NLRIEPVKN
A0A3D4HF88      -----------------------RK--MLM---EPYKGDEEVTINEVLYE-NRDVVPLRA
A0A351MR11      ----------RK-----------AVLEPYQ---SGNIFSGPLTSQEVFGR-QRGIAAQRM
A0A6G6K641      ----------DF------------VFLPRP---AGRDANPLDVVVGRLQG-CVSSGVRGR
A0A5B5WI95      SIHPTSLMNEEWDGKPIIINHLTVL----------------ETAHGLLKN-FSVTRPDVK
A0A2N8I9W1      SIHPTSLMTDAWNEKTVIVRHKPVL----------------ETANNLLHG-LTVTRPDAK
A0A4Q5IH27      SIHPTSLMTDTWNEKTVIVRHKPVL----------------ETANNLLHG-LTVTRPDAK
A0A2N8IBZ6      SIHPTSLMTDAWNEKTVIVRHKPVL----------------ETANNLLHG-LTVTRPDAK
A0A2N8IJW9      SIHPTSLMTDAWNEKTVIVRHKPVL----------------ETANNLLHG-LTVTRPDAK
R6J100          SIHPTSLMTDAWNEKTVIVRHKPVL----------------ETANNLLHG-LTVTRPDAK
A0A1V6J089      ----------VW-----------GA--QLN---EDKSAITPELALQILQR-SIRVEQDRD
A0A3C1BZR1      ----------VW-----------GM--EFN---EDKSPVAPELALQILSR-SLRVEQDRD
A0A1H6KPB7      ----------QW-------------------------QTDDATAASILRG-MIQVMPVRG
A0A2E9ISN4      ----------EW-------------------------KKKLTEPERYVEF-LVTSVPGSN
B9XAX1          --------NSFF----------------LP---GNTNVLSEAKLVNALAG-MIVTKLRPE
A0A5R8KKM9      ----------LW-----------SLPANGR-----------QFAIGRLQG-HLEVNSSAR
A0A139TS01      ----------EW-----------GM---TD-----------DLAATNLAG-MIKVSPLRA
A0A3E1EJT7      -----------------------LRLLLEP---YKSHAGEPPSPASIIYH-NRQIIPQRL
A0A317ZP96      --------RKRFMAPYTDALSLRGP----------------LTPTEVLGR-NRKIIPRRM
A0A2D5WGA5      ----------KW----------------KP---ANGDPLSDVNARKILEK-SIDIRQYRN
A0A2E7SSH2      ----------RW----------------KE---LYKWDLNDQQARKQLEK-VIDVSQYRN
A0A349GXM8      ----------AW---------------ADR-----------LGGRHRMNP-KIAISQVRG
A0A4P5YP61      --------NGEFLTIYERKKGLFDAVAGTA---APEKEISIDGIAGTLAA-ITESRMRRG
A0A6B2LYM4      --------RNRFLAPYEKGLDA-TL--RGT-----------RSVGQILYS-NRAISPVRL
A0A6D1VXB3      --------HPDWLGLKKESFRK-HSINPSE---GIEPTSEINLYAEYLLK-NLQVTPVRN
I0JYY7          --------HPDWLGLKKESFRK-HSINPSE---GIEPTSEINLYAEYLLK-NLQVTPVRN
A0A4R7S1J2      --------RPDLFGGKLPSAED-AL----------------PQAVGILSG-ALKAAPRVG
A0A2A2XV69      ----------TWKKLY-------GI--AGK-----------EQTIFRLRK-MIDVREIRN
A0A651H7X9      --------MRRF-----------MA--PYE----TGDASDPVTPIEIIGQ-NRRIMPLRL
A0A4Y8P842      --------HPDWI----------GL--KPK---KTAPLPSSEKLAEIVQN-NLHVLPVRG
B3DZK9          --------HLDWL----------GL--KPK---KNGPLPSSEKLSEIVQN-NLHILPVRG
A0A5E6MPC4      --------HPDWVGLKPGWRKA-AK--RAN----LEEEPYISPVAGLLVG-NLRIEPVRN
A0A4V1SB02      ----------EIAQSQKSNGQA-GT--DID-----------SVIVDTLNS-KLKVTLRRN
A0A3C1VB86      ----------PE-----------GT--VVT---NGSKTVTRENIISQFEK-NVKTSLRRN
A0A146G2Q9      ----------KW-----------GM--PSR-----------EQAYFRLVR-MINIQEIRN
A0A2T6D3Y2      ----------KW-----------GM--PSR-----------EQAYFRLVR-MINIQEIRN
A0A2V2SDV4      ----------VW-----------GA--KYG---PNGAPLQSTDTMKLLQA-RMGLQPVRN
A0A2V5PK75      ----------DW-----------GK--KYH----GGVKLKTPDTIVMLKG-RMDLRPVRN
A0A1V6DME1      ----------EW-----------GK--KYA----GGERLKTQETMTLLRN-RMDLNPVRN
A0A3D3DIJ3      ----------EW-----------GR--KYA----SGERLRTPETIALLKQ-RIDLRTVRG
A0A2D5VY59      ----------RW-----------MK--RYN----LKQPLTLNEAFNVLKK-SIEVDQYRN
A0A2D8UZZ4      ----------RW-----------MK--RYN----LKQPLTLNEAFNVLKK-SIEVDQYRN
A0A353DV86      ----------RW-----------MK--RYN----LKQPLTLNEAFNVLKK-SIEVDQYRN
A0A2E5EPT8      ----------VW-----------GA--RYG----IGEFTP-QKTKLLLEK-RIDPTQVRN
A0A6I1K583      ----------RW-----------DQ--KYR----LGQSK--FKAYQVLIK-LIDPRQVRN
A0A350EWA4      ----------FY-----------RD--ARK----LEVNLKPEEAYMLLKG-DLSVSQMRN
A0A5B5WZ91      ----------EW-----------GM---TD-----------ELAATNLAG-MIKVSPRRA
A0A2N8HD92      ----------EW-----------GM---TD-----------EKAASNLAG-MIKVAPVRA
A0A2N8HIT2      ----------EW-----------GM---TD-----------EMAASNLAG-MIKVAPVRA
A0A354EBD3      ----------EW-----------GM---TD-----------EMAATNLFG-MIKVAPVRA
A0A355VEB2      ----------EW-----------GM---TD-----------EMAATNLFG-MIKVAPVRA
A0A2N8IMT3      ----------EW-----------GM---TD-----------EMAATNLFG-MIKVAPVRA
R6K1U5          ----------EW-----------GM---TD-----------EMAATNLFG-MIKVAPVRA
A0A2N8IWC2      ----------EW-----------GM---TD-----------EMAATNLAD-MIKVAPVRA
A0A2N8I441      ----------EW-----------GM---TD-----------EMAATNLAD-MIKVAPVRA
A0A2N8I3A6      ----------EW-----------GM---TD-----------EMAATNLAD-MIKVAPVRA
A0A410SCC4      ----------EW-----------GM---TD-----------EMAATNLAD-MIKVAPVRA
A0A3R5VEW0      ----------EW-----------GM---TD-----------EMAATNLAD-MIKVAPVRA
A0A411SSG2      ----------EW-----------GM---TD-----------EMAATNLAG-MIKVAPVRA
B2UKW3          ----------EW-----------GM---TD-----------EMAATNLAG-MIKVAPVRA
A0A1M6RLZ4      ----------RW-----------NL--PMQ-----------E-VVSIMTK-SLNTNQERG
A0A354T7G8      ----------RW-----------EL--PSR-----------QAALAKLRA-NLETQSMLR
A0A2S7U4L6      ----------KM-----------QI--STD-----------E-AILVLKG-GLSARQERG
A0A512MBZ2      ----------KW-----------SL--PSR-----------QAALGKLQG-NLNAQSMPR
A0A2E8MEZ0      ----------RW-----------GL--DMD-----------S-AIKTLEN-VVETIPIRG
A0A4Q2YKS3      ----------RW-----------GK--DRD-----------QIVAELKYK-IITTQNIRG
A0A6B3LBV6      ----------KW-----------AL--TDE-----------NQAIAKLRD-SVETENRRG
A0A2E3EC33      ----------KW-----------GL--TSE-----------EDAFXILKK-KVETQXVRG
A0A2E4GN01      ----------EW-----------GV--SSE-----------DDAFRXLKK-KVETQDVRG
A0A1Z8XU55      ----------AW-----------GV--NSD-----------EDAYRILKX-KVETQDVRG
A0A2E1RQR9      ----------AW-----------GV--NSD-----------EDAYRILKK-KVETQDVRG
A0A2E3ISQ4      ----------SW-----------GV--PTN-----------EDAYQILKR-KVETQDVRG
A0A2D6W6F4      ----------SW-----------GV--PSD-----------EDAYRILKR-KVETQDVRG
A0A2D8Z5A8      ----------SW-----------GV--PSD-----------EDAYRILKR-KVETQDVRG
                                                                            

A0A2A2XVF1      TR-LIDIIVE--DKDPV------MARDLAASFVKEFLRENFSQRLSVSRVATDFLQEESQ
A0A2V5UHJ2      TS-LVVIKFT--TPDPA------LSARLANAHASSYVRYGIDLRSQTNSEASEFLQEKLT
A0A2V5PST3      TR-LVEIAFV--TPNPA------LSQKLADAHIKAFIRMNLEGRFQLTKEARDFLDIKNA
A0A2V5PXM3      TR-LIDVKVE--HTSPE------MAALIANSL-------------------LNFLRNEEK
A0A139SU05      SF-ILRLTVG--HQDPE------AAAILAQRHVDQFLSYLLENISGVNDTAVDFLRERAE
A0A1D8AZK8      SF-LINISVT--NRDPE------GAALLANRYVEQFMRYLLENVGGKNEFAVDYLKTRAE
A0A1V5QB01      TA-FLAITVE--SLDPV------LGSDMANALADEYLDFKAEERLNTSQATVVSLTQQAN
A0A139SPN4      SF-ILRLTVG--HQDPE------AAAILAQRHVDQFLSYLLDNISGVNDTALDFLHERAE
A0A1V6E7N1      SF-LISVSVN--HQDPE------AAALIANRYIDQFMQQIMDSTMGKNEYATDFLRKRSD
A0A2D9MYT1      SR-LVDVSVE--SPNRN------EAALIANTVISKFLEQDNNRKRGKLANAVDFLREEAT
A0A258ANJ7      TR-LIDFNVT--GADPE------QVAALSNQAVLSLVSELESQKSKTLQGAIQALVAEGQ
A0A139TLN4      KTNLINISVR--CNNPV------KAENVLHNLVRFYNEASLDEKKKRGMNTDKFIEERLG
A0A290QGD9      SL-IIEVQYR--HPDRV------LASDIANMFVDEFIAYNSRVRIDESMKAVDELRARVN
A0A1D8AS58      SL-VLQVQFS--HPDKL------MAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERAD
I6AQC1          SL-LVAIEYR--HPDRL------IAAKVANLFLEEFVQFNTRQRVDQTFGILEDLKLRAE
W0ITH7          SL-LVAIEYR--HPDRL------IAAKVANLFLEEFVQFNTRQRVDETFGILEDLKLRAE
A0A1G3ZFT0      LG-LLTLAYQ--DTNPH------LAARVVNEIAKVTQHKNTEKKSLEASKILSFLSKQLP
A0A1Z8ZMT6      TR-LIDISVN--HTDPD------VAQVIANQIIQQFINIREGVNEEGKKSDLQHLLTAAK
A0A2E8MCT7      LR-LIDISVN--HTDPD------VAQVIANQIVKQFINIREGVNEEGKKSDLQHLLAAAK
A0A290Q2Z2      SS-MIEVGVY--SQDAA------LAAAIANEIARVYSDDRIMFATSEQREGLTQLRKELE
A0A2A2RGK2      TR-LIDVSIT--SRDPN------LSVKLANAYADEYIRYVFEKRSDAAKSATQFLVEEAD
A0A2A2XXF7      TR-LIDLMIT--SADPN------LSVKLANAYCDEYIRYVFERRSDASKSATQFLLEEAD
A0A2A2R5D6      SD-ILEIRVK--SDLPK------EASDIANAIMDVYIEMRRADLQTRESRGFKTLDDEIA
A0A2V2DJ66      SL-MIRVTYT--HPNAE------MAARIADLFVNEYITYTRMTRVQTLLDSIEELRTKVA
R7L5A9          SL-IVTVIFE--HPDNN------MAARIANLFATEFINYTHQKRVQALMGSIDELRTKVS
A0A1J4XH17      SL-MIMLAYN--HPDPE------IAAKVANMFAEEYINYNMTLNIDGSMKAIFDLKERAK
A0A3C1VJ32      TK-LISITVY--SDDKK------EAADLANSIAEAYRTYRIQTSQQQATTGLEVYQTQYL
A0A2N9NTX7      TS-LVEIWVT--SFNKE------EAAKLANEIAEAYQAHRLEERAELTTGGIKSLEERWK
B9XK55          TS-LIEIKIY--SNDKK------EAAAIANEVAIVYQKYRLDQKLDITGAGIKVFKQQVQ
A0A4P5YMI6      TS-LIEIRVF--SEIPA------EAREIAQKIAEVYRDNRLNAKRSMSAGGIKKLQEKLE
A0A2E6T482      TS-IIELRAY--DRDKE------LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRME
A0A3C0DQZ7      TS-IIELRAY--DRDKE------LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRME
A0A1Z9CBK5      TS-IIELRAY--DRDRG------LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMT
A0A2D6ZI96      TS-IIELRAY--DRDRG------LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMT
A0A358KGZ3      TS-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERME
A0A2E9ZQX4      TS-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMK
A0A3D5JZU0      TS-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERME
A0A2E6HCR0      TS-IIELRAY--DGDED------LAREIAQALAEQYKNYRSNLQKRRVEAGINKLKERME
A0A1Z8WN04      TS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERME
A0A2D7L1N4      TS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERME
A0A2E2R937      TS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKXRVEAGINXLKERME
A0A520QQY4      TS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERME
A0A2D5MR66      TS-IIELRAY--DGDEN------LAREIAQALAEEYKNYRSKLQKGRVEAGIGKLKERME
A0A2E0PDQ1      TS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERME
A0A2E2ZZP9      TS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERME
A0A2A2RGF2      TS-IIEINVY--SKDKA------EAAEIANKIAEIYKENREAQRKLQAEKGLKILRDRLA
A0A2G4I5Y6      TS-IIEINVY--SKDKE------EAAEIANKIAEIYKENRESQRKLQAEKGIKILRARLL
A0A3M1I883      TK-LVEITVY--SPIPE------EAADLANLIAASYKNWRQHSRREHMTNAIAVLQQKLE
A0A1V6JZ45      TS-LIEIRAY--SENRD------EASAIANEVANVYKESRVEEKQRQTSAGISKLRAKLD
A0A520RRW5      TS-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYL
A0A356NPK0      TS-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYL
A0A2D7B5P5      TS-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYL
A0A3D3XGB5      TS-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYL
A0A2V6F8A1      TS-LIEIRVY--SDAKDK--PAQEAAEIANQIATVYRDTQLGLKQEMSQKGIEVLRKELS
A0A2V5TNH4      TS-LIEIRVY--SDAKEKEKPAQEAAEIANEIANVYRDTRLELKQEMSRKGIQVLREELQ
A0A2V5X5Q6      TS-LIEIRVY--SDAKEKDNPAQEAAKIANEIANVYRDTRLELKQEMSRKGIKVLKQELE
A0A4P5QM05      TT-LVDIGVY--HTKPE------LAAVIANTIAVTYRDKRIEELRKNTDQTLKEMKDELK
A0A4Q3C001      TS-FIEIGVY--NTDPQ------TAANIANTIAVVYQNKRLEEQQGNVDRSLAQFRDEVE
B4DB23          TG-LIEVGAK--DTDAQ------RAANIANAIAVVYQEERQHELDKNVARGLEQLKDEVD
A0A6B3L938      TT-LINIEMT--HPDPE------TAKTIANAVMMVYIEGEQARRAGGSSDAFRILKAEAD
A0A2V5URB2      SR-LVRISIS--SADPV------LAASVANAHAIAYVRQGLKLGSQANEEARKFLETKLA
A0A5R8KA81      TR-LIEVSVE--DQVPE------RAQKIAGMLIEESIGQNIESRANAGTLANEFLAAESK
A0A5B5WU87      KNNLVNVSIR--CNNPV------KAEVILHSIVHFYNEASLKEKNTRGTKTNKFIGERLA
R7DZW0          KNDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLD
A0A2N8HID1      KNDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLD
A0A2N8HS06      KNDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLD
A0A3R5R2M8      SS-LLEMTLT--ASNPQ------KAEDVLNHLIEVYNQISIDEKKQSALKTRKFIEGRLA
A0A411SUQ6      SS-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLK
A0A2N8HZF2      SS-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKAALKTENFIQSRLK
A0A354E720      SS-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLQ
B2UPB6          SS-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLK
A0A2A2XXW5      SR-LVEVQVT--HPKGE------QAQRIADTILQVFLQQNLDDKKSKALQGLKILEQEAT
A0A2V6JLK8      TD-LLQISVY--DGSPQ------LAADIANKIVSVYQDRRVEEEKEILNRAVTAMNEEVG
A0A2W5Z1A5      TN-LLQISVF--DSNPQ------LAADIVNKIIAVYQDKRVEEEKDILNRAVGSMNEEVD
A0A2V6EA09      TD-LLQISVF--DANPQ------EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVA
A0A2V6GQI7      TD-LLQISVF--DANPQ------EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVA
A0A3C1HEJ2      TR-LIDVTVQ--HSDPQ------LTEQIANSLAREFLQRRFEQQISASESATSFYRQKEQ
A0A522ULD9      TS-LISIIVR--MEDAA------EAALVANEIAKVYREHRLSEKRSQMMRGMEALEGEIE
A0A1V6JU76      SR-LVDVVVE--HPNAS------KAAGIANALVEEFIEQNLVQKQKRTMDMLFFLRSQAN
A0A1Q6UHJ9      SL-IIRIAFE--HPDPD------MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKVS
A0A2V2BXR0      SL-IIRIAFE--HPDPD------MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKVS
A0A2D8V0G3      SR-LVEVSVE--HPSPL------QAAAIANKLMQNFLTRNLDKKKQRAFESYKWLQNEVN
A0A348S017      SR-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVD
A0A3C1UUV7      SR-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVD
A0A350I3V2      SR-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVD
A0A520RGV5      SR-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVD
A0A3D3XF90      SR-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVD
A0A2D7B522      SR-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWXDTEVD
A0A356NIC2      SR-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVD
A0A2U8DZK4      SS-IVEITID--TRDPA------LSAAIANEIVGVYTEDRINLATAAQKADLAELNNQLA
A0A2T6DFL8      SS-VIEINVD--AEDPQ------LAADIANEVARTYSADRIALATSDQSEGMAQLRQELL
A0A1D8AWD4      SS-IIEIDVY--ARDQR------LAADIANAIARVYAEDRITLATSDQREGLAQLRKELD
A0A4Q1C9S2      SS-IIEINVF--ARDNR------LAAEIANAIARVYAEDRIALATADQREGLAQLRKELV
A0A178IH18      TS-LLEVNVF--SRDAA------LAAAIANEIARAYSEDRIAFATAEQRAGLDQLRRELA
A0A2T6DT99      SS-LIEIEVS--AQDPA------LAAAIANEIGTAYSADRIDFATSQQREGLAQLRKELE
A0A1G3ZT33      SS-IIEIDVY--AQEPA------LAARIANEIARVYSENRINFATAGQREGMTELKKQLA
A0A3E1E2T2      SS-LIEISVY--SEDPT------LGAVIANEIARVYSDDRINLATSDQREGFVKLRGELI
B1ZMW1          SS-LIEINVY--AQEPP------LAAAIANEIARVYSDDRIALATSEQREGLAHLRKELE
A0A2N8HDG3      ESSILQMTLT--STNPV------KAADTLNKLIAVYNDHSTAERRTTAVKTKDFIREQRA
A0A146GCJ0      TR-LVQIVVE--DKNPE------KAQKIAATFVKEFFRENFDQKLALSRVANEFLQDEAD
A0A2T6D6H8      TR-LIELTVE--DKNPE------LAQKIAFSIVREFLRENFDQKLALSRVANEFLQEESE
A0A3D1TI55      TT-IIEVQVT--SRDSA------EAAAIANKIAEVFQETRLASVKKKYSDALVQMQEEMD
A0A3R8IT45      SL-IVGVEYT--HPDRL------IATKVANLFLEEFITFTSRQRIDQTFTILEDLKLRAE
A0A1H1MGC9      SL-VLQVQYA--HPDRH------VAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERAE
A0A2A2PYE8      TL-VVTVAYQ--HPDRF------VAAKVANLFAEAYLDHNISLRTQESNNAVEGLKGTVE
A0A2T6CN73      TL-MVWIAYK--HPNRF------VAAKVANHFARAYIDYNTQLRISEGVKAVEDLKGPVE
A0A3E1ET42      TE-IMTVIVS--SVRRD------EAAAIANEVREAYDAQRQEIEAERIRRLTQTLDAKIK
A0A2A2YDW8      TD-LIEITVL--HPGAE------DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAVL
A0A352XLN9      TD-LIEITVL--HPGAE------DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAVL
A0A3D0YP62      TD-LIEISVR--HRKKE------EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQ
A0A3D3DV47      TD-LIEISVR--HRKKE------EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQ
A0A2E5XJ49      TD-HIEIRIR--HQKPE------DAQLIAQEIAKSYQLVRNADERARAGEALDALEAEVR
A0A2E6SBY8      TD-HIEIRIR--HQKPE------DAQLVAREIAKSYQLVRNSDERARASEALDALEAEVR
A0A2E5QMS4      TD-HIEIRIR--HQNSE------DARDVAKEIAESYQXGRNADERNRAGEALDALEAEVR
A0A2E7YXQ3      TD-HIEIRIR--HQNSE------DARDVAKEIAESYQLGRNADERNRAGEALDALEAEVR
A0A2E3H787      TD-HIEIRIR--HQKQE------DARDIAKEIAESYQLGRNADERKRAEEALDALESEVR
A0A2E7AGN1      TD-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVR
A0A2E7AKY7      TD-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVR
A0A3D4CU34      TD-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVR
A0A2E8M146      TD-HIEVRIR--HQNRD------DARNIAKAIAESYKEGRNEDERKRAGDALDALESEVR
A0A355S8S2      TD-HIEVRIR--HQNRD------DARNIAKAIAESYKEGRNEDERKRAGDALDALESEVR
A0A2D6DVN8      TD-HIEIRIR--HQNRD------DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEVR
A0A3C1W2R2      TD-HIEIRIR--HQNRD------DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEVR
A0A2E3NAY6      TD-HIEIRIR--HQNRD------DARDIAKAIAESYQEGRNEDERKRAGDALDALEAEVR
A0A2E3II01      TD-HIEIRIR--HQNRD------DARDIAKAIAESYQEGRNEDERKRAGDALDALESEVR
A0A368B8C5      TD-HIEIRIR--HQNRD------DARDIAKAIADSYQEGRNEDERKRAGDALDALESEVR
A0A3R7RBB5      TD-HIEIRIR--HQNRD------DARDIAKAIADSYQEGRNEDERKRAGDALDALESEVR
A0A2A2QX62      TS-LIEIRVR--YNDPK------DAQAIASAVSEAYRERRTALQSEVASQAMDQLGKAVV
A0A4Q3BWH6      TS-LIEIRVR--YNDPK------DAQKIAKEVAEAYRERRRKLQGDHANQTLDELRKAVL
A0A3N5WCF1      TD-LISIRVR--HTNKV------DARDIAEEVARAYKEYRAEIETRDADRQLQELNKAVR
A0A4Q3C1K5      TD-LIQIRVR--HTSKE------DARNVTDEVAKAYRDYRLEIENRDADKALYELNKAVR
A0A2G4G428      TL-VVNVEFT--HPNRE------LARQVTTLFCKAIQKNSEDERLVITNPLVEKYRMDID
A0A139TV24      ESSLLQMTLT--SSNPD------KATDTLNKLIEIYNEHSREERRAIAVKTKEFIRRQLE
A0A2N8HT11      ESSILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRG
R7DS70          ESSILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRG
A0A2N8HNL6      ESSILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRG
A0A6I1K459      TR-LIDVTAE--SGDPA------LAQTLAQAVVEEYIKQNSEDRTGVGQNAGQFLMAEEM
A0A139TUL1      ESSLLELTLR--LSHPQ------KAEDVLNYLIEVYNDHSRREKQIASTRAEDFIVKRIE
A0A2N8HCB0      ESSLLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQLAASRAEEFIVKRIG
A0A2N8HP04      ESSLLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIG
A0A2N8HRJ0      ESSLLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIG
A0A366HAG0      SD-FITLDYY--DEDPD------LAALIANTIADSYKETRLETDNARINKAIEGLNIQIA
A0A3M1I8A3      TR-LVEVSVE--HTDPR------KAKDIVDRLANEFIERNRLLKTGRMMSTLQVLRSQAQ
A0A4V0XS84      TR-LIEIKAN--HTDPQ------KAAKIVNTLVSIFMKQNTDDQSSKSQETFKLLTDEAK
A0A0R2XQ77      TL-MIGVGYN--HPDPV------IAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRAD
A0A2E9IN28      SL-MIHIAYS--HPDPI------VAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRIRAD
D5ENH7          SL-MVSVTYT--HPDSQ------MAADIANLFADEFINYKLTENIDASMVAVEGLRIRAD
A0A351WE84      TS-LINISVT--QEDRE------LAARIANEMAAVYREQRLDVKRSELRRAIEVLDNEVQ
A0A1V5QDZ6      TS-LISIQVY--REDPT------EAARIANSIAQVYHDQRLSMKRRELKRAIEALEGELA
A0A4Y8P964      TR-LVKIKFD--SVNAE------AAAQIANAYAEAFIAFGLDRKLEANQHARQFLAKQLD
A0A3D4HF88      SL-LIAVTYT--HPDAR------IAAHVANLFADEYINYNLRLTIENSMKAVEDLKLRVN
A0A351MR11      TM-IVNVEFT--HPDRD------LSRQVCRLFCESIQKNSEDERLTVTNPLVEKARVEIE
A0A6G6K641      TR-LIDIRAE--HTDPE------TARKLADGVAEEYLRFTIETRNRSNQMANQMLMEEAT
A0A5B5WI95      ESSLLEMTLT--ANNPQ------KAADVLNQLIAVYNQVSIDEKKLAAQKTKKFIEGRLE
A0A2N8I9W1      ESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLK
A0A4Q5IH27      ESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLK
A0A2N8IBZ6      ESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLK
A0A2N8IJW9      ESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLK
R6J100          ESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLK
A0A1V6J089      TM-LMNISAT--SEDPK------QAAAIANEIANVYRERRLADKRREIQHAIDAMSNEVR
A0A3C1BZR1      TT-LMNISAT--SEDPK------LAAEIANEVANVYRDRRLLAKRREIQRAIDAMSNEVR
A0A1H6KPB7      KD-LVDVKVV--GSDPA------LVKLICDAVTECYKEGREAQENEVLDKAIATIQEELT
A0A2E9ISN4      GT-MIDCLVD--SVAAE------YSKAYLVEMIQGYRSLRMEELMEVNQSALLGLKNEET
B9XAX1          TR-LVDITVT--HPNAE------MAQKLANAVAQEFILESLDQRFSNTKAANELLYAEAG
A0A5R8KKM9      SE-IINITYY--DEDPQ------LAADIANAVAESYRETRIQVDRDLADNSIKEFNIQVA
A0A139TS01      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVLR
A0A3E1EJT7      SL-MTAIEFR--HPNPK------IAARVANLIAVEYIAYNSRLRVEESLKAVDDLKDRAD
A0A317ZP96      SL-MINIAYS--HPDPI------VAAEVANLFAKEFIDYNLKLNIDSSMKAVEDLRIRAD
A0A2D5WGA5      TS-IIELRAY--DRDPN------LAQDIAQALAEEYKNHRTSLQKERVKTGIDTLTNRME
A0A2E7SSH2      TS-IIELRAY--DGDKQ------LAQEIAQALAEAYEEYRQSLQQKRVQAGIDKLKERME
A0A349GXM8      INPMVSVAVQ--SRNKD------YTAAFLSLLIDEHREEWQTVQRQARNSAGGMLEQELA
A0A4P5YP61      TR-LIDVSVE--HPNAA------MAALLANSIFKQYVQLSYEQYVSSGLTASQFLVEEAE
A0A6B2LYM4      SL-VVNIIFT--HPDKE------VAAVVANYFAEEYIDFNRNQQIEGSLRAVDDLRSQAD
A0A6D1VXB3      TR-LVQIKFD--SVNAQ------AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQLD
I0JYY7          TR-LVQIKFD--SVNAQ------AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQLD
A0A4R7S1J2      TR-LLDITAT--HGDPI------VARDLAVATAKGVMKWDLEQRSQSVGVANEFLMQEAE
A0A2A2XV69      TE-LIQISVL--DQDRN------EASEIANRIAEEYQRRRIGEQQGTVNRSLIQLKDEVA
A0A651H7X9      SL-VISVQYR--HRDPV------LAARVADLFVEEFINLNTQMRIQESLRAVEDLRDRAE
A0A4Y8P842      TR-LIRICYD--SPNSF------GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQIE
B3DZK9          TR-LIRICYD--SPNSF------GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQIE
A0A5E6MPC4      TR-LVKIRCE--SPSAF------GAAQLANVYAQSFITFGLDRKLEANRYARKFLAGQLE
A0A4V1SB02      TR-LIDIVAE--ENSPK------KAQALANEVVNQFFLLQGSDKSGVSKDAFVALKAQEE
A0A3C1VB86      TR-LIDITVR--NTDPG------LAARLANSLVKNYLGQDALVQSSVNEEAGVFLRREAD
A0A146G2Q9      TE-LIHITVF--STDNK------EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVE
A0A2T6D3Y2      TE-LIHITVY--STDNK------EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVE
A0A2V2SDV4      TS-LIEIRVT--TDKPE------EAAKLANEIAQAYCDYRVEHRKQMTMGGVDALEKKFT
A0A2V5PK75      TK-FIEIVVY--SENKD------EAARLANAIAEAYQEHRQEQREKLSQGGIDAMEKRLK
A0A1V6DME1      TS-LITIRVF--SQDAE------EAARIANEIAETYKEYRLAQRRELTMGGIRILEDRFQ
A0A3D3DIJ3      TS-LIEIVVY--SEKPE------EAARIANAIADAYKTHRQEQRAQLSRGGIKALEERFA
A0A2D5VY59      TS-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYA
A0A2D8UZZ4      TS-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYA
A0A353DV86      TS-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYA
A0A2E5EPT8      TS-IIALTVY--SEDKK------EAAEIANTIAKVYAETREQNRITQVRKGIAKMREKLG
A0A6I1K583      TS-IIEINVY--SKDKA------EAAEIANKIAEVYKASRDELRLRLVDQGLKTLREKLT
A0A350EWA4      TE-LIEITVF--NENKA------MARNIANEIAKVYREWRMNLSDERFQEGFDAINQQLE
A0A5B5WZ91      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVLR
A0A2N8HD92      TD-LVDVIVS--GPDPK------LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A2N8HIT2      TD-LVDVIVS--GPDPK------LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A354EBD3      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A355VEB2      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A2N8IMT3      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
R6K1U5          TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A2N8IWC2      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A2N8I441      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A2N8I3A6      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A410SCC4      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A3R5VEW0      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A411SSG2      TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
B2UKW3          TD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLR
A0A1M6RLZ4      TD-LVEIAFV--HSNRE------DVKMITQAIADSYREMRIEDEEKRRTEASYELEKKIQ
A0A354T7G8      SD-FVSIDYY--DQDSQ------LAANIANEIAKSYMEQRNNIETEKKQKALTVLQQQIS
A0A2S7U4L6      TD-LIEISLRMVKDNRQ------YVKPATEAIALAYSEMRINQETKRRDKTRVELAKKIQ
A0A512MBZ2      SD-FVIIEFY--DQDAA------LAADVANAVASSYMTQRIEIDSSQKREALERMQKQIA
A0A2E8MEZ0      TD-FIEITVT--HANPE------DAKEIAEAVSQAYIERRNSTEEGRAQEALEALNQELQ
A0A4Q2YKS3      TD-LISIKVR--HVNKE------DARDVATEVSEAYRQYRNDLEGQEAEKAMEELSKAVR
A0A6B3LBV6      TD-IVEIRVR--DTDAD------LAAQIANSLYRAYAEALDDEVNLINAQSTGDLDAQLD
A0A2E3EC33      TD-LIDIEVY--DTDAQ------LAADIANALANAYQARRQNEEKERADTALEKLDTQIM
A0A2E4GN01      TD-LIDIEVF--DTDAQ------LAADLANALAXAYQXRXQNEEKXRADKALEXLXTXIX
A0A1Z8XU55      TD-LIDIEIY--DTDPK------LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQIK
A0A2E1RQR9      TD-LIDIEIY--DTDPK------LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQIK
A0A2E3ISQ4      TD-LIEIEVY--DTDPN------LAADIANAVAKAYKIRRQRVEKERADTALALLDLQIQ
A0A2D6W6F4      TD-LIDIEVY--DTDPN------LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIK
A0A2D8Z5A8      TD-LIDIEVY--DTDPN------LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIK
                                                                            

A0A2A2XVF1      KLKKKLEESEIKLQRYKEQNQAVS-----------------LEE----RQNITVERLREL
A0A2V5UHJ2      ELKERVQQSEAALNSYRKEKGIIS-----------------VDD----KSNVIIERLLDL
A0A2V5PST3      ELKARLERAEAELNRFRQTHGVVS-----------------IEK----GENIVIDRLVDL
A0A2V5PXM3      RLKVKLEQSERAMQEYKEQTKSVS-----------------LED----RQNVVVEKLKEL
A0A139SU05      QLRLESEAKAQRQQEYMQRHNLIS-----------------LDN----STSIVDSRLLAV
A0A1D8AZK8      ELRKESEIAEGRLQDYRRKHNLVS-----------------LDN----SINIISERLRTI
A0A1V5QB01      RVHEELKRAEERALEFARQNSVIA-----------------IQE----RGNVAARILGTL
A0A139SPN4      QLRLESEAKAQKQQEYMEKNNLIS-----------------LDS----STSIVDNRLLTI
A0A1V6E7N1      DLRKESEAAALQVQRFMEVHKLVS-----------------LDE----STNLVNARLQTV
A0A2D9MYT1      NLSTAVHTNYMALHNFKLEWDIIS-----------------LED----SQNTTLQALLKA
A0A258ANJ7      RLQDKLKKSEIAMHDYKRSNQAIS-----------------LDE----RKDLVLSKLKEL
A0A139TLN4      VINEEMGENDLAIENLKKESNILT----------------DLST----ALTEEYENSLND
A0A290QGD9      DQRKKVEELATRLQTYRETHKMVS-----------------LDQ----RRDMVTETLKAR
A0A1D8AS58      QQKKRVEEMAIILQNYREKNQQVS-----------------LDQ----RKDIVTEKLKAL
I6AQC1          SQRKTVEDLNRQMQAYREKYNMGS-----------------LDK----TKDIQTRKLMEQ
W0ITH7          SQKKKVEDLNRQMQAYREKYNMGS-----------------LDK----TKDIQTRKLMEQ
A0A1G3ZFT0      LAKQDLTRAELALNRYHTTSGKID----------------------------TKLEIKNL
A0A1Z8ZMT6      ERESELETARRRAGTYTPALEAEK------------------------------------
A0A2E8MCT7      ERESELETARRRAGSYTPALEAEK------------------------------------
A0A290Q2Z2      SQERTVSLQRDMVEQLRKDLGISG--------------VDLNAR----YSDMEIETLRQM
A0A2A2RGK2      RLRKKLRVSEEAMQSFRERERAAS-----------------IET----MLSSAQSQVGEV
A0A2A2XXF7      RLRKKMRVSEEAMQSFRERERAAS-----------------IEN----MLASAQSQIAEI
A0A2A2R5D6      KQGEVVQRAKDYVEELRKSLNLNM--------------VGGGEN----ETQMIEEEWKRK
A0A2V2DJ66      QQETKVKELDRRLVEYREKNGAIS-----------------LDQ----MDDVDRRELQEM
R7L5A9          QQEAKVKELDKKLVEYREKNGAVS-----------------LDT----LDDVDRTELRDI
A0A1J4XH17      EQQKVVENIETQMAEYREKYGTVS-----------------LEQ----QADIDHQELTEI
A0A3C1VJ32      EESNRIEMLQANVDNLRRTLDINN------------GTASSPEP----ELTVEQLRSY--
A0A2N9NTX7      EQEASVGKAQSNVDYLRDKLKISD----------PNSGAEMPGP----LLTTESLHRI--
B9XK55          EQDDLIAKQEAKVDKLRKDLKVTD----------L-GGESATGP----QQTLEPMNVMHY
A0A4P5YMI6      THEKNIREKQKVVEAIRKDTGITL----------I--TPEGAGA----YNTLATETLRHL
A0A2E6T482      EINKKITGLQGNVDRMRTELGISD----------A----AGEES----YSIIEPEIVRRY
A0A3C0DQZ7      EINKKITGLQGNVDRMRTELGISD----------A----AGEES----YSIIEPEIVRRY
A0A1Z9CBK5      TINEEIGAMQANVDXLRVQLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2D6ZI96      TINEEIGAMQANVDXLRVQLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A358KGZ3      KTNDEITAMQANVDDLRAKLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2E9ZQX4      KTNDEITAMQANVDDLRAKLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A3D5JZU0      KTNDEITAMQANVDDLRAKLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2E6HCR0      KTDEEISVMQAKVDDLRVKLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A1Z8WN04      KTNNEISLMQAKVDSLRVTLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2D7L1N4      KTNNEISLMQAKVDSLRVTLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2E2R937      KTNNEISLMQAXVDSLRVTLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A520QQY4      KTNNEISLMQAKVDSLRVTLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2D5MR66      KTNDEISVMQAKVDALRVKLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2E0PDQ1      KTNEEISLMQAKVDSLRVKLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2E2ZZP9      KTNEEISLMQAKVDSLRVKLGISD----------A----AGEDS----YSIVEPEIVRRY
A0A2A2RGF2      DQDALVRTALTNVNQIHQDKGLNV----------I-HEVGGSV------MSLETDTIRAL
A0A2G4I5Y6      DQDALVRTALTNVNQIHQDKGLNV----------I-HDGGGTI------MSLETDTIRSL
A0A3M1I883      EQNARVERLQKQLDQLRLELNIPD----------T-VAGTAGAY----SISTERERLSTL
A0A1V6JZ45      EQAEAVAKLQDNVDQLRAELNIPD----------S--INDASVY----QTSLEREKVSAM
A0A520RRW5      TQQNKVQTKQKDLDKLREDLNISD----------I-YSAEGSSI----GMTTEPQIVMKL
A0A356NPK0      TQQNKVQTKQKDLDKLREDLNISD----------I-YSAEGSSI----GMTTEPQIVMKL
A0A2D7B5P5      XQQNKVQTKQKDLDKLREDLNISD----------I-YSAEGSSI----GMTTEPQIVMKL
A0A3D3XGB5      TQQNKVQTKQKDLDKLREDLNISD----------I-YSAEGSSI----GMTTEPQIVMKL
A0A2V6F8A1      QNDEKIKEAEAKVDELRKEYSISD----------I--SAEGPYA----ISTLEPQTVRSL
A0A2V5TNH4      QNEEKVKAAEAEVDQLGKEYKVSN----------G--SLEGA--------TLEPQTVRSL
A0A2V5X5Q6      QNDEKVKAAEIAVDQLRKEYKISD----------I--QPEGAYA----YSTLEPQTVRSL
A0A4P5QM05      TKEDEMARLFQEASRIRQDESISD---------------PDPDSSNAALSITAPTGIATG
A0A4Q3C001      KQRKVVEDAAVLAAKIRQEDGIVD---------------PDIENPTALISGGD-RSIVSS
B4DB23          RRRKEMEDTSAVAMQIRAREGIVD---------------SDPDKENSVISGGEGGNVLQR
A0A6B3L938      DVALELESAERSFHVYRAALALNQ------------------------------------
A0A2V5URB2      ELKDRVQKSEEALNHFRRAKGIIS-----------------LND----KENIVVDRLADL
A0A5R8KA81      RLAKALADSELALQNYKDERQAVS-----------------LEE----KQNIVTEKLRDL
A0A5B5WU87      VISEEMRKNDLAVEKLKKETNILT----------------DLST----ALTEEYENSIND
R7DZW0          VISEEMKKNDLAIEDLKKETDVLT----------------DLST----ALTEEYENSLND
A0A2N8HID1      VISEEMKKNDLAIEDLKKETDVLT----------------DLST----ALTEEYENSLND
A0A2N8HS06      VISEEMKKNDLAIEDLKKETDVLT----------------DLST----ALTEEYENSLND
A0A3R5R2M8      ELEKSLNKADKELTDFKAKSDIVK----------------DTET----TMSADFSSSQVL
A0A411SUQ6      ELGASLSDVDKKLTEFKTKSDIVK----------------DADT----TMSADFSTSQAL
A0A2N8HZF2      ELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQAL
A0A354E720      ELGASLSDVDKKLTEFKTKSDIVK----------------DTDT----TMSADFSTSQAL
B2UPB6          ELGASLSDVDKKLTEFKTKSDIVK----------------DADT----TMSADFSTSQAL
A0A2A2XXW5      GKEVELEALQGKLQKYRKDKGMVS-----------------LKD----AQNIDAATMRDL
A0A2V6JLK8      KQQKRVEEAGAEMAKIRDEEHIVD------------LNPEGTED----SQAPVNSIVVKQ
A0A2W5Z1A5      KQQKKVDDAAVEVARIRDTEHIID------------LNPEGTED----SKTPLDTVVVKQ
A0A2V6EA09      REQKAVSDAAAEVARIRDQEHIID------------LNPEGMED----TQTAVNSIVLKQ
A0A2V6GQI7      REQKAVSDAAAEVARIRDQEHIID------------LNPEGMED----SQTAVNSIVLKQ
A0A3C1HEJ2      ELLETIKTLESLLQEFKKNHPGIS------------------EE----EQAILSKQIGEL
A0A522ULD9      KQQDKVNKAEEDLEHIRKDLGVSS----------------------VGGMQIDKMKLQAM
A0A1V6JU76      GLEVDVAKAEEDIQNYRAQVKFVS-----------------LDS----SYNIVAEALSQS
A0A1Q6UHJ9      QQEAKVKELDKRLVEYREQYKAIS-----------------LEN----LDDVDRNELRDI
A0A2V2BXR0      QQEAKVKELDKRLVEYREQYKAIS-----------------LEN----LDDVDRNELRDI
A0A2D8V0G3      QLADDVRATRLSVFQFREDNQMPS-----------------LEE----SQNTLSQALFLA
A0A348S017      GLQEEVKNSRLAVFRFREKNKMPS-----------------LEE----SQDTVSKALFAA
A0A3C1UUV7      GLQEEVKNSRLAVFRFREKNKMPS-----------------LEE----SQDTVSKALFAA
A0A350I3V2      GLQEEVKNSRLAVFRFREKNKMPS-----------------LEE----SQDTVSKALFAA
A0A520RGV5      GLQEEVKNSRLAVFRFREKNKMPS-----------------LEE----SQDTVSKALFAA
A0A3D3XF90      GLQEEVKNSRLAVFRFREKNKMPS-----------------LEE----SQDTVSKALFAA
A0A2D7B522      GLQEEVKNSRLAVFRFREKNKMPS-----------------LEE----SQDTVSKALFAA
A0A356NIC2      GLQEEVKNSRLAVFRFREKNKMPS-----------------LEE----SQDTVSKALFAA
A0A2U8DZK4      AQEKIVIAQRDTVERLRAELSISG-----------------IDLTNPRNNSMEIERLRQM
A0A2T6DFL8      KQEQAVTRQRDAVEKLRKELNISG-----------------VDL-NARYSDMEIETLRQM
A0A1D8AWD4      KQELAVTTQRDHVEKLRKELDIAG-----------------VDL-SQRYSDMDIETLRQM
A0A4Q1C9S2      KQEQAVTDQRDHVEKLRKELDIAG-----------------VDL-SQRYTDMDIETLRQM
A0A178IH18      GQERAVATQRDLVEKLRAQLNISG-----------------VNLVTPQGGDIEIETLRQM
A0A2T6DT99      KQEKVVTSQRDLVEKLRKDLNISG-----------------VDL-SARYSDMEVETLRQM
A0A1G3ZT33      AQEEVVSKQRDLVEKLRRDLNISG-----------------VDL-NARYSDMEIERLRQM
A0A3E1E2T2      AQEQVVMLQRDTVERIRKDLNISG-----------------VDL-NARYSDMEIETLRQM
B1ZMW1          AQEQVVSAQRDTVERLRKDLNISG-----------------VDL-NARYSDMEIETLRQM
A0A2N8HDG3      QVGADLKQVDQKMDDIKIKNDIIA----------------DTEA----SISADFNAAQTL
A0A146GCJ0      KLKVKLEASERKLQAYREDNKAVS-----------------LEE----RQNIIVEKLREL
A0A2T6D6H8      KLKAKLETSERKLQAYREQNKAVS-----------------LEE----RQNIIVEKLREL
A0A3D1TI55      QQKFKVRELEDNVEDLRLQNQIVF-----------------GAT----GAELSKERLDQL
A0A3R8IT45      TQKKKVEELQFQMQAYREKYGL-T-----------------LDP----KKDILTKKLVEQ
A0A1H1MGC9      QQKKKVEELAINLQAYREKNKMVS-----------------LDQ----RKDIVTEKLKAL
A0A2A2PYE8      EQQKRVERMARELQEYKEKNNMVS-----------------LDQ----RKDIVSESLKAI
A0A2T6CN73      TQRKLVERLASELQRYKEQHKMVS-----------------LDQ----RKDIVSESLKAI
A0A3E1ET42      SSENDLEAARIVMNEVARKHGIV-------------DNSYQGGQGFTAVVTTKPEEYADS
A0A2A2YDW8      EHSDVVEEKRKQRDNLQRRA--PS----------V-VRDFLTGN----AGNGYQSMQANV
A0A352XLN9      EHSDVVEEKRKQRDNLQRRA--PS----------V-VRDFLTGN----AGNGYQSMQANV
A0A3D0YP62      NKSDRVAELRKRLMDIAEKVGVIW----------V-ESERGGET----IG-GELELRQLA
A0A3D3DV47      NKSDRVAELRKRLMDIAEKVGVIW----------V-ESERGGET----IG-GELELRQLA
A0A2E5XJ49      SQEDLVEDKRRHFHTIVKAVGVPY----------I-EGVFPSGR----MGQSEEEILKMA
A0A2E6SBY8      SQEXLVEDKRRHFHAIVKAVGVPY----------I-EGVFPSGR----MGQSEEEILKMA
A0A2E5QMS4      SQEDLVEDKRRHFHSIVKAVGIPY----------I-EGVYSSGR----MGQSEEYILKSA
A0A2E7YXQ3      SQEDLVEDKRRHFHSIVKAVGIPY----------I-EGIYSSGR----MGQSEEYILKSA
A0A2E3H787      SQEDLVEDRRRHFHAIVKAVGIPY----------I-EGIXTSGR----MGQSEENILKTA
A0A2E7AGN1      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILKTA
A0A2E7AKY7      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILKTA
A0A3D4CU34      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILKTA
A0A2E8M146      SQEDLVEDKRRHFHAIVKAVGIPY----------I-EGVLTSGR----MGQSEEAILKSA
A0A355S8S2      SQEDLVEDKRRHFHAIVKAVGIPY----------I-EGVLTSGR----MGQSEEAILKSA
A0A2D6DVN8      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRTA
A0A3C1W2R2      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRTA
A0A2E3NAY6      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRSA
A0A2E3II01      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRTA
A0A368B8C5      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRTA
A0A3R7RBB5      SQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRTA
A0A2A2QX62      QQKDLVEDKRKLLSQIIRQEGIIY----------QGDSSVFQGT----SGFDKADEAETA
A0A4Q3BWH6      VQEDLVEDKRKLLSQIIRTENIIY----------WGDPSVSQGA----RGFTKADDAENA
A0A3N5WCF1      DQEDKVEERRKVLATIVRNKGIIY----------RGQDAFY-ES----GGVDEDQGARNA
A0A4Q3C1K5      DQEDKVEERRKVLATIVRTKGIIY----------KGQDSFY-GQ----SGVDEDQEARDA
A0A2G4G428      SVEDKIRKLYDKRNELIKGQKLLS-----------------IAK----DTNTLTAERAAL
A0A139TV24      QIGEELKRLDSERDDIKFENDIIA----------------DTQA----SLSADFSTAQTL
A0A2N8HT11      QIGADLKEVDQKMDDIKIKNDIIA----------------DTEA----SISADFNAAQTL
R7DS70          QIGADLKEVDQKMDDIKIKNDIIA----------------DTEA----SISADFNAAQTL
A0A2N8HNL6      QIGADLKEVDQKMDDIKIKNDIIA----------------DTEA----SISADFNAAQTL
A0A6I1K459      RIKERLLKAERSVQQYLATNNISL------------------QQ----GQDILTEEFRTL
A0A139TUL1      KLGGQLGGVDKQVIDYKRHSRIVK----------------DMST----TLEATFSKLQEI
A0A2N8HCB0      KLGGQLGGVDKQVIDYKRNSRIVK----------------DMDT----TLDATFNRVQEI
A0A2N8HP04      KLGGQLGGVDKQVIDYKRNSRIVK----------------DMDT----TLDATFNRVQEI
A0A2N8HRJ0      KLGGQLGGVDKQVIDYKRNSRIVK----------------DMDT----TLDATFNRVQEI
A0A366HAG0      AKELQAKQSMERMIQLKKDLDLVT-------LPTSMDAKGAQDD----VMTPESAMLLDT
A0A3M1I8A3      QMEREVTELEEAVQQYREKQNFVS-----------------FDA----GSNPVAQSLSQV
A0A4V0XS84      SMKVKVDRDEEAVHKFKEGHQVVS-----------------FDE----TENVVLLALKQR
A0A0R2XQ77      QQKERVEELELKMAEYREDNNAVS-----------------LDS----QENIAGTQLSTL
A0A2E9IN28      QQKERVEELELKLAEYREENNAVS-----------------LQS----DENIAGAQLARL
D5ENH7          RQKERVEELELELAEYREEHNAVS-----------------LDS----QENIAREQLGSL
A0A351WE84      KQQEKVDQAESELERIRQEVGVSF-----------------LGQ----GFRADKVRLQQL
A0A1V5QDZ6      KQQEKVEKSEEELERIRKDLGVSV-----------------LSQ----GVRADKLRLSQM
A0A4Y8P964      SMRKKLALAEERLANFTEQTGIVK----------------FPGV----DRSPAEQELNRV
A0A3D4HF88      QQRSEVEALETRLAEYKERTGSIS-----------------VEE----REDIDLQEIMQL
A0A351MR11      SLEERLNRLYLDKNELVGRERMLA-----------------IVK----DTNTLGSERGAL
A0A6G6K641      RLKEKVSRSQLALQEFRERTGLVS-----------------LEK----DQDIVVTRFKQL
A0A5B5WI95      ELEKSLNKAGKELTDFKTKNDIAG----------------NAET----TISADFSSAQAL
A0A2N8I9W1      ELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQAL
A0A4Q5IH27      ELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQAL
A0A2N8IBZ6      ELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQAL
A0A2N8IJW9      ELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQAL
R6J100          ELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQAL
A0A1V6J089      KQQERVEEAEAELERIRQERGIAL--------------IGRGLM----SIRVESTRLNAL
A0A3C1BZR1      KQQERVEEAESELERIRQERGISL--------------IGRGNM----SIRVEATRLNML
A0A1H6KPB7      RRENELLAKTDTLRKYMTTSDYIG---------LLSDTGNTIPT----TVNNEEAVLTER
A0A2E9ISN4      RVLEDLEQAKQDLETFERENQILF-----------------EKE----RADMDIAFVNQL
B9XAX1          KLKQKVEMSERNLQAYKESNKTVS-----------------LED----RQNIIVEKLKGL
A0A5R8KKM9      AKEQLAQQARNKMFAVKKDLGIIE--------LPGDNRATGQDV----IDTVESATLIDR
A0A139TS01      EQEDIVNDKMMALKKLIVENDYLP-------STMYRSGDNRSVM----TGAMEDEDFRNS
A0A3E1EJT7      QQRKRVDEIANSLLAFRQRGNLIS-----------------LVQ----SKDIVTEKLKAL
A0A317ZP96      QQKDRVEELEFKLADYREQKNAVS-----------------LDS----QENIAREQLGSL
A0A2D5WGA5      KINIEITGMQGRVDRLRTDLGISD--------------AAGEES----YSIIEPEIVRRY
A0A2E7SSH2      KTNEEISSMQSNVDALRAKLGISD--------------AAGEDS----YSIVEPEIVRRY
A0A349GXM8      RLDQKIRTAEDDLIEYQRLHDIAR-----------------VEA----RGTMESRHLSAL
A0A4P5YP61      KLKKKMLSSEKALQTYREKVGSAA---------------ISLDD----KKDIVGQKLKEM
A0A6B2LYM4      QQLAKIKEMEMRLADFKEKYDTLS-----------------VDR----SQDIDNQQLISL
A0A6D1VXB3      SMRKKLALAEEKLATFTEQTGIVK----------------FPGV----DRSPAEQELNRV
I0JYY7          SMRKKLALAEEKLATFTEQTGIVK----------------FPGV----DRSPAEQELNRV
A0A4R7S1J2      RLRKKVELSEQALQKYRVENNAVS-----------------LEE----NQNLVVSQLQDI
A0A2A2XV69      KQSRRVDELRAEAQRIRIENEIQD------------LNPDSVVD----PMQAANEVLLSV
A0A651H7X9      QQRKVVEDLELRLQAFREDANMIS-----------------LDQ----RRDIVTEKLKML
A0A4Y8P842      LMKKKVTESEAKLARFMEKTGIVK----------------LPGI----NSSPTEKELAQV
B3DZK9          LMKKKVTESEAKLARFMEKTGIVK----------------LPGV----NSSPTEKELAQV
A0A5E6MPC4      TLRKKVAQSEERLADFMAETGIVR--------------------------------VSQM
A0A4V1SB02      DLRKKMAESDNALADYRQQHKAVS-----------------LDE----KSNVLADRVKDL
A0A3C1VB86      RLKKKLEASDQALQDYRKQVGSVS----------------------------LEQSQDVI
A0A146G2Q9      KQQAIVTKLQETMTRIRQETGIQD------------LNPDTADG----GTQAENSILLQV
A0A2T6D3Y2      KQQAVVTKLQDTMTKIRQETGIQD------------LNPDTADG----GTQSENSILLQV
A0A2V2SDV4      EQQGKVSEAQSNVDVLRFKLQISD------------PVVTENTP----GTLMTGDTLRRF
A0A2V5PK75      EQEEKVAKKAEEVEKLREELQVPD------------SMSLEAAP----VQLLSAETIHKV
A0A1V6DME1      DQEKKVQAAQREVDELRAKLEISD------------ADAAGTSP----TTLLEAEVLRRL
A0A3D3DIJ3      EQEAKVKAAQERVDNLRKELNISD------------AMASGDGP----SPLMTAETLRKI
A0A2D5VY59      DQNEKVRLKQADLDQLREELNISD-----------IYSAEGSSI----GMTTEPQIVLRL
A0A2D8UZZ4      DQNEKVRLKQADLDQLREELNISD-----------IYSAEGSSI----GMTTEPXIVLRL
A0A353DV86      DQNEKVRLKQADLDQLREELNISD-----------IYSAEGSSI----GMTTEPQIVLRL
A0A2E5EPT8      EASNSVVQAQADVQRVREELKFDV------------IMETPGKV----ALALDSERVRAL
A0A6I1K583      EHHGFVEVAKSNVNQILKDKGIIL-------------TMDTPGM----IGTLDIDTMRAM
A0A350EWA4      KAESDLKESEAEVNRLRASLEITD------------IDEASSRN----EQFFDMQTIQQF
A0A5B5WZ91      EQEDIVNDKMMALKKLIAENDYLP-------STMYRSGDNR-VM----TGAMEDEDFRNS
A0A2N8HD92      EQEDTVNEKMMALKKLIAESSYLP-------TT-WRNGENRNTL----TAGMEEEDFRNA
A0A2N8HIT2      EQEDTVNEKMMSLKKLIAESSYLP-------TT-WRNGENRSTL----TAGMEEEDFRNA
A0A354EBD3      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A355VEB2      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A2N8IMT3      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
R6K1U5          EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A2N8IWC2      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A2N8I441      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A2N8I3A6      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A410SCC4      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A3R5VEW0      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A411SSG2      EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
B2UKW3          EQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRNA
A0A1M6RLZ4      AQEDLVADHRNRLATMSQKTGIPY-----------AGDKNSIGA----GSNPAELNFREN
A0A354T7G8      DQEELRRLAQVRSQEARRKAGIVGDWIAGGGSSLNPGGEMRSEK----DSMVISREQALM
A0A2S7U4L6      KYEDIVEDYRTRLLEFSAKTGIYS-------------LDRSSGG----ATDVVRRDLQQE
A0A512MBZ2      EQESLRDQARAKMLEAKKKAGIVGDWIAGGGPSITPGVSLATSK----DGMVASREQAML
A0A2E8MEZ0      DQGDLVQDYRKALTVLIQQYGI---------PYFDGRDSGQVGQ----AEELMYRRAQEK
A0A4Q2YKS3      EQEDIVAERRKALSNIVREKEII-----------YRGSESIFGN----TGVFEDDSARSA
A0A6B3LBV6      EQSEKVSEARIKMHNAMRELKVID--VGKG---FYYSDEVVTPE----DRIIQTGQERLA
A0A2E3EC33      AQMTRLEKARDMMINLMEELNIVD--LSLGEPTWLRGSQPNTGI----ASLVMTAKQKEF
A0A2E4GN01      AQMTXXEXSRDMMIGLMXELNIVX--LSLGEPTWLRGSQPXTGX----ASLVMTAKQKEF
A0A1Z8XU55      KQEGRLEAARNNMIELMEELNIVD--LSLGEPVWLRGSQPNTGT----ASLVLAAKQREF
A0A2E1RQR9      KQEGRXEAARNNMIELMEELNIVD--LSLGEPVWLRGSQPNTGT----ASLVLAAKQREF
A0A2E3ISQ4      QQEKRLEDARSVMIKLMEDLNIVD--LSLGEPVWLRGSQPNTGT----ASLVMAAKQREF
A0A2D6W6F4      SQEGRLEKARNNMIELMEELNIVD--LSLGEPVWLRGSQPNTGT----ASLVMAAKQREF
A0A2D8Z5A8      SQEGRLEKARNNMIELMEELNIVD--LSLGEPVWLRGSQPNTGT----ASLVMAAKQREF
                                                                            

A0A2A2XVF1      SSKATEAKSERLRLESDIEQVRK----------VPANNTDELL----------------R
A0A2V5UHJ2      NKGLTAAEGDRIAWEAQVRAARGRNAD--------------------------------E
A0A2V5PST3      NRNLTTARAQRLEAESLNSVVQNKSTQYLSQ-----------------------------
A0A2V5PXM3      NQKVTEAKSLRILHETSYNQALQ-----------FSNNPAALL----------------F
A0A139SU05      NGSLTQARLRLLEVESLAKQVDD-----------YQEAGANLL----------------E
A0A1D8AZK8      NATLTSARLSRIDLENLLGQIER-----------MQQAGGNLL----------------E
A0A1V5QB01      SSQAAQFRTQKMFLEAQQPLLSR----ASDEAVLAALGPAGSGIPGVGLMSIAAMGVETN
A0A139SPN4      NGALTAARLRLLEVESIAKQVAD-----------YQESGDNLL----------------E
A0A1V6E7N1      STELTRVRLARLELESQVKQIET-----------YQAEGRNLF----------------E
A0A2D9MYT1      QTDYDAAHSRAVEAQASADEAQR-----------VFTETGEFG----------------T
A0A258ANJ7      GSELNQQSKERLTLETQLQACKE-----------GTLPRDELL----------------S
A0A139TLN4      KKDLRELTLEIKSIEYLKEYLEK-----------EAEFDSRLV----------------P
A0A290QGD9      NIIVTQTNARFKDAEVRWKQIQE-----------LRAAGRDLT----------------E
A0A1D8AS58      NAYVTQTTSRLNEAEVRWRQVQE-----------RKATPALLL----------------E
I6AQC1          GSLVTQSGARLSEATVRWQQVDE-----------RLKNNGDLL----------------E
W0ITH7          GSLVTQSGARLSEATVRWQQVED-----------RIKANGDLL----------------E
A0A1G3ZFT0      IQEIMVIEKQLINLRMTKHEMFY-------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      QNSLIALSVDAIGRKTRYERFKS----IPAEDRINLINSELIQ-----------------
A0A2A2RGK2      SNNQSLIQRRIEQIDSDLAVIRA-----------NTGEPEELL----------------T
A0A2A2XXF7      LGVQNEIQKRIQQIESDLAVVRT-----------NTGSVEELL----------------F
A0A2A2R5D6      SALLDDVRAEYLGRQVRYERLNR----LSTNEFLDAIVAMGIE-----------------
A0A2V2DJ66      NTILTTDKRTYDAAAIQWSLLQE-----------YKRDGRDLC----------------T
R7L5A9          NAILTNDKRIFDAASTQWTLMQE-----------YKRDGKDLC----------------T
A0A1J4XH17      NKTVTDARRDFDIAQSRKNLVDQ-----------YIKSGGKLW----------------D
A0A3C1VJ32      QAQKLESEQAYNVSLVQLQDLQTIQQT-NQSKLRDV-----------------------L
A0A2N9NTX7      EGLRIESSAELVKMETLLSKLEELQRT-NPAALIQT-----------------------I
B9XK55          NTLRIDAETQYIKEEKLLSQLKQLKSD-E---LKQA-----------------------I
A0A4P5YMI6      DSLRNTAHLEFIEKDTRLAALRKIPRN----EIKEV-----------------------I
A0A2E6T482      ESELITAKGIHTTQATLLEGLKAQSRE----ELRAS-----------------------I
A0A3C0DQZ7      ESELITAKGIHTTQATLLEGLKAQSRE----ELRAS-----------------------I
A0A1Z9CBK5      ESELITAKGLYTQQATLLQGLQEQSVE----ELRES-----------------------I
A0A2D6ZI96      ESELITAKGLYTQQATLLQGLQEQSVE----ELRES-----------------------I
A0A358KGZ3      ESELITAKGLYTQQATLLQGLQEQSLE----ELRES-----------------------I
A0A2E9ZQX4      ESELITAKGLYTQQATLLQGLQEQGLE----ELRES-----------------------I
A0A3D5JZU0      ESELITAKGLYTQQATLLQGLQEQSLE----ELRES-----------------------I
A0A2E6HCR0      ESELITAKGLYTQQATLLKGLKEQSFE----NLRES-----------------------I
A0A1Z8WN04      ESELITAKSLYTQQATLLQGLKEQGDE----ELRNS-----------------------I
A0A2D7L1N4      ESELITAKSLYTQQATLLQGLKEQGDE----ELRNS-----------------------I
A0A2E2R937      ESELITAKSLYTQQATLLQGLKEQGXE----XLRNS-----------------------I
A0A520QQY4      ESELITAKSLYTQQATLLQGLKEQGDE----ELRNS-----------------------I
A0A2D5MR66      ESELITAKSLYTQQATLLQGLQEQSSE----ELRNS-----------------------I
A0A2E0PDQ1      ESELITAKSLYTQQATLLQGLQDQDSE----ELRNS-----------------------I
A0A2E2ZZP9      ESELITAKSLYTQQATLLQGLQDQGSE----ELRNS-----------------------I
A0A2A2RGF2      ESQLIEIRGLFTKKQTSVVELKKLKPE----QLRNV-----------------------L
A0A2G4I5Y6      ESQLTDIRGIYIKKQTSFVELKKLKPE----QLKNA-----------------------L
A0A3M1I883      LQALQQARSDLVYWKSKLQELERIRDK-GLQDLRDA-----------------------I
A0A1V6JZ45      AQELTRAHSEYVYFLTKLEDLKKLDRT----SMREA-----------------------V
A0A520RRW5      EQERTVAEANLIRYETLFKELTSLTLE----ELRNT-----------------------L
A0A356NPK0      EQERTVAEANLIRYETLFKELTSLTLE----ELRNT-----------------------L
A0A2D7B5P5      EQERTVAEANLIRYETLFKELTSLTLE----ELRNT-----------------------L
A0A3D3XGB5      EQERTVAEANLIRYETLFKELTSLTLE----ELRNT-----------------------L
A0A2V6F8A1      EEQRIRAEAEFSGLAGMLNGLLQLRADKGDAELRKS-----------------------I
A0A2V5TNH4      EEQRIRVEAEFSGLAGLLNGLLKLREEKGNTELRKS-----------------------I
A0A2V5X5Q6      EEQRIRVEADYSGLAGLLNGLLKLREEHGDSELRKS-----------------------I
A0A4P5QM05      ETQLAETRALVDRLRSQLMRVEK----LKPEELMEAARILGIT-----------------
A0A4Q3C001      ETAVNEARNKTEELRTKLRQIES----LKADELLEVLRTLNID-----------------
B4DB23          QQQVNEQQIKVVELERQLEMINS----LSPEQLQDALKTLGID-----------------
A0A6B3L938      ---------ELNQFRTELSALRQ-------------------------------------
A0A2V5URB2      NKRLTEAEAERIGLEAQARLIKR----------------RDYD----------------S
A0A5R8KA81      NVRLTQSKTDRIRLENDREQVKT-----------AGNDLYKLL----------------S
A0A5B5WU87      KKDLRELALEIKSIEYLKQYLEE-----------EAEHDAKLV----------------P
R7DZW0          KKDLRELELEIKSIEYLKDYLEQ-----------EAEHDARLV----------------P
A0A2N8HID1      KKDLRELELEIKSIEYLKDYLEQ-----------EAEHDARLV----------------P
A0A2N8HS06      KKDLRELELEIKSIEYLKDYLEQ-----------EAEHDARLV----------------P
A0A3R5R2M8      EKEIFELETQIKLSSVLADNLKE------------AGRNGGLI----------------S
A0A411SUQ6      EKEIFDLETQIKLASTLADNLKE------------SERKHGLI----------------S
A0A2N8HZF2      EKEIFDLETQIKLAAILADNLKE------------TERKQGLI----------------S
A0A354E720      EKEIFDLETQIKLASTLADNLKE------------SERKQGLI----------------S
B2UPB6          EKEIFDLETQIKLASTLADNLKE------------SERKHGLI----------------S
A0A2A2XXW5      KIAYETLRSTADVAKQIAQQAQE-----------WVAAGKDIT----------------D
A0A2V6JLK8      EAEVNDAETKVTTLSSKLAQIEN----LKGDDLMRMLPTLDVQ-----------------
A0A2W5Z1A5      EAEVNDVEAKVATLQSQLSQIEH----LKGEDLMRMFAALNIQ-----------------
A0A2V6EA09      EEGVNEAEMTIEALGSRLEQIRK----LKGEELMRMLATLNIQ-----------------
A0A2V6GQI7      EEGVNEAEMTIEALGSRLEQIRK----LKGEELMRMLATLNIQ-----------------
A0A3C1HEJ2      NQRIAASEFNAQSLDRDLSRMTG------------LGQNVPLL---------------VT
A0A522ULD9      QGDLIAARVDMLVRKSRLDQIQN----LDGENLLS------------------------A
A0A1V6JU76      QAQYAMAKAQAQTTQTIVEELDR-----------HIQAGNPLE----------------T
A0A1Q6UHJ9      NTILTSDKRAYDAASTQWNLVQE-----------FKRDGKDLA----------------D
A0A2V2BXR0      NTILTSDKRAYDAASTQWNLVQE-----------FKRDGKDLA----------------D
A0A2D8V0G3      SDGFQKASDEAAQAVKVVETVDN-----LIAEAEADSRTLDLS----------------V
A0A348S017      SQSHQLANDEAEQAQKAIDEVDK-----MIREAGESGQLLDLS----------------Q
A0A3C1UUV7      SQSHQLANDEAEQAQKAIDEVDK-----MIREAGESGQLLDLS----------------Q
A0A350I3V2      SQSHQLANDEAEQAQKAIDEVDK-----MIREAGESGQLLDLS----------------Q
A0A520RGV5      SQSHQLANDEAEQAQKAIDEVDK-----MIREAGESGQLLDLS----------------Q
A0A3D3XF90      SQSHQLANDEAEQAQKAIDEVDK-----MIREAGESGQLLDLS----------------Q
A0A2D7B522      SQSHQLANDEAEQAQKAIDEVDK-----MIREAGESGQLLDLS----------------Q
A0A356NIC2      SQSHQLANDEAEQAQKAIDEVDK-----MIREAGESGQLLDLS----------------Q
A0A2U8DZK4      QSTLVALTVDANSLKTRYESFRD----IPPDKRLSLVNAQLIE-----------------
A0A2T6DFL8      QNTLIALSVDAIGRKTRWERFKS----IPAGERQSLVNSELIP-----------------
A0A1D8AWD4      QNSLIALRVDAIGRKTRWERFRN----IPAADRRNLVNSELIQ-----------------
A0A4Q1C9S2      QNSLIALRVDAIGRKTRWERFRG----IPTADRRNLVNSELIQ-----------------
A0A178IH18      QNTLVALRVDAIGRRARYENFKK----IPEADRANLVNSELIT-----------------
A0A2T6DT99      QNSLIALSVDAIGRKTRYERFKS----IPPEERLNLVNSELIQ-----------------
A0A1G3ZT33      QNSLIALRVDAIGRRTRWERFKN----IPAGERVTLANSELIQ-----------------
A0A3E1E2T2      QNSLIALSVDAIGRKTRWERFKD----IPFEERVSLVNSELIP-----------------
B1ZMW1          QNSLIALSVDAIGRRTRWERFKS----IAPADRLSLVNSELIQ-----------------
A0A2N8HDG3      DNSIFELQTQMKLADGLKESLNA------------LGQKAGLI----------------S
A0A146GCJ0      NSKVTEAKSKRLQLEADIDQLKR----------VEKGNLDALL----------------A
A0A2T6D6H8      NTKVTEAKSKRLQLEADIEQLKR----------VEKANVDELL----------------S
A0A3D1TI55      QLELERARLDLWTAEAQLQKVES----LEGKQLED------------------------A
A0A3R8IT45      GSVLTQTQSRLGEAEVRKNQVEA-----------RIKAGGDLT----------------E
A0A1H1MGC9      NAYVTQTTSRLNEAEIRWRQVQE-----------RKATPAQLL----------------D
A0A2A2PYE8      NAEKTRAQIAMNAAEGRINQIKE-----------VRQRSGDLT----------------E
A0A2T6CN73      NLEVARASIALNAAENRRNQVAE-----------LKARGGNLT----------------E
A0A3E1ET42      LRSQGVLEQQVIRLRSQLESLMK----LEGDQLIANAASLDVQ-----------------
A0A2A2YDW8      ESQVEAAKTTLAELDSMIASIDR----LSADEVIRYAANLEVA-----------------
A0A352XLN9      ESQVEAAKTTLAELDSMIASIDR----LSADEVIRYAANLEVA-----------------
A0A3D0YP62      ERQLYEAERERDQLKFQIDKLLA----VADEDLPGLAA--DLP-----------------
A0A3D3DV47      ERQLYEAERERDQLKFQIDKLLA----VADEDLPGLAA--DLP-----------------
A0A2E5XJ49      VMQQFEHEKSKRQLENQINQLVN----LKNEELMNFAEGLKLP-----------------
A0A2E6SBY8      VMQQFEHEKAKRQLENQINQLVS----LKNEELMNFAEGLKLP-----------------
A0A2E5QMS4      EMQQFGAEERKAELENQIQQLLT----LRDDELIDFAEGLKLP-----------------
A0A2E7YXQ3      EMQQFGAEERKAELENQIQQLLT----LRDDELIDFAEGLKLP-----------------
A0A2E3H787      EMQQFAAEXKKXXLENQIERLLT----LKDAELIDFAEGLQLP-----------------
A0A2E7AGN1      EMQQFTAEEKKGQLENQIEQLLT----LRDEELIDFAEGLQLP-----------------
A0A2E7AKY7      EMQQFTAEEKKGQLENQIEQLLT----LRDEELIDFAEGLQLP-----------------
A0A3D4CU34      EMQQFTAEEKKGQLENQIEQLLT----LRDEELIDFAEGLQLP-----------------
A0A2E8M146      EMQQFTAEEKKGQLENQIEQLLT----LQDEELIDFAEGLQLP-----------------
A0A355S8S2      EMQQFTAEEKKGQLENQIEQLLT----LQDEELIDFAEGLQLP-----------------
A0A2D6DVN8      EMQQFTAEEKKGQLENQIAQLLT----LRDEELIDFAEGLQLP-----------------
A0A3C1W2R2      EMQQFTAEEKKGQLENQIAQLLT----LRDEELIDFAEGLQLP-----------------
A0A2E3NAY6      EMQQFTAEEKKGQLENQIAQLLT----LRDEELIDFAEGLQLP-----------------
A0A2E3II01      EMQQFTAEEKKGQLENQIAQLLT----LRDEELVDFAEGLQLP-----------------
A0A368B8C5      EMQQFTAEEKKGQLENQIAQLLT----LRDDELVDFAEGLQLP-----------------
A0A3R7RBB5      EMQQFTAEEKKGQLENQIAQLLT----LRDDELVDFAEGLQLP-----------------
A0A2A2QX62      AREYDRLDREKIQLESQIETLLK----YDGAQLLAHASGLSLP-----------------
A0A4Q3BWH6      AKVYVETEQEKIQLESQIETLLK----YDGPQLMNYASGLSLP-----------------
A0A3N5WCF1      LQIYHDIEQEKLQLESQISSLLK----YDSDQLMVYAGGLNLP-----------------
A0A4Q3C1K5      MQTYSQLQQEKMQLASQINSLLK----YDSDQLMVYAAGLDLP-----------------
A0A2G4G428      VRAREDTRKAIDEMEIIWRLIGE-----------YKQTGKDLY----------------D
A0A139TV24      DNSIFELQTQIMLANDLENNLKA------------VSKKAELI----------------S
A0A2N8HT11      DNSIFELQTQMKLADGLKENLDA------------LGHKAGLI----------------S
R7DS70          DNSIFELQTQMKLADGLKENLDA------------LGHKAGLI----------------S
A0A2N8HNL6      DNSIFELQTQMKLADGLKENLDA------------LGHKAGLI----------------S
A0A6I1K459      SENCTAAKTERLVMETDYEMTKR-----------VGSKVSELL----------------T
A0A139TUL1      GTELFSTRTELIQVKVLAGLLAE------------GGRERDMI----------------P
A0A2N8HCB0      GTELFSTRTELIQVKVLARLLAD------------RSRQQDMI----------------P
A0A2N8HP04      GTELFSTRTELIQVKVLARLLAD------------RSRQQDMI----------------P
A0A2N8HRJ0      GTELFSTRTELIQVKVLARLLAD------------RSRQQDMI----------------P
A0A366HAG0      QRDVATLQKQVRDLKAQHDQMMT----LEGDELIRLAGEMKVE-----------------
A0A3M1I8A3      QARYADAKATAEIMQATIRELDA-----------HLKAGRPAE----------------T
A0A4V0XS84      QLDLEKAVSDSISKTQLANELGN----LVRAGLSAEGAQMAML-----------------
A0A0R2XQ77      NTIKLENKNVYDNLETRMGLVET-----------FRREGRNLW----------------E
A0A2E9IN28      NEIKLSNKNLYDQLETKWNLIES-----------YRRQGKELW----------------E
D5ENH7          NQIKLESKNNYDQFETKWKLIDS-----------YKLEGKNLW----------------E
A0A351WE84      EADRIASRVDMLVRKARLNQLES----LEGTELMN------------------------A
A0A1V5QDZ6      EADRIAARVDMLVRKAQLDQLVN----LSGEELMN------------------------A
A0A4Y8P964      SEAMSKARFEMIRREVYLEKAKS---------------AMEAG----------------K
A0A3D4HF88      NQVLTTTKQVRDQSKHRWEQIQS-----------FKAEGKPLQ----------------D
A0A351MR11      VKDREELRRQIDELAIIWEQIEQ-----------FKKEGKDLV----------------L
A0A6G6K641      NERLNEARSRRMQLEVDMAGALK-----------GQSNAEDLL----------------K
A0A5B5WI95      EKEIFDLETQIKLAAVLADNLKK------------TVRNDGLI----------------S
A0A2N8I9W1      EKEIFDLETQIKLAAILADNLKE------------TERKQGLI----------------S
A0A4Q5IH27      EKEIFDLETQIKLAAILADNLKE------------TERKQGLI----------------S
A0A2N8IBZ6      EKEIFDLETQIKLAAILADNLKE------------TERKQGLI----------------S
A0A2N8IJW9      EKEIFDLETQIKLAAILADNLKE------------TERKQGLI----------------S
R6J100          EKEIFDLETQIKLAAILADNLKE------------TERKQGLI----------------S
A0A1V6J089      ENERSAARVDMLVRKARMDQLED----LEGDKLMDA-----------------------A
A0A3C1BZR1      EGERSGARVEMLVRKARMDQLEG----LEGDRLMDA-----------------------A
A0A1H6KPB7      RNKLSALDDEITQLKTHINKLKS----LKDSELMDYVRQTDLL----------------A
A0A2E9ISN4      LARLKSVRLERVLLENQYEQLSDADILTVNEALAATRETEGRSQVTPEGAPAVDPGAETP
B9XAX1          NQKYTSAKADRIQMEADLKLIQS------------------------------------L
A0A5R8KKM9      ERDIYKLTNEIQSLRAQISQLQT----LDGDALIRQAGELRVE-----------------
A0A139TS01      KAQLMKFEKDEQELAAYVAEVQR----LPDDKLMDYVTNSDLL----------------N
A0A3E1EJT7      NMMGTQTNAHLKEAEVKWNQVQE-----------WTKAGRSLS----------------E
A0A317ZP96      NTMKLNNKNILDNLETKWNLIEN-----------YKREGKDLW----------------E
A0A2D5WGA5      ESELITAKGVHTTQSTLLEGLKA----QSDEELRASILTAHPD-----------------
A0A2E7SSH2      ESELITAKGLYTQQATLLQGLQG----QSPDELRESIMTAHPD-----------------
A0A349GXM8      MERRNQLTTELMLLEAQYPALDGANAAVISDVARLTRATGEIKPSESSRDEEEAPVPGGE
A0A4P5YP61      SKKVTEAKSVRISLESDLAQIQQ----LGTN-------IGALL----------------G
A0A6B2LYM4      NTRLEQDKQLYDEASTVMAQINE-----------ARDSGDPLW----------------E
A0A6D1VXB3      SEAVSKARFEMIRREVYLEKAKA---------------AMDAG----------------K
I0JYY7          SEAVSKARFEMIRREVYLEKAKA---------------AMDAG----------------K
A0A4R7S1J2      SSKLSQQTNDRVRLETDYAALLQMKSRPDEAVNLQIVANHPTL----------------N
A0A2A2XV69      EQQVSTERLRVSTLRAKYEQISK----LSDDQIMRSISTLDVQ----------------D
A0A651H7X9      NMMLTEAAARRNEAAVRWNLVQQ----YREE-------GRPLT----------------E
A0A4Y8P842      GDALSKARFEMIKKEVFYERAKN---------------GLDSG----------------K
B3DZK9          SDALAKARFEMIRKEVFYERAKN---------------GLDMG----------------K
A0A5E6MPC4      DKSPAEQELGRLSEAIFRARLDL----LRREVRLERAKEAFAG----------------G
A0A4V1SB02      NNQVGTATNQRTAIESDLAALKQ----IPTENVEELL-----------------------
A0A3C1VB86      TPQLQDLNERLTQSKASLVQAQG----AYQDSLKMSTNTEDLL----------------A
A0A146G2Q9      EQQVSQESLRVAALRAKYDQVSK----MTDEQIMRSLTTLEIE----------------D
A0A2T6D3Y2      EQQVSQESLRVAALRAKYDQVSK----MTDEQIMRSLTTLEIE----------------D
A0A2V2SDV4      ESLRIEGLRELVSQQTLLDKLLA----FSPKDVVNVL-----------------------
A0A2V5PK75      ESLRIENEADFVKQSTLLNKLKS----LKYQELTQVL-----------------------
A0A1V6DME1      KAQQIEGEAAYVREATLLQELKT----TAPEDLKSVL-----------------------
A0A3D3DIJ3      ESLRIESQAEYVRQATRLDRLKNLGKELGPEGLAQAI-----------------------
A0A2D5VY59      EQERTVAEAKLIRFQTLFNELEA----MTLDQLKNTILTAMPG----------------N
A0A2D8UZZ4      EQERTVAEAKLXRFQTLFNELEA----MTLDQLKNTILTAMPG----------------N
A0A353DV86      EQERTVAEAKLIRFQTLFNELEA----MTLDQLKNTILTAMPG----------------N
A0A2E5EPT8      EMLNIEMNAGLTSKKTQLEQLKS----LSPKVLGNALMTVLPN----------------E
A0A6I1K583      EQENIQLATTYRRKQTRFDELKK----LPADQLRNALNYVAPD----------------E
A0A350EWA4      RNKHDLEKLEYEKMMKRLHGMEA----LTSIDQLKVALPTSFP----------------D
A0A5B5WZ91      KAQLMKFEKDEQELAAYVAEIQR----LPDDKLMDYVTNSDLL----------------N
A0A2N8HD92      KSQAMAFEKDEKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A2N8HIT2      KSQAMQFEKDEKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A354EBD3      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A355VEB2      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A2N8IMT3      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
R6K1U5          KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A2N8IWC2      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A2N8I441      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A2N8I3A6      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A410SCC4      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A3R5VEW0      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A411SSG2      KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
B2UKW3          KAQAMDFERREKELASYVQELQR----LPDDKLLDYVISSDLL----------------N
A0A1M6RLZ4      ERLYQEALRDRDSLKSIVQRLGD----LDNEALISAMAGLNLP----------------E
A0A354T7G8      L-----ADQDTLTLQAEIDEIGK----LSIEELIARASGLKLD----------------N
A0A2S7U4L6      NMLYDEAVKARDELERQVKDLVG----LDDETLISHVSGLNRP----------------E
A0A512MBZ2      Q-----SDLEVQNLTSELEQLDK----LSPDELVARASGLRLD----------------N
A0A2E8MEZ0      LDT---LEQTRDQIQIQIRKLID----TPNEDLIRTAAGLELP----------------E
A0A4Q2YKS3      ADAFAKLEQQKIELESQIKSLLN----YRTEQLMVYASGLDLP----------------E
A0A6B3LBV6      T-----LEYEISGMKSQLEGLQG----LEGTDLIRKAAMLGIE----------------D
A0A2E3EC33      Q-----AEGAIQNLRTTIKSLTD----LEGEELIKSAVDLGIK----------------N
A0A2E4GN01      X-----AEXAIQXLXTTIXSLTD----LKGEELIKSAVDLGIK----------------N
A0A1Z8XU55      A-----AEEAIQNLRSTISSLTQ----LEGEELIKSAVDLGVK----------------N
A0A2E1RQR9      A-----AEEAIQNLRSTISSLTK----LEGEELIKSAVDLGVK----------------N
A0A2E3ISQ4      A-----AEEAIQNLRSTIKSLTQ----LEGAELIKSAVDLGVK----------------N
A0A2D6W6F4      A-----AEEAIQNLRSTIKSLTQ----LEGAELIKSAVDLGVK----------------N
A0A2D8Z5A8      A-----AEEAIQNLRSTIKSLTQ----LEGAXLIKSAVDLGVK----------------N
                                                                            

A0A2A2XVF1      IGS-------------VATIPQVAEARRQLSDSNMEIAAMQDRYG---------ERHPKF
A0A2V5UHJ2      VPS-------------VRNSAVIGSLKAELGKFEAEYASLAKEFK---------AGYPPL
A0A2V5PST3      ----------------VLTQGMIPTLRSTLLTLEAEKIKQSTVFK---------PDHPRM
A0A2V5PXM3      LPA-------------VANDPTVTDIRGNVGRLESDLANLRQRYK---------EKHPKY
A0A139SU05      ITY-------------IGNYNTVAPLRGQMTTLLQEQARLAERYL---------ERHPRM
A0A1D8AZK8      IGY-------------ITAYGNIAALKTQLAELQNQQSLLAERYL---------ERHPKM
A0A1V5QB01      APAPAVGGLEGLVEYGVVQQRGWQEQRRVKSLLEARLAEYRTKFR---------DAHPLV
A0A139SPN4      ITY-------------IGSYGTVAPLRTQLSTLLQEQARLAERYL---------ERHPRM
A0A1V6E7N1      ISS-------------IATYDQIPALNAQIAELTRTQTVLGERYL---------ERHPLM
A0A2D9MYT1      IPD-------------VAADAEVKKMRGDLALALAELASLRERYL---------EKHPKI
A0A258ANJ7      LPS-------------IASHPKVSGILSQIASQKSALAVLAERYK---------PKHPKY
A0A139TLN4      INS-------------KIADMGIRDQIGVFNDTLLKKTSLKVNAG---------DNNPIV
A0A290QGD9      LSF-------------IAIQPIIGELKKQQAEQKVVVAQLSERYR---------AKHPRM
A0A1D8AS58      LPF-------------IASQSLIVQLVQQVAAQKIVLAQMRERYR---------DKHPRM
I6AQC1          LPF-------------IASNPLVSQLASQIAMQTITIKQLRERYK---------EKHPKM
W0ITH7          LPF-------------IANNQLVAQLASQVAMQTITVKQLRERYK---------EKHPRM
A0A1G3ZFT0      ------------------------------------------QYT---------KSHPSM
A0A1Z8ZMT6      ----------------------------EMAVAEKAIQDLSIRYG---------LKHPKI
A0A2E8MCT7      ----------------------------EMAVAEKAVQDLSIRYG---------PKHPKI
A0A290Q2Z2      -------------------DPNIQNLLQAYLIADQNVTKFRARLG---------AAHPEL
A0A2A2RGK2      LPS-------------VAAEPKVAQYSESLNARQRDLTIVAQRYR---------SKHPTY
A0A2A2XXF7      LPS-------------VAAEPKVAQYSESLNARQRELTLISQRYR---------AKHPAY
A0A2A2R5D6      ------------------DANLTSLRAKKYAAESDLEQMRKSGLE---------GNHPRI
A0A2V2DJ66      LPF-------------IADLPIISKLVSDRSQYQVSVSTLEKRYK---------EKHPRM
R7L5A9          LPF-------------ISEFQQIAKLLTDRSTQQVFIASLEKRYK---------EKHPSM
A0A1J4XH17      LSF-------------INSIPQVEQLLSDLATKNIEISSLEKRYG---------AKHPKM
A0A3C1VJ32      PGV-------------VSDAE-LGSLLAQYHEAQRKIAALKVDYS---------PANLDV
A0A2N9NTX7      PIT-------------APDSY-LNSLMEQVTVADQRLVMVQKDYG---------PENDET
B9XK55          PTA-------------APDAI-LIQLLQDLIGAETKLVTLLADYG---------DKHPEV
A0A4P5YMI6      VTV-------------YPDEL-LATLLQKQTLTIQELAAKSKDLG---------AQHPEV
A0A2E6T482      LTA-------------HPDAQ-LDALIRELHTGEQTVANQSIDLG---------EQHPRI
A0A3C0DQZ7      LTA-------------HPDAQ-LDALIRELHTGEQTVANQSIDLG---------EQHPRI
A0A1Z9CBK5      MTA-------------NPDAQ-LDALIREYQTGQTTLANKSIDLG---------EGHPTI
A0A2D6ZI96      MTA-------------NPDAQ-LDALIREYQTGQTTLANKSIDLG---------EGHPTI
A0A358KGZ3      MTA-------------NPDAQ-LDALIREYQTGQTTLANKSIDLG---------EGHPTI
A0A2E9ZQX4      MTA-------------NPDAQ-LDALIREYQTGQTTLANKSIDLG---------EGHPTI
A0A3D5JZU0      MTA-------------NPDAQ-LDALIREYQTGQTTLANKSIDLG---------EGHPTI
A0A2E6HCR0      LTA-------------YPDAQ-LDALVREYQTGQTTLANKSIDLG---------EGHPTI
A0A1Z8WN04      LTA-------------YPDAQ-LDALVREYQTGQNSLANKSIDLG---------EGHPTI
A0A2D7L1N4      LTA-------------YPDAQ-LDALVREYQTGQNSLANKSIDLG---------EGHPTI
A0A2E2R937      LTA-------------YPDAQ-LDALVREYQTGQNSLANKSIDLG---------EGHPTI
A0A520QQY4      LTA-------------YPDAQ-LDALVREYQTGQNSLANKSIDLG---------EGHPTI
A0A2D5MR66      LTA-------------YPDAQ-LDALVREYQTGQTTLANKSIDLG---------EGHPTI
A0A2E0PDQ1      LTA-------------YPDAQ-LDALVREYQTGQTTLANKSIDLG---------DGHPTI
A0A2E2ZZP9      LTA-------------YPDAQ-LDALFREYQTGQTTLANKSIDLG---------DGHPTI
A0A2A2RGF2      GPP-------------VVNDEILARRLEEHSAAEKEFVSKGKDLG---------PNHPDY
A0A2G4I5Y6      GPP-------------VVNDEILSRRLEEYSAAEKEFVSKGKELG---------PNHPDY
A0A3M1I883      LTV-------------MPSEALLPKRIDDLDVVEQNLSKLLKDYT---------PENPEV
A0A1V6JZ45      LVT-------------MPTEARLGELLGALSLAQQEVARLREDFS---------NDYPEM
A0A520RRW5      LTA-------------MPGNLRLTSLLNEFDRGHQQLSQMKAIHG---------PDHPQM
A0A356NPK0      LTA-------------MPGNLRLTSLLNEFDRGHQQLSQMKAIHG---------PDHPQM
A0A2D7B5P5      LTA-------------MPGNLRLTSLLNEFDRGHQQLSQMKAIHG---------PDHPQM
A0A3D3XGB5      LTA-------------MPGNLRLTSLLNEFDRGHQQLSQMKAIHG---------PDHPQM
A0A2V6F8A1      LTA-------------MNDEL-LSKLMMDLATTEANLAKLKETLG---------PQHPDF
A0A2V5TNH4      LTA-------------INDEL-LSKLMMDLSTTEANLAKLKETLG---------PENSDF
A0A2V5X5Q6      LTA-------------INDEL-LSKLMTDLSTTEANLAKLNAGLG---------PRNPEF
A0A4P5QM05      ------------------DSTVEKTLPLLQDAKAEEAKFFSAGLG---------ENHPRM
A0A4Q3C001      ------------------EPTVRENLPLLQQAAAEEAKLLASGLG---------EAHPKI
B4DB23          ------------------DTTVSRNLPLLQDAAAEHARLTNLGLG---------VNHPRI
A0A6B3L938      ------------------------------------------RYL---------PKHPRR
A0A2V5URB2      LPA-------------VISNSLIQSLRAQVVQLESEHAKLAAQFL---------PGYPRL
A0A5R8KA81      IPS-------------IANQRAVAELRSQISLAESEMANLSQRYR---------PKHPRF
A0A5B5WU87      INS-------------KIADMGIRDQIGVFNDTLLKKTSLKVNAG---------DNNPIV
R7DZW0          INS-------------KIADMGIRDQISVFNDTLLKRTSLKVNAG---------DNNPII
A0A2N8HID1      INS-------------KIADMGIRDQISVFNDTLLKRTSLKVNAG---------DNNPII
A0A2N8HS06      INS-------------KIADMGIRDQISVFNDTLLKRTSLKVNAG---------DNNPII
A0A3R5R2M8      VDT-------------GLTDNGLSRQIENYNEAWLEYRKIAGSAG---------SRNPIA
A0A411SUQ6      VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIA
A0A2N8HZF2      VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIA
A0A354E720      VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIT
B2UPB6          VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIA
A0A2A2XXW5      FAP-------------LAKDEQVAYLRKQVNDNSSKLAGLRTKYR---------ERHPRV
A0A2V6JLK8      ------------------DPTVQKILPNYQDTVAQEALLLNSGLG---------EDHPKV
A0A2W5Z1A5      ------------------DPTTLKILPNYQDAVAQEASLLNSGLG---------ENHPKV
A0A2V6EA09      ------------------DPTIQKILPNYQEAVAQDAFFLNSGLG---------ENHPKV
A0A2V6GQI7      ------------------DPTIQKILPNYQETVAQDAFFLNSGLG---------ENHPKV
A0A3C1HEJ2      MPV-------------VSADPTVSAAMIAVLTQENAMDLVKRDLK---------PKHPDY
A0A522ULD9      SQF-------------IVGDVSLNSLRQQVTDTQVSLKLMLENLG---------ENHPDV
A0A1V6JU76      FPK-------------IAADGKVNSLQLQLSGQENELAGLLKRYK---------DKHPAV
A0A1Q6UHJ9      LPF-------------IAELPQISKLLTDKSSQQVFVASAEKRYK---------EKHPRM
A0A2V2BXR0      LPF-------------IAELPQISKLLTDKSSQQVFVASAEKRYK---------EKHPRM
A0A2D8V0G3      LPY-------------IQNSPIIQQLRVSLAAAEAELASLEVKYL---------EKWPAV
A0A348S017      IPF-------------VASSEIIKTIRANLVMAKTDLAALQVKYL---------EKWPAV
A0A3C1UUV7      IPF-------------VASSEIIKTIRANLVMAKTDLAALQVKYL---------EKWPAV
A0A350I3V2      IPF-------------VASSEIIKTIRANLVMAKTDLAALQVKYL---------EKWPAV
A0A520RGV5      IPF-------------VASSEIIKTIRANLVMAKTDLAALQVKYL---------EKWPAV
A0A3D3XF90      IPF-------------VASSEIIKTIRANLVMAKTDLAALQVKYL---------EKWPAV
A0A2D7B522      IPF-------------VASSEIIKTIRANLVMAKTDLAALQVKYL---------EKWPAV
A0A356NIC2      IPF-------------VASSEIIKTIRANLVMAKTDLAALQVKYL---------EKWPAV
A0A2U8DZK4      -------------------DPGTQRLQQIYLEAEQNVTKLSARLG---------EAHPEM
A0A2T6DFL8      -------------------DQNIQNLLQAYLVADQKVTQLQGRLG---------EAHPDL
A0A1D8AWD4      -------------------DTNIQNLLQAYLISDQTVTRLMARLG---------AAHPDL
A0A4Q1C9S2      -------------------DTNIQSLLQAYLVAEQNVTRLMGRLG---------SAHPDL
A0A178IH18      -------------------DTNIQNLLQAYLVADQNVTRLRSRLG---------EAHPEL
A0A2T6DT99      -------------------DPNIQNLLQAYLVADQNVAKLKTRLG---------EAHPEL
A0A1G3ZT33      -------------------DTNIQNLLQAWLVADQTVARLKSRLG---------EAHPDL
A0A3E1E2T2      -------------------DINIQNLLQAYLLADQNVTKLKARLG---------EAHPDL
B1ZMW1          -------------------DTNIQNLLQAYLVADQNVTRLQSRLG---------EAHPDL
A0A2N8HDG3      LDT-------------GIADSGVSRQIEAYNTAYLEYQKVAGSAG---------GQNPIV
A0A146GCJ0      INS-------------VSNLPQVALIREQLLNAEGDLAGLKERYL---------PKHPKY
A0A2T6D6H8      INS-------------VSQLPHVAVIREQLVSAEAELAALKDRYL---------PKHPKY
A0A3D1TI55      IPF-------------LVNDPSYNTLNQQLVEAEIAYRAAEENYG---------PKHPEM
A0A3R8IT45      LPF-------------IAANHLVAQLSQLVSMRKIEVKQLRDRYK---------DKHPKM
A0A1H1MGC9      LPF-------------ISSSQLIGQLVQQVSAQKIVMSQLREHYR---------DKHPKM
A0A2A2PYE8      LPF-------------IASQPQVVQLGQLLAERKIAIATLRERYR---------DKHPKM
A0A2T6CN73      LPF-------------IATQATIVELLKQLAAQKVQLEQLGARYR---------AKFPKM
A0A3E1ET42      ------------------NDTIKALYPEYQKSVIEESRLLNSGFG---------KNHPKI
A0A2A2YDW8      ------------------GQDLKSLFPEYQEQVRMLSGMQVQGLG---------PRHPNV
A0A352XLN9      ------------------GQDLKSLFPEYQEQVRMLSGMQVQGLG---------PRHPNV
A0A3D0YP62      ------------------DVGFREAYNKFEDAKAELQTAKASGLG---------NKHPDI
A0A3D3DV47      ------------------DVGFREAYNKFEDAKAELQTAKASGLG---------NKHPDI
A0A2E5XJ49      ------------------GSAVPELHRAWMAGKRSIATMEASGLG---------RKHPNI
A0A2E6SBY8      ------------------GSAVPELHRAWMAGKRSIATMEASGLG---------RKHPNI
A0A2E5QMS4      ------------------GSQVPVLRARIQESKLNMAAMEASGLG---------RKHPSM
A0A2E7YXQ3      ------------------GSQVPVLRARIQESKLNMAAMEASGLG---------RKHPSM
A0A2E3H787      ------------------GSQVPVLRGRLQESKVNIAAXEASGLG---------RKHPQV
A0A2E7AGN1      ------------------GSQVPVLRSRFQESKVNIAALQASGLG---------RKHPSV
A0A2E7AKY7      ------------------GSQVPVLRSRFQESKVNIAALQASGLG---------RKHPSV
A0A3D4CU34      ------------------GSQVPVLRSRFQESKVNIAALQASGLG---------RKHPSV
A0A2E8M146      ------------------GSQVPVLRGRYQESRVNIAALEASGLG---------RKHPSV
A0A355S8S2      ------------------GSQVPVLRGRYQESRVNIAALEASGLG---------RKHPSV
A0A2D6DVN8      ------------------GSQVPVLRARYQEGKVNIAALEASGLG---------RKHPSV
A0A3C1W2R2      ------------------GSQVPVLRARYQEGKVNIAALEASGLG---------RKHPSV
A0A2E3NAY6      ------------------GSQVPVLRARYQESKVNIAALEASGXG---------RKHPSV
A0A2E3II01      ------------------GSQVPVLRARYQESKVNIAALEASGLG---------RKHPSV
A0A368B8C5      ------------------GSQVPVLRARYQESKVNIAALEASGLG---------RKHPSV
A0A3R7RBB5      ------------------GSQVPVLRARYQESKVNIAALEASGLG---------RKHPSV
A0A2A2QX62      ------------------DNVIPVLLPQFQSAKREYDSAMSSGLG---------ERHPKM
A0A4Q3BWH6      ------------------DNIIPVLLPQYQEQKRTYEAMKSQGRG---------ERHPMM
A0A3N5WCF1      ------------------DNIIRTLYPQYQEAKRQLDGLKISGLG---------DRHPTI
A0A4Q3C1K5      ------------------DNLIRNLYPLYLEAERTLESLKIKGLG---------DRHPTI
A0A2G4G428      VAQ-------------VRSDERVASFGSKISDLRVAVRTMEEKYT---------DEHPTL
A0A139TV24      LDT-------------GIADSGVSRQIEAYNTAYLEYQKIAGSAG---------SQNPIV
A0A2N8HT11      LDT-------------GIADSGVSRQIEAYNAAYLEYQKVAGSAG---------GQNPIV
R7DS70          LDT-------------GIADSGVSRQIEAYNAAYLEYQKVAGSAG---------GQNPIV
A0A2N8HNL6      LDT-------------GIADSGVSRQIEAYNAAYLEYQKVAGSAG---------GQNPIV
A0A6I1K459      LVS-------------IARTPEVQSLKEKIQAQETSLANLKLRYR---------EKHPAM
A0A139TUL1      ANI-------------GIQDAGIAKQIELFNDNFLQYKKLSASAG---------KQNPMV
A0A2N8HCB0      ANI-------------GIQDAGIAKQIELFNDNFLQHKKLFASAG---------RQNPMV
A0A2N8HP04      ANI-------------GIQDAGIAKQIELFNDNFLQHKKLFASAG---------RQNPMV
A0A2N8HRJ0      ANI-------------GIQDAGIAKQIELFNDNFLQHKKLFASAG---------RQNPMV
A0A366HAG0      ------------------NETIRRMGPTYQELLLKQQSLATAGLG---------RKHPTM
A0A3M1I8A3      FPS-------------VANDSRVIELQKRLTGYRTDLGAMLQRYG---------EKHPAV
A0A4V0XS84      QQY-------------GGRLTGIQELKKSLTEKESQLANLTQRYR---------DEHPTI
A0A0R2XQ77      LSF-------------IAEESRVAGLLDRISGVKIGISSSSKRYR---------EKHPVM
A0A2E9IN28      LSF-------------ISEQPRVSSLLQRISGTRISISSLSKRYR---------EKHPAM
D5ENH7          LSF-------------ISEQPRVASLLQNISATKIEIASLSKRYR---------EKHPMM
A0A351WE84      SSY-------------VVMDQSIASIRQQLIDTEVALKLMLENMG---------VNHPDV
A0A1V5QDZ6      SSY-------------IVSDPALQAIRAQLIDSEVTLKLMLENYG---------AKHPEV
A0A4Y8P964      LAA-------------IPDSPFTVDLKKNLLKEQAKYHELEDIYK---------EEYPKM
A0A3D4HF88      LPF-------------IAEMPLVQDLQSQLSELKVSQSSAAKRYR---------EGHPRM
A0A351MR11      IPM-------------VKSDDRVAALYNRVSELQVTIETLEKKYT---------ESHPTL
A0A6G6K641      VPS-------------IAQNADVRLAQERWAQEEANLRAISARYR---------EKHPRH
A0A5B5WI95      VDT-------------GLADNGISRQIEGYNEAFLEYQKIAGSAG---------SQNPIA
A0A2N8I9W1      VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIT
A0A4Q5IH27      VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIT
A0A2N8IBZ6      VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIT
A0A2N8IJW9      VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIT
R6J100          VET-------------GLPDSGIARQIEHYNEAYLEYQKIAGSAG---------SQNPIT
A0A1V6J089      AYI-------------VQDPTLLSIRQQYIDSQVSLQLMLKNGVV--------GENHPDV
A0A3C1BZR1      AYI-------------VQDPTLMGIRQQLIDSQVSLQLMLKNGVM--------GENHPDV
A0A1H6KPB7      ETT-------------PGSLSVRELYTRSQTEESTLSKMHMDGYG---------EKHPAL
A0A2E9ISN4      PEA-------------AKNYGAYDHLNTGIQWQETQVRLDELQNEYKQLAAVFKDTHPRM
B9XAX1          TNQ-------------PEAILTLPSILQDPAVMETRRRVVEQEAQVATLLLRYKPNYPKM
A0A5R8KKM9      ------------------NETIRTIGPAYQGLLMRQESVAGSGLG---------PKHPTM
A0A139TS01      AEI-------------LAADSLRKTYQEYMEKDKERENLKAQNLG---------PKHPKM
A0A3E1EJT7      LPF-------------ITSQAKVGQLLVQVTTQKLSVTQLRDRYK---------DKHPRL
A0A317ZP96      LSF-------------IAEQERVASLLERISGARISISSLSKRYR---------EKHPVM
A0A2D5WGA5      --------------------AQLDALIRELHTGQQTLANQSIDLG---------EQHPRI
A0A2E7SSH2      --------------------AQLDALIREFQTGQTTLANKSIDLG---------EGHPTI
A0A349GXM8      TKS-------------AKEDAAQQTDETIQGFQNLRVRLMRLEADQAELLKVLKDDHPRL
A0A4P5YP61      IAS-------------VANDPTVRDIKSNLSKFESEFATIKQRYL---------PKHPKY
A0A6B2LYM4      LGF-------------IANNAEVSDLLNKLTVNKIQIATLSKKFR---------AMHPTM
A0A6D1VXB3      LAA-------------IPDSPFTVDLKKILLKEQAKYRELEDIYK---------EEYPKM
I0JYY7          LAA-------------IPDSPFTVDLKKILLKEQAKYRELEDIYK---------EEYPKM
A0A4R7S1J2      GIS-------------TALAARRSEFAALQSRYK--------------------SKHPKY
A0A2A2XV69      PT-------------------ITQMLPQFQEVASEEARLLNSGLG---------VNHPTV
A0A651H7X9      ISF-------------IANNPIVNDLRARLAAKEIEMAQLRDRYR---------DLHPTM
A0A4Y8P842      SVT-------------IPDNQYTMDLKKNLLKEQAKYRELEEIYK---------EDYPKM
B3DZK9          SLT-------------IPDNQYTMDIKKNLLKEQAKYRELEEIYK---------EDYPKM
A0A5E6MPC4      KAG-------------VPENPYTVELKKLLLKEEAKYREMEEIYK---------PEYPRM
A0A4V1SB02      ---------------------KLNSLSALPDVLRARTAVMEKEAAFATVLERYKSKHPKY
A0A3C1VB86      YPQ-------------IAIEPDMVQISTDLARLENDFAVIRQRYR---------EAHPKY
A0A146G2Q9      PT-------------------ITQLYPQFQEAASEEARMLNAGLG---------ANHPNV
A0A2T6D3Y2      PT-------------------ITQLYPQFQEAASEEARMLNAGLG---------VNHPNV
A0A2V2SDV4      -PT-------------VIPDATLTSWLEQRNMLQQRFIALTNILG---------ERHADV
A0A2V5PK75      -PT-------------TVADSLLSSLLEQKNMTEQALVIRQKEYG---------DKHVEV
A0A1V6DME1      -PT-------------AVADPQLAELLQQLNLVEQERIRLARDLT---------DDHPAV
A0A3D3DIJ3      -TT-------------DAPDTLLTSLLDQLTMAEQRLIALEADYG---------PENTEV
A0A2D5VY59      LR-------------------LTHLLNEYDTTRQALARLSAIH-G---------PEHPER
A0A2D8UZZ4      LR-------------------LTHLLNEYDTTRQALARLSAIH-G---------PEHPER
A0A353DV86      LR-------------------LTHLLNEYDTTRQALARLSAIH-G---------PEHPER
A0A2E5EPT8      IN-------------------LPRLYEQLATAQQELVA-KGKELG---------PKNPEI
A0A6I1K583      LLT-------------KRLDELSLAEKEFIS--------KSKDLG---------PLNPEY
A0A350EWA4      SAL-------------IVN--FAGMFQSEADAERQLAGLLGQ-FG---------RDHPTV
A0A5B5WZ91      AEI-------------LAADSLRKTYQEYMEKDKERETLKSQNLG---------PKHPKM
A0A2N8HD92      AES-------------VGAKALRETYAEFSEKLKEKENLKAQNIG---------PKHPKM
A0A2N8HIT2      AES-------------VGAKALRETYAEFSDKLKEKENLKAQNIG---------ARHPKM
A0A354EBD3      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------PKHPKM
A0A355VEB2      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------PKHPKM
A0A2N8IMT3      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
R6K1U5          AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
A0A2N8IWC2      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
A0A2N8I441      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
A0A2N8I3A6      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
A0A410SCC4      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
A0A3R5VEW0      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
A0A411SSG2      AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
B2UKW3          AET-------------VGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKM
A0A1M6RLZ4      IK------------------VVQNLNEMYLDASRERGSLIAAGLG---------ANHPRV
A0A354T7G8      PS-------------------LASNTTEYNKLIVQREGLMNAGMG---------RRHPNV
A0A2S7U4L6      SA------------------VLALTFQQYQDAKRERAGVIAQGLG---------ENHPQV
A0A512MBZ2      PN-------------------LTSMTAEYQKLQITREGLSQQGLG---------RKHPLV
A0A2E8MEZ0      NQ-------------------VTSYYTGYRAADEQVSAMIASGLG---------PNHPEV
A0A4Q2YKS3      NI-------------------VKTLYPQYLEMQNNLDAAKTQGFG---------DRHPTV
A0A6B3LBV6      QT-------------------IQRYYPMFNDLLLEEQQALESGLG---------ANHPTV
A0A2E3EC33      ET-------------------LSSGWSSYQALELSRAALVESGVG---------NKHPKI
A0A2E4GN01      DI-------------------LSNGWSSYQTLELSRAALVESGVG---------KKHPKI
A0A1Z8XU55      ET-------------------LTSGWTEYQSLELNRAALVDSGVG---------IKHPKI
A0A2E1RQR9      ET-------------------LTSGWTEYQSLELXRAALVDSGVG---------XKHPKI
A0A2E3ISQ4      ET-------------------LNSGWSEYQTLELSRAALIDSGVG---------VKHPKI
A0A2D6W6F4      ET-------------------LNSGWSEYQTLELSRAALIDSGVG---------VKHPKI
A0A2D8Z5A8      ET-------------------LNSGWSEYQTLELSRAAXIDSGVG---------VKHPKI
                                                                            

A0A2A2XVF1      IAALAKAESLKKSLRESAGKAGDILNRQ------------YEAACQTE----SKLTVALK
A0A2V5UHJ2      DNVKTRLEETRRHLNSEIDKEVKGIEAG------------FAAARNKE----SELRVAME
A0A2V5PST3      IELNQQIKEATQSLNTEINNVVRGIREN------------YVAARAKE----QALEVETG
A0A2V5PXM3      IQTASQLVEWKNTLTNAVLNVPQVVRSL------------YESARTAE----AALETALR
A0A139SU05      IEVTNAIIITQEHLDLAVQGAIADLKTS------------LIEVKKTI----AQLENEYA
A0A1D8AZK8      ISVANSIDVIAAQIQNDIAQSLSDLRTQ------------YTKVKETE----ASYQKEYK
A0A1V5QB01      QQTMRELKEVQDALNIELQFALRQYYAQ------------LEALSIR-----EQASKRVE
A0A139SPN4      IETTNAIITTQEHLDFAVQGAIADLHAS------------LTEVNKTI----SQLETEYT
A0A1V6E7N1      IELANKLRVAQEQLRTQVSLAIADLKSR------------LAKTADSE----RTFEQEKQ
A0A2D9MYT1      IEKRSSIEALQESLKNAENRIFDSIMNK------------AKLAKATD----VQLAGVLT
A0A258ANJ7      EAVQVVIHNQEQQLTTILDDAFHLLQSS------------WEHARELE----HRLQEQLK
A0A139TLN4      RELEANLASLKDALKRSVNNYYTSLLVK------------------------KKNVEEQH
A0A290QGD9      IDATRMLSQIDAELAKATAEAASIVEGD------------YQSALRNA----DEARSGLV
A0A1D8AS58      IEAHNSLTQTEKELGRAIDSMAATVEAD------------FQTARRND----EDARANLA
I6AQC1          IEASNALTQAQLELQKAVKIAAELVKSE------------YEAALNSN----KEARAILA
W0ITH7          IEANNALTQAQLELQKALKIAAELTKSE------------YQTAFNAD----KEARGALA
A0A1G3ZFT0      INLKRRIAMLHEEKKELLNEVKKL----------------------------PLMDQMML
A0A1Z8ZMT6      ISGTDQINLKTKILLSAMKDVLS-----------------SDLETDYW----RGFQDQID
A0A2E8MCT7      ISATDHIDLKTKILLSAMMDVLS-----------------NDLETDYW----RGFQDQID
A0A290Q2Z2      IGATDNRAKIKEQLDAQLRGYESALEIA------------YKEADARV----AELKNQLA
A0A2A2RGK2      VAIKTQIDLTKADLKRVLKDAVTLLANS------------RNRLEVQS----TEMKTARE
A0A2A2XXF7      ISVKTQIDLTKADLRRVLNDAVNLLESA------------RNRLEVQA----NETKIARE
A0A2A2R5D6      KSREAELAKIDEQINANAAGKRRALEID------------VQVTKARV----TQLEKEVG
A0A2V2DJ66      IEARKALDQVDKELAAALDSAYEKVRST------------YLTMKNNY----EMSQQRLN
R7L5A9          IEARKTLDQIEKELALAVDAAYAKVQAS------------YETARQNY----EQSQKRLA
A0A1J4XH17      IEATRAKEQTEIELKSALDSSINKVYAN------------YDHARDFL----IQSEKRLA
A0A3C1VJ32      TRVQTLIDTLDGQIIDRVAGIMVTLQSQ------------VNSKKASL----DSLVQQVE
A0A2N9NTX7      KKARESVSDLKQKIKDRVDGIMLGLQAK------------VASVRESL----DQMKKEVD
B9XK55          LRTQKLVNELNAKIDDRVKGIMVGMDAR------------VASLLAVV----KNSEDKVN
A0A4P5YMI6      IRVNSLLEKITAQVADRVDGILRGKEAD------------LAAARARD----EELTRAVE
A0A2E6T482      KGLKKVVATLEGQIDDRIKGVLAGLELR------------VKSSKAQV----EELQRDVD
A0A3C0DQZ7      KGLKKVVATLEGQIDDRIKGVLAGLELR------------VKSSKAQV----EELQRDVD
A0A1Z9CBK5      KSLKAALESLDQQIDNRIKGILAGLELR------------VQSSLAQV----XELQKAVD
A0A2D6ZI96      KSLKAALESLDQQIDNRIKGILAGLELR------------VQSSLAQV----XELQKAVD
A0A358KGZ3      KSLKAAMESLNQQIDNRIKGILAGLELR------------VNSSLAQV----RELQKSVD
A0A2E9ZQX4      KSLKAAMESLNQQIDNRIKGILAGLELR------------VNSSLAQV----RELQKSVD
A0A3D5JZU0      KSLKAAMESLNQQIDNRIKGILAGLELR------------VNSSLAQV----RELQKSVD
A0A2E6HCR0      KSLRAALQSFDSQIQNRIQGILAGLELR------------VSSSLAQV----NELQMAVD
A0A1Z8WN04      KSLRAVLSTFEGQIQNRIKGILAGLELR------------VKSSLAQV----NELQKAVD
A0A2D7L1N4      KSLRAVLSTFEGQIQNRIKGILAGLELR------------VKSSLAQV----NELQKAVD
A0A2E2R937      KSLRAVLSTFEGQIQNRIKGILAGLELR------------VKSSLAQV----NELQKAVD
A0A520QQY4      KSLRAVLSTFEGQIQNRIKGILAGLELR------------VKSSLAQV----NELQKAVD
A0A2D5MR66      KSLRAALQSFEAQIENRIQGILAGLDLR------------VKSSLAQV----KELQKAVD
A0A2E0PDQ1      KSLRAALQSFEAQIENRIQGILAGLELR------------VKSSLAQV----NELQKAVD
A0A2E2ZZP9      KSLRAALQSFEAQIENRIQGILAGLELR------------VKSSLAQV----NELQKAVD
A0A2A2RGF2      VRMQALIVKLNQQVEDRVSGIMLNLETD------------LKAQAAAL----ALTETKLE
A0A2G4I5Y6      VRMQAVIVKLSQQVDDRVNGIMLSLETD------------LKAQAAAL----ELTETKLE
A0A3M1I883      QRYMALKDTLQKQITNRLNGILEGMRAQ------------VASFKARY----DEISNQVA
A0A1V6JZ45      KRKLALVEQIDQQVEARLTGILTGLENQ------------VISLKARR----DELQKAVD
A0A520RRW5      QASNSLLLTLNDQIKKEITGVLRGLQTQ------------VNAARNQL----TELTSAVE
A0A356NPK0      QASNSLLLTLNDQIKKEITGVLRGLQTQ------------VNAARNQL----TELTSAVE
A0A2D7B5P5      QASNSLLLTLNDQIKKEITGVLRGLQTQ------------VNAARNQL----TELTSAVE
A0A3D3XGB5      QASNSLLLTLNDQIKKEITGVLRGLQTQ------------VNAARNQL----TELTSAVE
A0A2V6F8A1      KGVAAMQAHLDEEINRRINGILGGLKVR------------VDAFKANL----DTLAKSVD
A0A2V5TNH4      KAMAAVQANLDTNINQRIEGMLAGLKLK------------VDAFRLHL----DSLAGAVD
A0A2V5X5Q6      IAMAAMQANLDTNINQRINGILGGLKLK------------VDAFKLNL----DTLASAVD
A0A4P5QM05      KSLRAQREVYAKILSDQLDSIKRSLNTR------------LGIEEATL----KTFETNVD
A0A4Q3C001      ASLRQMSAVYRQNLDNALEAIRRAQATN------------LKVSEDTL----AALEQKLE
B4DB23          KALDAQMATYQKILGDQLNTIKITQANR------------LRLEKDKL----SGLQEMSK
A0A6B3L938      IEAEAVYEDLYNRFRREIDTASRTTEERDFWGLKRDEMRELDIEVRTA----QTPSARAA
A0A2V5URB2      AQVKAQLQETRSKLAQQIRSVVEGINSA------------YLAAAGKE----RALKLQMD
A0A5R8KA81      IQMQDRLKDLQRSQLENIALAAEGMENA------------YNSALATE----QKVAQGLA
A0A5B5WU87      RELEANLSSLKDALKRSVNNYYTSLLVK------------KKNIQDQH----EKTREHIR
R7DZW0          RELEANLNSLKDALKRSVNNYYTSLLVK------------KKNVQDQH----EQTREHIR
A0A2N8HID1      RELEANLNSLKDALKRSVNNYYTSLLVK------------KKNVQDQH----EQTREHIR
A0A2N8HS06      RELEANLNSLKDALKRSVNNYYTSLLVK------------KKNVQDQH----EQTREHIR
A0A3R5R2M8      AGLRDRMESTRAAANKALANYRNNLDIK------------LKELNAKR----DSLAERMA
A0A411SUQ6      VSLRDRMNSTRAAANKALSNYRSNLDLK------------LNQLINKR----NSLTERLT
A0A2N8HZF2      VSLRERMNSTRAAANKALSNYRSNLNLK------------LNQLISKR----NSLTERLT
A0A354E720      VSLKDRMNSTRAAANKALSNYRSNLDLK------------LNQLIDKR----NSLTERLT
B2UPB6          VSLRDRMNSTRAAANKALSNYRSNLDLK------------LNQLINKR----NSLTERLT
A0A2A2XXW5      IQPATQLQADTQKLRDESERALQGIFQM------------AELEKSRE----VEALRKYT
A0A2V6JLK8      KSVRAARQVYTRQLEQQVGIIRQGLERN------------LKTAQGTR----DELRKRLE
A0A2W5Z1A5      KALRAQKQVFARQLQEQVGIVRSALEKN------------LKTAEKTR----DELRARLN
A0A2V6EA09      KALRATKAVYAKQLEEQMASIRSALEKN------------LKTAQTTR----ERMDKRLA
A0A2V6GQI7      KALRATKAVYAKQLEEQMASIRSALEKN------------LKTAQTTR----ERMDKRLS
A0A3C1HEJ2      IKAQTQLAAAQSQLTNAVLKVVGAYATK------------LSAAKAEE----QELKAGLS
A0A522ULD9      KRLRAGLEELRQRLADGLAGMKKGLEAD------------YQVAKAKY----NVLEQELT
A0A1V6JU76      IQARSKIEETHRSVQGAAQQVAEILRSE------------ARLAKASE----QILAANVK
A0A1Q6UHJ9      IEARKALDQINKELASAIESAEQKVQAA------------YEAARQNY----EQSQKRLL
A0A2V2BXR0      IEARKALDQINKELASAIESAEQKVQAA------------YEAARQNY----EQSQKRLL
A0A2D8V0G3      IVAKEQIRKLTDEIQQQAGQELKILREQ------------ARFANERA----DRARVTYD
A0A348S017      IEAKERIVKLTEEIQKVAQDEIDLLREQ------------ARYQQARA----VRALDSLN
A0A3C1UUV7      IEAKERIVKLTEEIQKVAQDEIDLLREQ------------ARYQQARA----VRALDSLN
A0A350I3V2      IEAKERIVKLTEEIQKVAQDEIDLLREQ------------ARYQQARA----VRALDSLN
A0A520RGV5      IEAKERIVKLTEEIQKVAQDEIDLLREQ------------ARYQQARA----VRALDSLN
A0A3D3XF90      IEAKERIVKLTEEIQKVAQDEIDLLREQ------------ARYQQARA----VRALDSLN
A0A2D7B522      IEAKERIVKLTEEIQKVAQDEIDLLREQ------------ARYQQARA----VRALDSLN
A0A356NIC2      IEAKERIVKLTEEIQKVAQDEIDLLREQ------------ARYQQARA----VRALDSLN
A0A2U8DZK4      IVARENLSKIKTQLEAQLTGYEFTLKSK------------AEEAEARV----TELKKQLE
A0A2T6DFL8      IAAVDNRAKIKEQLDAQLRGYENSLEIA------------YKEAEARV----AELKSQLA
A0A1D8AWD4      IAAIDNSAKIQQQLDSQLRGYESSLEMA------------FKEAEARV----TELERQLA
A0A4Q1C9S2      IAAVENGAKIQQQLDSQLRGYESSLEMA------------YKEAEARV----TELERQLA
A0A178IH18      ITATDNRAKIREQLDAQLRGYENGLEIS------------CKEAEARV----AELEKQLE
A0A2T6DT99      IAAMENRAKIREQLDGQLRGYENALEIA------------YKEADARV----AELKNQLG
A0A1G3ZT33      IAAVDNRAKISEQLDALLTGYEKSLEIS------------CKEAEARV----TELESQLA
A0A3E1E2T2      ISAIDNRAKIKEQLDAQLRGYENALEIA------------YKEAEARV----TELKRQLS
B1ZMW1          IAAVDNRAKIREQLDGQLRGYESALEIA------------YQEADSRV----AELKNQLA
A0A2N8HDG3      VTLTKKMDATRSAAARSLDNLRNNQKLQ------------LQELTKKR----ENIGKRLT
A0A146GCJ0      IAASMRIANLRQSLATEATQASETLSRL------------YEAAKDSE----VKLEAALQ
A0A2T6D6H8      IAGVTRIANLKQALDSEVKQAGETLSRL------------YEASRESE----MKLETALQ
A0A3D1TI55      VKFQTTIDELRRAKEQKLVAIKEGLASR------------YDVAQRRV----ENLEQEMD
A0A3R8IT45      IEANNALAQAELELKRAVDSAAASVISE------------YETAKNAD----TEARAILE
A0A1H1MGC9      IEAVNSLAQTERELSRAIDSTAAMFEAD------------FQTAKRND----EEARANLV
A0A2A2PYE8      IEALNSFQQTERELKRAVENVSAQVESD------------FQAASRTF----KNLEEDLA
A0A2T6CN73      IEAQNSYDQIKRELDRAIASACAQVESD------------YQSALNTY----RQNQEELK
A0A3E1ET42      RGLRESINTTRKTLETAVSGFKDSLKVQ------------ISQAEQTL----AKGQELTD
A0A2A2YDW8      LAQESTVDSLFKQLQASVVSFKDSLKIK------------RETKNVEL----VELNNRLV
A0A352XLN9      LAQESTVDSLFKQLQASVVSFKDSLKIK------------RETKNVEL----VELNNRLV
A0A3D0YP62      VMRTTRIEELKKGLEKRAVNVRQSLTHK------------LGIIEGRV----NKMREVRD
A0A3D3DV47      VMRTTRIEELKKGLEKRAVNVRQSLTHQ------------LGIIEGRV----NKMREVRD
A0A2E5XJ49      RMALIAQDKLEEDLRSAVVTLKDLLRTQ------------LELVDGQL----EKLRQVVE
A0A2E6SBY8      RMALIAQDKLEEDLRAAVVTLKDLLRTQ------------LELVDGQL----ENLRKVVE
A0A2E5QMS4      EMSLIAQNKMQEDLGGAVVVLRELLKTQ------------LRLVNGQL----AKIKERVE
A0A2E7YXQ3      EMSLIAQNKMQEDLGGAVVVLRELLKTQ------------LRLVNGQL----AKIKERVE
A0A2E3H787      EMGLIAQAKIEEDLKAAVVVLRELLKTQ------------LSLVXGXL----EKIKDRVE
A0A2E7AGN1      EMALIAQEKLQEDLKASVVVLRELLKTQ------------LDLVNGQL----VKIKDRVE
A0A2E7AKY7      EMALIAQEKLQEDLKASVVVLRELLKTQ------------LDLVNGQL----VKIKDRVE
A0A3D4CU34      EMALIAQEKLQEDLKASVVVLRELLKTQ------------LDLVNGQL----VKIKDRVE
A0A2E8M146      EMAYIAQSKLQEDLKSSVVVLRELLKTQ------------LSLVNGQL----VKIKDRVE
A0A355S8S2      EMAYIAQSKLQEDLKSSVVVLRELLKTQ------------LSLVNGQL----VKIKDRVE
A0A2D6DVN8      EMAYIAQEKLSEDLKSSVVVLRELLKTQ------------LNLVNGQL----DKIKDRVE
A0A3C1W2R2      EMAYIAQEKLSEDLKSSVVVLRELLKTQ------------LNLVNGQL----DKIKDRVE
A0A2E3NAY6      EMAYIAQEKLKEDLKSSVVVLREXLXTQ------------LNLVDGQL----EKIKDRVE
A0A2E3II01      EMAYISQKKLSEDLKSSVVVLRELLKTQ------------LNLVNGQL----EKIKDRVE
A0A368B8C5      EMAYISQEKLSEDLKSSVVVLRELLKTQ------------LNLVDGQL----EKIKDRVE
A0A3R7RBB5      EMAYISQEKLSEDLKSSVVVLRELLKTQ------------LNLVDGQL----EKIKDRVE
A0A2A2QX62      VSLATNLVAMEKQLDEAVANLRETLKVK------------LELSKEQL----ARLKSRKE
A0A4Q3BWH6      VSQATTLEGMERDLTEAVANLRETLKAK------------LSLSQEQL----ARLKTRMD
A0A3N5WCF1      LVAVDQIENMKRQLDEGVVNLRATLQAQ------------LDLAVNRL----KSVEVMKD
A0A4Q3C1K5      LAAKDQIAGMKKQLDEGVVNLRATLQAQ------------LDMATDRL----KNVENLKD
A0A2G4G428      IQARAQLKQTEAELQNAIVTSVNRIQVA------------IQNAHANY----AAIISNLD
A0A139TV24      VSLTKKMDATRAAAFRSLSNLRDNLNLR------------LQELTRKR----EDITRRLA
A0A2N8HT11      VTLTKRMDATRSAASRSLDNLRNNLELK------------LQELTRKR----QDIAKRLT
R7DS70          VTLTKRMDATRSAASRSLDNLRNNLELK------------LQELTRKR----QDIAKRLT
A0A2N8HNL6      VTLTKRMDATRSAASRSLDNLRNNLELK------------LQELTRKR----QDIAKRLT
A0A6I1K459      IQAHTELNSLRQQFEDEVLKAPVRLSQQ------------LKAAQERE----RGLEQVLK
A0A139TUL1      SSLAENMKEMRESIVRSISNYCDVLRVR------------MGELERER----DELNRGLS
A0A2N8HCB0      SSLAENMKEMRESIGRSIANYCNALEVR------------MSELEKER----DELNRLLS
A0A2N8HP04      SSLAENMKEMRESIGRSIANYCNALEVR------------MGELEKER----NELNRLLS
A0A2N8HRJ0      SSLAENMKEMRESIGRSIANYCNALEVR------------MGELEKER----NELNRLLS
A0A366HAG0      RGIAGSLEQTRALLLEAAQDYRKNLGVR------------ITTVERQL----EEAEKHNK
A0A3M1I8A3      VTLRSQIAETEKELQQTVKDVIETLRKS------------AELRQIEL----ANLEENLR
A0A4V0XS84      VRLRDEVRSLRSAFERESQALGDGVRAD------------ARIAQSIE----AAFRKALA
A0A0R2XQ77      IEQLQILQESEVELVTAVKDSINKLSSA------------FAESKNNF----ELASQRLA
A0A2E9IN28      IQLLQTLQESEQELAIAVKNSVDKIYAS------------YSEAKSNF----ELASQRLA
D5ENH7          IQQLQTLQESEVELGEAVQNSVDKVYAS------------YIEAKSNF----ELASQRLA
A0A351WE84      KRLQAGVDELKKKLNESLVGLKIGLNAD------------YEVAKAKF----DALEAELQ
A0A1V5QDZ6      LRVQAGVDELRKKLENALNGMKTGLRAN------------YEVALQRY----EVLEKELE
A0A4Y8P964      SRIKAEIEGLNKEINEEKEATIEKLEAD------------YEAAKKHY----ESLEEEWK
A0A3D4HF88      ISINQSIDETQSELTAAVNSAVQKVHAA------------YVISDTNY----NHAKAEIS
A0A351MR11      RISREQLDVTKRELKTAIEMSVNRLAGL------------RSSSQQRL----IAAERSLS
A0A6G6K641      IDQVARVEAAKRELPAAAMRAAATMKEQ------------YETAKETE----SRIEKEFQ
A0A5B5WI95      VGLRERMDSTLSAANKALANYRSNQNLK------------LEELKKKR----ETLSERLT
A0A2N8I9W1      VSLRDRMNSTRAAANKALSNYRSNLNLK------------LNQLISKR----DSLTERLT
A0A4Q5IH27      VSLRDRMNSTRAAANKALSNYRSNLNLK------------LNQLISKR----DSLTERLT
A0A2N8IBZ6      VSLRDRMNSTRAAANKALSNYRSNLNLK------------LNQLISKR----DSLTERLT
A0A2N8IJW9      VSLRDRMNSTRAAANKALSHYRSNLNLK------------LNQLISKR----DSLTERLT
R6J100          VSLRDRMNSTRAAANKALSNYRSNLNLK------------LNQLISKR----DSLTERLT
A0A1V6J089      LRLRGAQDELRRQLDSALAGLKAGVKAD------------YEVARQKY----EALDSELA
A0A3C1BZR1      LRLKGAVEELRRQLASALEGLKAGIKAD------------YEVARQKY----EALDEELS
A0A1H6KPB7      LSMVQEHENTKQKLTEGLVGLKDALEQT------------LSLKEEGR----KSIKRAFD
A0A2E9ISN4      IDLKGEITKAQSSLAHQNELALKRFEAH------------YEALKLQE----AGIESVLN
B9XAX1          LQAQRQLDDLKDALRSLASKAPKLVQSA------------YDGALARE----NNLEAALK
A0A5R8KKM9      ISLGKEIETARTLLLDAANDYRNNLAFR------------ITTGERQL----AEAQKTYQ
A0A139TS01      VALQETANILKEKLNKELVGLRSSLRSK------------LEMVTASR----VKWAKIVA
A0A3E1EJT7      IEAVNALNQTEQELQASLATAAESIKAE------------YENAVQTD----EGARKALA
A0A317ZP96      IQQIQTLQEAEMELESAVKNAVDKIYAG------------YIEAQKNY----EIATKRLV
A0A2D5WGA5      KGLKKVVSTLEGQIDDRIQGVLAGLELR------------VKSSKAQV----EQLQRDVE
A0A2E7SSH2      KSLKAALDSLNQQIDNRISGILAGLELR------------VNSSLAQV----QELQKSVD
A0A349GXM8      KAVRDEIKSIQDQLASMAEVQMRNLRDR------------HRALSIQL----NAIETAEY
A0A4P5YP61      MGTLSALTEWRNALTNAVMKIPQTIEIS------------YRGAKSSE----ETFEAALK
A0A6B2LYM4      IAAQEQLDQTQSELDKAVNTAASRFEKD------------FERTEANL----RNSEDRLA
A0A6D1VXB3      SRLRTEIEGLNKEISEEKEATIEKLEAD------------YEAAKRHY----ESLEEEWK
I0JYY7          SRLRTEIEGLNKEISEEKEATIEKLEAD------------YEAAKRHY----ESLEEEWK
A0A4R7S1J2      TAAQSDIANLEARFREALPQVSVSLEAS------------LLASLESAKVNEKKLQEALA
A0A2A2XV69      KSMRAKKEVMATQLVTQIASLRASMEAN------------IRIGEDSI----TQLEQRLR
A0A651H7X9      IEARNSIQQTRTELNQAVEQAAARVHSE------------FQTAERSV----AEARAALS
A0A4Y8P842      VRLKAGIEGLNQQLTDEKQAVVEKLEAE------------YEAAKKNF----ESLEEEWK
B3DZK9          VRLKAGIDGLNQQLAEEKQAVVEKLEAE------------YEAAKKNF----ESLEEEWK
A0A5E6MPC4      VQVHAEIQGLQDELNQEKEASVADLDAE------------YEAAKRNY----AGIEQEFQ
A0A4V1SB02      GEAQAQLSEAKSKLRTAVANAGDALRQQ------------YRSLTETE----EKLTEQLK
A0A3C1VB86      ILAASSLAGLKGQLAANALKARARIQES------------LRIAYQNVLTAKQGLETQMH
A0A146G2Q9      KALRAKKEVMQRQLAEQTAILRKTLETN------------LAIAEQGL----KSLQDKLD
A0A2T6D3Y2      KSLRAKKEVMQRQLAEQTAILRKTLETN------------LTIAEQGL----TSLQEKLT
A0A2V2SDV4      VTVQSQLDDLNAKIAAKATGILQGVQTR------------VAAVKDSL----AKLEHEVD
A0A2V5PK75      IKLQRQLDDLQDKIAKRVEGIITSLEAR------------VAAVQTNL----ALLQAQVD
A0A1V6DME1      VTVTRQIKDIETKIAQRADGIIRGLEKR------------VASMKAYL----DSLTRNVE
A0A3D3DIJ3      LKCKGLAEDLHKKIKSRVEGIMLGLDTR------------VISLSNSL----VNLQQEVG
A0A2D5VY59      KSLYTLLEEIETQVTSEITGVLRGLQSQ------------VNAAQNEL----NELTAAVE
A0A2D8UZZ4      KSLYTLLEEIETQVTSEITGVLRGLQSQ------------VNAAQNEL----NELTAAVE
A0A353DV86      KSLYTLLEEIETQVTSEITGVLRGLQSQ------------VNAAQNEL----NELTAAVE
A0A2E5EPT8      ERMTKVILEIQLQIEGRVKGIMSGLEAE------------AKALQSGY----DNRMTQLD
A0A6I1K583      ARMKDVIAKIETQIEARVVGLMKGLETD------------LLADKATL----AERTQKLE
A0A350EWA4      MSAQAELDKARETIKSRVEAMLIGQKND------------ALALSNNL----VELERTIA
A0A5B5WZ91      VALQETANILKEKLSKELVGLRSSLKSK------------LEMVAASR----MKWEKIVA
A0A2N8HD92      LALVETERILSDKLNKELIGLRSSLKSK------------LEMVSASR----KHWEETVA
A0A2N8HIT2      LALLETERILGEKLNKELIGLRSSLKSK------------LEMVSASR----KHWEATVA
A0A354EBD3      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A355VEB2      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A2N8IMT3      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
R6K1U5          LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A2N8IWC2      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A2N8I441      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A2N8I3A6      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A410SCC4      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A3R5VEW0      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A411SSG2      LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
B2UKW3          LALLETERILGDKLNKELIGLRSSLKSK------------LEMVAASR----KHWEATVA
A0A1M6RLZ4      KMSRTRVEALRKQLDEKVTEVRDVLKDK------------LDLENQRV----QRLSKSKD
A0A354T7G8      ESLSSQIDKLKTFIEAEARAHVQGLQNR------------LDGAKRKR----DSFQTYND
A0A2S7U4L6      KHHDSQISILRETLDAKVRRVRDLLKVL------------LEQAGAKI----ARLQISKD
A0A512MBZ2      QTADKQLAKSKELILAETQSYIEGLKNR------------FDAAKMRR----ETLQTYSK
A0A2E8MEZ0      KAMRLRADGALENAGKEVMSLKEVLETR------------LNLVDKQV----EKMKQMVR
A0A4Q2YKS3      LELSGRVANMKKQLDEGVVNLRDVLRAR------------LEMATAQL----AQVEILKG
A0A6B3LBV6      RAIRTQLDSLRGLLMEAVSDVRGALEIQ------------ITQLEKRL----AEAEESED
A0A2E3EC33      INIDSQLALRMKQLLDAVDVHKKALETQ------------LSMAEQQF----QNSKETKE
A0A2E4GN01      LNIDKQLKLRMMQLLDAVEVHKKALQTQ------------LSMAEQQF----QNSKETKE
A0A1Z8XU55      LNIDSQLNLRMKQLLGAVETHKKALSTQ------------LTMAEQQF----ENSRESKE
A0A2E1RQR9      LNXXSQLNLRMKQLLGAVETHKKALSTQ------------LTMAEQQF----ENSRESKE
A0A2E3ISQ4      VNIDSQLKLRMNQLLDAVETHKKALTTQ------------LSMAEQQY----ENSKESKE
A0A2D6W6F4      VNIDSQLNLRMNQLLDAVETHKKALTTQ------------LAMAEQQY----ENSKESKE
A0A2D8Z5A8      VNIDSQLNLRMNQLLDAVETHKKALTTQ------------LAMAEQQY----ENSKESKE
                                                                            

A0A2A2XVF1      E-QEVAALDLNKMAIPFNV--LQREVESDRVLYESVIKRMKETAVTGAVDQAP-YTL--I
A0A2V5UHJ2      D-QKKATLNLKDSAVQYAI--LAREVDTNKQLYDGVLQRLKEIGVAAEVRTSN-IYV--M
A0A2V5PST3      K-QQQAALNLKEVGVQYAV--LQEEVNVNKNLYDSILKRLNETTISNDIAVSN-MQI--T
A0A2V5PXM3      E-QESAALELSSQALHYSS--LSREVDSDRALYEAVLNRIKETALTKEIKPGK-VRV--I
A0A139SU05      E-NEKEALSLRNMRVDFES--LQNEAAVARANYMQILDRLNQTTTTKYLEKVP-IRL--L
A0A1D8AZK8      E-AEMGQLRLGELSVEFKS--LENQATVAKNNYIEILNRLNQVTTSKNLENIP-VKP--L
A0A1V5QB01      QEWEEEALEVSRKQQEYQN--IQRNFGRLQSLYDLAFNRLKEIDISVGIEPES-VQI--M
A0A139SPN4      A-AEQEALNLRNMRVDFES--LQNEALVARSNYMQILDRLNQTTTTKYLEKVP-IRL--L
A0A1V6E7N1      L-QETEFFKLRDLRGEYNS--LKNQADVAQKNYIDILDRLNQTTTTKSLEKLP-LQP--L
A0A2D9MYT1      I-RKSEQQSMNQKSIEYNN--LSRTATQSETMYNLALQRXKETELQEKDIVQN-MHV--I
A0A258ANJ7      K-QESEALDLEQLAVQYNV--LKREMESDQAVYESVLTRIKQVDVSKGMETPP-IWV--H
A0A139TLN4      EGTRAHIRAVSGKERAVNQ--IAREQRVRESLYIFLLNKREENSLALAATEDN-ARI--V
A0A290QGD9      E-QETQSLGIDRAGVEYES--LDRELKIEEQVLQHLMGRMRETTMSSTLDTQN-ARV--I
A0A1D8AS58      R-QEKESLDLDRDAVEYSN--LERDLAINEHLLNTLLSRMRETSMSSTIETQS-ARV--V
I6AQC1          Q-IEKESFEIDKAAVDYQM--IERDFLVNSSILDNTIKRIRELDITSTIEGQN-IQISPI
W0ITH7          Q-IERDSLNMDKIGVDYQM--LEQDFLINREILDRTIGRIREIDLTSTIEGQN-VQIRPI
A0A1G3ZFT0      N--------------------LLRDVKMKNALNTILLSKIQEMKIIQAGLLSD-VRI--L
A0A1Z8ZMT6      DIENEENFKDLRNAMKLRASLLTNSVETKNELYNTLLSRVGVLKTDAEGVE---AEV--I
A0A2E8MCT7      DIKNEENFRELRNAMKLRASLLTNSVETKNELYNTLLSRVGVLKTDAEGVE---AEV--I
A0A290Q2Z2      QAKVDQILSARDRMRPFEE--AARKLEDETRLLSTLKVTLRQREIDFQVPKRS-IEI--L
A0A2A2RGK2      A-AEKRLLEVTHKSIEYND--IKREQETDQALYNSVISRLKEVDVSKQLTESP-VRI--H
A0A2A2XXF7      K-AEGRLIEVTAKSIEYND--IKREQETDQALYNSVLSRLKEVDITKQLTESP-VRI--H
A0A2A2R5D6      VLTDQVRMQKTTELAKFRE--AKKEQDRQQLLYDQFVIRKKQSVVDKQITNDP-ATI--I
A0A2V2DJ66      K-KREEILQLGRKAIVYKA--LERERKVAEGMHAEFIAAMNVRLAQVSLITDT-AKV--I
R7L5A9          E-KKEEILSLGKKAIIYKS--LERERMVAEGMHASLISAMNVRTAQVSLINEG-ASI--I
A0A1J4XH17      Q-KEKGIINLSKIKVEYST--LSRDFEVNQGLYQSMVLRLNTEMAQIDLKKPS-ARI--I
A0A3C1VJ32      E-AKQKDHDNATKNQPYYD--EKRKLDQLLDSHKLLYTKIVIDTIDAQIPKTTMVEV--I
A0A2N9NTX7      E-ATKTDISKASESAPYWK--AKRELEEQEHFRAILDLKIISEKVDLSLPKTTMVEI--V
B9XK55          E-AKSNDLVLAESSRPYFI--EKSQLDHLKKFREILEFRAAQEQVDRALPKTTMVQI--V
A0A4P5YMI6      E-AKVKNREAAEKMRDYLT--AVRDVEQLERMRDSLKFKIQQEDIDMDMPKTSMVEI--T
A0A2E6T482      E-AKQRESDMREKGREYFD--AKRELANTTRIRDTILLRIMQEEVDLELPTESTVEI--I
A0A3C0DQZ7      E-AKQRESDMREKGREYFD--AKRELANTTRIRDTILLRIMQEEVDLELPTESTVEI--I
A0A1Z9CBK5      D-AKAKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A2D6ZI96      D-AKAKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A358KGZ3      D-AKAKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI--I
A0A2E9ZQX4      D-AKAKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI--I
A0A3D5JZU0      D-AKAKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI--I
A0A2E6HCR0      D-AKSKEAKVQEEGREYFD--AKRRLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A1Z8WN04      S-AKSKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A2D7L1N4      S-AKSKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A2E2R937      S-AKSKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A520QQY4      S-AKSKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A2D5MR66      N-AKSKEAKIQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A2E0PDQ1      N-AKTKEAKIQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A2E2ZZP9      N-AKTKEAKIQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--I
A0A2A2RGF2      E-AKVRNRTAAEKNRTYQM--ALTDLEDLKRLRATMNAKIIVEESDVAMSRSNSVRV--T
A0A2G4I5Y6      E-AKVRNRTAAEKNRTYQM--ARDDLDDLKRLRATMNAKIIVEESDIDMSRSNAVRV--T
A0A3M1I883      Q-AERAVAEEAARFSQYFD--LKRQWENEQRIRDTLLLRTLQETIDSALPTESVVEV--T
A0A1V6JZ45      D-GKKLVVEEAKRSREYWS--SKRELENKQKIRDAILMRMLQEEVDAELPKESMVRI--V
A0A520RRW5      S-AKASDAEKTAEYRPYFT--AKRDLENLSKISDMIMIRILQETVDAALPTDSIVEI--Y
A0A356NPK0      S-AKASDAEKTAEYRPYFT--AKRDLENLSKISDMIMIRILQETVDAALPTDSIVEI--Y
A0A2D7B5P5      S-AKASDAEKTAEYRPYFT--AKRDLENLSKISDMIMIRILQETVDAALPTDSIVEI--Y
A0A3D3XGB5      S-AKASDAEKTAEYRPYFT--AKRDLENLSKISDMIMIRILQETVDAALPTDSIVEI--Y
A0A2V6F8A1      D-ARKKDADMTEKYRPYFE--AKRRLDNLQKLRDAVHLRVLQETVDAALPKTSIVEI--T
A0A2V5TNH4      H-ARTNDAFMTEQYRPYFK--AKRRLDDLTKLRDAVHLRILQETVDAALPKTSIVEI--T
A0A2V5X5Q6      H-ARTNDAFMTEQYRPYFK--AKRKLDDLQKLRDAVHLRILQETVDAALPKTSIVEI--T
A0A4P5QM05      K-THKVQIDEKTRMSRYVE--KKSAYLMTKTLLFEIRRQYDKAKMNNILTQIP-VKI--W
A0A4Q3C001      Q-TRSAQIIDKNSSSRYTE--AKTKYLNAKKILEAAELRYSTARMERGVDIDP-ARI--K
B4DB23          A-SRTDDIKEKASLVEYVD--AKNKYIQARKLYESVELSYVTQKMNNSVKGDS-AKI--W
A0A6B3L938      AKDRWLSLVQSSLSARASI--LESRILNQRRLYETVTNRLTEIDVADETSNAE-VTV--F
A0A2V5URB2      K-QKSDALALKDASVEYAI--LARETNTNSQLYDGVLERFKEINVAGEIPASN-ISI--L
A0A5R8KA81      E-QERLALDLGKIAIEYNA--LARDVESNQALYASVQKRLKETDITRTIEFAP-WRV--V
A0A5B5WU87      N--------VSSRERDVNY--IDREQRVRESLYVFLLNKREENSLALAATEDN-ARM--V
R7DZW0          N--------VSSRERAVNH--IEREQRVRESLYVLLLNKREENSLALAATEDN-ARM--V
A0A2N8HID1      N--------VSSRERAVNH--IEREQRVRESLYVLLLNKREENSLALAATEDN-ARM--V
A0A2N8HS06      N--------VSSRERAVNH--IEREQRVRESLYVLLLNKREENSLALAATEDN-ARM--V
A0A3R5R2M8      R--------TATREQELTP--LVREHKVKEELYLILLSKEQENAMALAATEAS-ARV--L
A0A411SUQ6      E--------TAIKEQEIIP--LIREHKVKEELYLMLLSKEQENALAMAVTESN-ARV--L
A0A2N8HZF2      E--------TAIREQEIIP--LVREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--L
A0A354E720      E--------TAIKEQEIIP--LIREHKVKEELYLMLLSKEQENALAMAVTESN-ARV--L
B2UPB6          E--------TAIKEQEIIP--LIREHKVKEELYLMLLSKEQENALAMAVTESN-ARV--L
A0A2A2XXW5      E-SVERVFALDEAKISYDI--MEQQLKRVEGFYQTILTKAKDFDIGAKDLLQN-MKV--Q
A0A2V6JLK8      Q-INAKQLQTKNLSANYAR--AKNAYIKEKTLFDGVRTRAQTQTMEMAMPRFA-VSV--K
A0A2W5Z1A5      E-INEKQLSTKNLSANYTR--AKNNYIKEKLLLDSVRQRAQTQTMEMAMPRVA-VSV--K
A0A2V6EA09      E-INTRQLATKTLSANYVR--AKNAYIKERLLLDGIRMRAQTQTMELAMPRIA-VSV--K
A0A2V6GQI7      E-INTRQLATKTLSANYVR--AKNAYIKERLLLDGIRMRAQTQTMELAMPRIA-VSV--K
A0A3C1HEJ2      G-LESRRRDLDAAAGEYGI--IQNKLKFNRELYERIVKERQVTKVVQTLNKDP-VAI--E
A0A522ULD9      TVKKTDIDAEREKYLPYNK--AERKLDTERAVLNALKARLAQQGIELQIPRTP-VEV--I
A0A1V6JU76      E-WEDQQMEWNKAKMQYDV--LMRKAQSSKALFDTVLAKMKEIELVQRDKGNN-IRV--I
A0A1Q6UHJ9      E-KKEQILDLGRKAIVYKS--IEREKQVAEGMHAAFIASMNVRLAQVNLINEG-ANI--I
A0A2V2BXR0      E-KKEQILDLGRKAIVYKS--IEREKQVAEGMHAAFIASMNVRLAQVNLINEG-ANI--I
A0A2D8V0G3      E-AQVAMNRLNELKVEYDN--LVMEKEQSEQLYTAMLAKTKEMDLNTKDMMQN-LEV--V
A0A348S017      A-RQADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--V
A0A3C1UUV7      A-RQADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--V
A0A350I3V2      A-RQADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--V
A0A520RGV5      A-RQADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--V
A0A3D3XF90      A-RQADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--V
A0A2D7B522      A-RQADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--V
A0A356NIC2      A-RQADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--V
A0A2U8DZK4      EAKASQIENASKRMRPFEE--AMQKLDEATRLYTTFKLTLRQREIDYNQPKRP-VEI--L
A0A2T6DFL8      QAKVDQILSARDRMRPFEE--AAQKLEDETRLLTTLKLTLRQREIDFQVPKKT-IEI--L
A0A1D8AWD4      QAKVDQILSARERMRPFEE--ATGKLDDEQRLLTTLKLTLRQREIDFQVPKKT-IEI--L
A0A4Q1C9S2      QAKVDQILSARERMRPFEE--ATTKLEDEQRLLTTLKLTLRQREIDFQVPKKT-IEI--L
A0A178IH18      EARARQITSSTDRMRPFEE--AVRKLDDETRLLSTVKLVLRQREIDYQVPKRT-IEI--L
A0A2T6DT99      QAKVDQILSARERMRPFEE--ALQKLEDDTRLLSTTKLTLRQREIDFQVPKRT-IEI--L
A0A1G3ZT33      QARVDQILSARERMRPFEE--AATRLDDEARLLTTLKLTLRQREIDFQVPKRT-IEI--L
A0A3E1E2T2      QAKVDQILSARDRMRPFEE--AAQKLEDETKLLTTLKLTLRQREIDFQVPKRT-IEI--L
B1ZMW1          QAKVAQILSARERMRPFEE--AAQKLEDETRLLTTLKLTLRQREIDFQVPKRT-IEI--L
A0A2N8HDG3      A--------TSGKARELTP--LDREHRVKEELYLTLLSKELENDLTLALTESS-ARV--L
A0A146GCJ0      E-QEAKALELNKVAIPYNV--LQRDVESDRALYESVTKRLKETAITQGIEQAP-YRV--I
A0A2T6D6H8      E-QEERALELDKVAIPYNV--LQRDVESDRALYESVTKRLKETAITQGVEQPP-FRI--I
A0A3D1TI55      LLRNQDLERHREAFLPFER--ALRDRDAAKQVLTALEHRVAQEVIELEIPSTP-VEV--V
A0A3R8IT45      Q-IKTESLSTDKEGVAYQM--LERDFMMNEQLFLKTVERIKETELTNTIEAQN-VQVMPL
A0A1H1MGC9      R-QESESLELDRYAVEYSN--LVRDYDINEHLLNSILGRMRETSMSSTIETQS-ARV--V
A0A2A2PYE8      K-RTEDSLQLDRAALEYND--REREYRTNEKILDAIVARSRETSMTSGITTQN-ARI--V
A0A2T6CN73      R-RTQDSLAVDHAALDYEN--MQRELKIQEDILTTITARRTETSMSSNIATQN-ARI--I
A0A3E1ET42      T-KKLSTVEDRAKQSEYAT--EKTKFEMQRQLLQQVKEHSMKTAVDKEVPRKP-IEV--L
A0A2A2YDW8      E-VKDMSKENIIAMTQIQN--VHDEFTTQQKLLDEMKQKLTTDRINLRQPQNI-IQL--H
A0A352XLN9      E-VKDMSKENIIAMTQIQN--VHDEFTTQQKLLDEMKQKLTTDRINLRQPQNI-IQL--H
A0A3D0YP62      K-KQDEGTDRARAFQEFNI--ARKDYETAQGIKDQMQIKYDIEKTKLAIPPTN-III--H
A0A3D3DV47      K-KQDEGTDRARAFQEFNI--ARKDYETAQGIKDQMQIKYDIEKTKLAIPPTN-III--H
A0A2E5XJ49      E-SRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKITNSARRIALKIPKNP-ITI--L
A0A2E6SBY8      E-SRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKITNSARRIALKIPKNP-ITI--L
A0A2E5QMS4      E-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKNP-ITI--L
A0A2E7YXQ3      E-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKNP-ITI--L
A0A2E3H787      D-RRFDAVXKAXQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKNP-ITI--L
A0A2E7AGN1      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITL--L
A0A2E7AKY7      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITL--L
A0A3D4CU34      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITL--L
A0A2E8M146      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--L
A0A355S8S2      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--L
A0A2D6DVN8      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--L
A0A3C1W2R2      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--L
A0A2E3NAY6      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--L
A0A2E3II01      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--L
A0A368B8C5      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--L
A0A3R7RBB5      D-RRFDAVDKALQSQDYVE--AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--L
A0A2A2QX62      S-TNEDAIGKGIANQTFID--AKNEFESALRLLETLQAKEIVERMQDKVTDDP-III--H
A0A4Q3BWH6      T-KEDDAVKQGIANQTFVD--AKNDFETAQRLLEQLKVKLISEEMQTKITEDP-IIM--H
A0A3N5WCF1      E-SRDEAIKRGLDAQDYVD--AKREFETDQQLLETMKLKQMGETISRKIPGES-VEV--H
A0A4Q3C1K5      D-TREDAIKRGLDNQDYVD--AKRDFETDQELLQQMRLKQIDRNIREKMTNDS-IVM--H
A0A2G4G428      K-KDDEIARLTVANNELER--VDKEIKSQEDFLSRQKQSFEEAKIRSSTTGTT-TSI--K
A0A139TV24      A--------TSGKARKLTP--LNREHGVKEEYYLTLLTKEQENELALETTPSS-ARV--L
A0A2N8HT11      A--------TSGKARELTP--LDREHRVKEELYLTLLSKELENDLTLALTESS-ARV--L
R7DS70          A--------TSGKARELTP--LDREHRVKEELYLTLLSKELENDLTLALTESS-ARV--L
A0A2N8HNL6      A--------TSGKARELTP--LDREHRVKEELYLTLLSKELENDLTLALTESS-ARV--L
A0A6I1K459      E-QEKKLNQMQSQRFELDR--LQGDLSSQRKLYDAVIQRLREIDLTGGMKKND-VRI--I
A0A139TUL1      D--------MASKDEGLVP--LLREQKVMEELYLMLLKKREENALALATTEPS-ARI--L
A0A2N8HCB0      D--------MASKDEGLVP--LLREQKVMEELYLMLLKKREENALALATTEPS-ARI--L
A0A2N8HP04      D--------MASKDEGLVP--LLREQKVMEELYLMLLKKREENALALATTEPS-ARI--L
A0A2N8HRJ0      D--------MASKDEGLVP--LLREQKVMEELYLMLLKKREENALALATTEPS-ARI--L
A0A366HAG0      D-TRAKSLDSQAGHHEYLA--AKREWETLQQDTAKLKDTKAQKEIERDGSKTP-ITV--Y
A0A3M1I8A3      Y-WEQKQQEWNKAKTTYDV--LQRKADASRALFNMVLSRLSEAEVMQRDTANN-INI--V
A0A4V0XS84      E-QEQKLLTMNKLKIQHDS--LNRELQQSKLLYEKITSRLKEIEVTGNIKDKN-FTV--V
A0A0R2XQ77      E-KEAELIELSKTRVEYSS--LEREMDVQQGFLQALVGRMTQERAAVNLKNPN-SRV--I
A0A2E9IN28      E-KEQELIDLSKTRIEYNS--LLRDLSVQQNFFQALNSRMTTEKAQVNLKNPN-ARI--V
D5ENH7          E-KESELIGLSKVRVEYNS--LLRELEVQQSFFQALNSRMTQEQAQVSLKEAS-ARI--V
A0A351WE84      AAKHSDIEDEKKKFLPFDR--AERNVIIQRDILNALRARITQQGIEVEVPRTP-VEV--V
A0A1V5QDZ6      ATRASDIDSERDRFLPFDK--AEREVLVQRQILDALRARIAQEGIAVEVPRTP-VEI--V
A0A4Y8P964      E-AMVKVKKEGRLLSQYAL--LKREADTDREMYTSLLKRLKETDITSALNSGN-IEV--V
A0A3D4HF88      R-KEKDLIGLAKTKVEFNA--IKTDLEANRDLHRAMVLRLNTEIAQVNLKNPT-ARI--V
A0A351MR11      G-KEAEIARLQGANIELER--IEKEIRLGEDFLNRLKLSYEDAKLRTSTTGTS-TSV--R
A0A6G6K641      D-QEKDTYTLGKTQVEYDG--LKRDVEQDIAVFNGVLSSLKQSDVSKGFETDS-VEI--V
A0A5B5WI95      K--------TATKEQEFTP--LIREHKVKEELYLNLLSKEQENAMALAAAESS-ARV--L
A0A2N8I9W1      E--------TASREQEIIP--LIREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--L
A0A4Q5IH27      E--------TASREQEIIP--LIREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--L
A0A2N8IBZ6      E--------TASREQEIIP--LVREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--L
A0A2N8IJW9      E--------TASREQEIIP--LVREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--L
R6J100          E--------TASREQEIIP--LVREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--L
A0A1V6J089      SIKATDIESESENYLPFDR--AERNVAVNRDILTALRARITQTGIEVEVPRTT-VDI--V
A0A3C1BZR1      LIKTSDIESEGENYLPFDR--AERNVSVNRDILTALRARITQTGIEVEVPRTA-VEI--I
A0A1H6KPB7      E-VTEIVRNKTQSDILVMS--AIRDYRTEKSRYEDLENEYINQTMNRRASRPI-IQI--H
A0A2E9ISN4      N-WRSEQFLSVANQSEYKQ--LSSKVAHFERKYNLVYGRLLENTGTTEP-----FFL--R
B9XAX1          E-VQMESLDLDRKGIEYNV--LMREVQSDLALYDSVLKRLKETDLSKGLEKAS-IAV--V
A0A5R8KKM9      E-QRSKSLEADTNNQEYLH--AKEEWEGLNRDLWKLRDTLAQQQIERDIPATP-FTI--H
A0A139TS01      Q-KEEDLRKHVMKMPVYEQ--TSREYDTALDQLKTLDARYKDEIARLRVPRES-VEM--Y
A0A3E1EJT7      D-QETKSLEIDKYAVEYDN--LNRDFRVNEQLLESMMSRMRETSVTSSIETES-ARI--I
A0A317ZP96      E-KEKELIELSRTRVEYNS--LLRDLEVEQNFYQALNSRMTTEKAQVNLKNPN-ARI--V
A0A2D5WGA5      E-AKRRESDVREKGREYFD--AKRELANTTRIRDTILFRIMQEEVDLALPKSSTVQI--I
A0A2E7SSH2      D-AKAKEAKVQEEGREYFD--AKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI--I
A0A349GXM8      K-WQAKNLTASQRQAEYSR--LRSEVGRLAAHYNTLYTRLHDMRVSEELKSEH-FVP--E
A0A4P5YP61      E-QEALELVLNKQKLEFDT--LSREVESDRGLYENVMKKMKESQISKELQSDK-LRV--I
A0A6B2LYM4      L-NQQKLIELDRIRPEYNA--LARDLAISQELYNHYYNRLQQAAVKVTTEGQT-ARI--I
A0A6D1VXB3      E-AMVKVKKEGRLLSQYAL--LKREADTDREMYTGLLKRLKETDITSALNSGN-IEV--I
I0JYY7          E-AMVKVKKEGRLLSQYAL--LKREADTDREMYTGLLKRLKETDITSALNSGN-IEV--I
A0A4R7S1J2      E-QEKKSFELDALSIEYNV--RKREMESDKAVYESVISRLKEVDLTKGMDQSK-LKL--H
A0A2A2XV69      E-SQAKQQTSKTRASGYYE--AKNNYIQAKKILEAAEMRLSTETMQRTMPQDP-TVI--W
A0A651H7X9      N-QESEALNLGRLAVSYDS--LANEAQVNELIYQSIVARMRETTMTSTLESGN-ARV--V
A0A4Y8P842      R-TLSKLRDENTLLAKYAM--LKREADANQQMYMGLLKRLKETDITSALNSGN-IEV--V
B3DZK9          K-TLLKLKDENSLLAKYAM--LKREADANQQMYMGLLKRLKETDITSALNSGN-IEV--V
A0A5E6MPC4      K-AMEKVRGETKALSRYTI--LKREADTDREMYVGVLKRMRETDITSAINASN-VEV--L
A0A4V1SB02      K-AEADALDFDKIAYPYNA--LKRDAETNRSLHDSIMTRMKEIDITSTLAKSP-YKV--I
A0A3C1VB86      E-VETNAMKLSDSAVRFNV--LTRELRSDQALFDSVIGRLGETSVAGQITAER-IRV--I
A0A146G2Q9      K-VRSDWQTSKTSSIGYYE--AKNNWLQARKVLEAAQTRLATEKMEQTIPQSP-TTI--W
A0A2T6D3Y2      K-VRADWQTSKTSSIGYYE--AKNNWLQARKVLEAAQTRLATEKMEQTIPQSP-TTI--W
A0A2V2SDV4      Q-AMTNDLVKAVQSQPYFE--AKRKVEEAETKLKLLTMKIYTEKLDNELPKTA-MAF--I
A0A2V5PK75      K-ATANDIGNSKRWRPYFD--KKRELDEQQRFRQILTMKIASEKIDQKLPKTL-MVE--I
A0A1V6DME1      E-AMRVDIEKAEKSRPYFE--AKQRLEEVMRFRSILNLKLAQERIDVDLPRTA-MVE--I
A0A3D3DIJ3      R-ATTNDVTQANLTRPYFE--AKRALEELQRFRQVLDAKIAFEKIDVELPKTL-MVE--V
A0A2D5VY59      N-AKANDALKTAKYRPYFT--AKRDLENLSKISDMIMIRILQETVDASLPTES-IVE--I
A0A2D8UZZ4      N-AKANDALKTAKYRPYFT--AKRDLENLSKISDMIMIRILQETVDASLPTES-IVE--I
A0A353DV86      N-AKANDALKTAKYRPYFT--AKRDLENLSKISDMIMIRILQETVDASLPTES-IVE--I
A0A2E5EPT8      K-AREQNRTAAENGQRYMD--VQKKLERLERIRDTIELKIESEEIDADIGRTA-AVE--V
A0A6I1K583      E-VKKQSREIAESRRVYQL--AGQELERQQRLRETVENKIKVEELDRDIKRTT-AVR--V
A0A350EWA4      A-KEAEFRQKSSNIMPYIS--AKEEYLRRRNVRDSVAMKIAQEKINYALNSTF-IVG--V
A0A5B5WZ91      Q-KEEDLRHHVMKMPVYEQ--TSREYDTALDQLKTLDARYKDEIARLRVPRES-IEM--Y
A0A2N8HD92      L-KEKALQDHVLKVPMYEQ--ASRDYDAALDQLKDLSSRYTDEIARLRVPRDA-VEM--Y
A0A2N8HIT2      Q-KEEALQKHVLQVPMYEQ--ASRDYDAALDQLKDLDSRYKDEIARLRVPREA-IEM--Y
A0A354EBD3      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
A0A355VEB2      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
A0A2N8IMT3      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
R6K1U5          Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
A0A2N8IWC2      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREV-IEM--Y
A0A2N8I441      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREV-IEM--Y
A0A2N8I3A6      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
A0A410SCC4      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
A0A3R5VEW0      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
A0A411SSG2      Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
B2UKW3          Q-KEEDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--Y
A0A1M6RLZ4      S-AKGERLATAYDYTLFNA--LVQEYEQARAVLSQIKINLTNELLKDNLMVDP-IRF--S
A0A354T7G8      D-AKKELQDMQSLYNEYKT--AKDEVTYLEDLLVKMRSRFFEEKAGIELVKSP-ATI--Y
A0A2S7U4L6      A-SQSDAKNTAEDYTRFQS--YQDEYKDSVNNLNTLRTSNVIEELQENMSIEP-IEF--Y
A0A512MBZ2      E-ADKEQISKGATYNDYKI--AMDDVTYIEALLLKFRESYSENNASLQLVKSP-ATI--Y
A0A2E8MEZ0      E-KKDGTVDLSMRQHQYNS--AKEEYEQSRMMYREMSVKQQQQRVLLKMPRTP-ITL--H
A0A4Q2YKS3      E-KKGEAVRQGIDTQDYVD--AKREFETDLELLQTMKLKYITEKASGKLNGES-IAV--H
A0A6B3LBV6      E-KVEEYIAGALDNAEYEH--YREEYRTEKELLKALTMSTYTKKIEENKALRP-VSV--L
A0A2E3EC33      R-TEKASLKERKDNVRYIE--AKKEYELCKEMLNGMQSQLAKEKIDAAGQRTP-MVI--H
A0A2E4GN01      R-TEKASLKERKDNVRYIE--AKKEYELSKEMLNGMQSQLAKEKIDAAGQRTP-MVI--H
A0A1Z8XU55      R-TEKMSLQERKQNVRYIE--AKKEYELSKEMLNGMQSQLAKETIDKEGQRTP-LVI--H
A0A2E1RQR9      R-TEKMSLQERKQNVRYIE--AKKEYELSKEMLNGMXSQLAKETIDKEGQRTP-LVI--H
A0A2E3ISQ4      R-TEKMSLQERKQNVQYIE--AKKEYELSKEMLNGMQSQLAKETIDSAGQRTP-LVI--H
A0A2D6W6F4      R-TEKMSLQERKQNVRYIE--AKKEYELSKEMLNGMQSQLAKETIDSAGQRTP-LVI--H
A0A2D8Z5A8      R-TEKMSLQERKQNVRYIE--AKKEYELSKEMLNGMQSQLAKETIDSAGQRTP-LVI--H
                                                                            

A0A2A2XVF1      EEPLVASL--PSKPNRTRTLAMALIMAFFFAIGAVIFFDSLNSSLRSVDEAESFLHLPAL
A0A2V5UHJ2      GKALPPGS--PSYPDKRRSMLLGVLLGLAAGIGLAFFLEQLDNTLKSPEEAERYLRLPSL
A0A2V5PST3      QSAERPEF--PNSPNIPIDLTMYAAMGLFIGAGLAFFLEYLNSRLETPEHVWRAVDLSTF
A0A2V5PXM3      QHAEVPEL--PAKPEKLRVILLGLLAGLGSGLLLALFLNSLDRSLKTVDQTEEYLGIPVL
A0A139SU05      DRAQVSGR--PYTPNFPKIVRMCVMMFCVVFFGTAFGLDFIDDRIKSAWDIENFLGTSLL
A0A1D8AZK8      DRALPAGA--PFTPNIRSIIKTSIGLGLLVFAAVAIGLSFIDDRVKSAWDIEGFIGAHLL
A0A1V5QB01      ERARPASS--PVTPRKLQSIFIAALIGLGVGLGLVFGLEYIDDSLRYPEEVTDLLGLPFF
A0A139SPN4      DRAQVASH--PYTPNFPKIIRVCVMMFLVVFFGTAFGLDFIDDRIKSAWDIENFLNTSLL
A0A1V6E7N1      DRAVPAGA--PFTPDLARIIRTSSLLFVALFLAVAIGLNFIDDRIKSTWDVEHYIGTTLL
A0A2D9MYT1      DLATAQMH--AIKPKKLLTAFLGIIGGLGAGFGLAFFVNFLDDSIKSQEDIETYLKLPFL
A0A258ANJ7      QLAMVPGD--PVSPNAKKVVGSSTAGGFMLGLAIIGLIVIQDRSIRSVDDARQKLRVPVL
A0A139TLN4      DAVRGGDG--PLAPNVPKILLVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESLTDIPVY
A0A290QGD9      DRAFPSQPEQYVKPVILLNLGLGLVGGLGLGLAVAIFVAFIDDRVKSSFDIEGQMGLHLL
A0A1D8AS58      DRASPALKP--ASPNVLLNLALGFLGGLALGTAFAFFVAYVDDRVKSSFDIESVIGLPLV
I6AQC1          SRAVPAREDQYVEPRIVLNLAGGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLL
W0ITH7          SRAVPAREDEYVEPRIVLNLAGGFILGIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLL
A0A1G3ZFT0      SYAKIPDS--AVPIERAKLYGGSIIIGLIASIILIFGRKFIFPRIEDPYWTETRFNIPNL
A0A1Z8ZMT6      KHEDAPRAWAPFSPNRKKIMIKNTLLGLCGGLALAFMFQFVDNKIHGVADVEQTFGISIL
A0A2E8MCT7      KHEDAPRAWAPFSPNRKKIMVKTTMLGLCGGLALAFMFQFVDNKIHGVADIEQTFGISIL
A0A290Q2Z2      NYAEPARR--AAKPSWPLNIAFAVLFGGVLGIGTAVLIEFFDTSFRNVAELEGRLGKPVL
A0A2A2RGK2      ETAVGAG---PIRPSATKKWIQSLLGGAAIGVGLALLMFFMDTSMKTVDQVESVTGVGVI
A0A2A2XXF7      EPAVGAA---PIRPSATKTWIQNLLGGLAIGIGIAIAIFMLDTSIKTVDQVEQFTGVNVI
A0A2A2R5D6      SKAEPNDM--PFRPNLTINLIASGVAGLVLGIVLAFFIEYLDTSVKTMDDVEKLLDLPVL
A0A2V2DJ66      DKAGISPL--PSSPNYILNFVGGFILALFGGIAMAFAVAFLDDRAKSAYDVETVIGLPLL
R7L5A9          DRAAPALR--PSSPNYVLNIILGIIAGIIGGICMAFLVAFLDDRAKSAYDIEAVIGLPLL
A0A1J4XH17      DFAVAPGH--PAKPKKVIILALGLMGGIASGLGAVFAIAFFDDRIKTAFDIESVVGLPLL
A0A3C1VJ32      DRAEPGKA--PVKPNKTLNITLGLIFGLIMGVGLAFFIEYLDTSVKTIDDVERTFQAPVL
A0A2N9NTX7      DRAVAPLF--ASSPNKTLNIALGVIVGLVVGIGLAFFIEYLDTSVKTIDDVERSLQSPVL
B9XK55          DTAEEIDK--PVRPNKALNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERTLQAPVL
A0A4P5YMI6      DAAELPVK--ATRPNIPLNIALGVIVGMIMGVGLAFFIEYLDTSVKTIDDVEAALQTSVL
A0A2E6T482      DDADXPDK--AIKPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERSLGAAVL
A0A3C0DQZ7      DDADVPDK--AIKPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERSLGAAVL
A0A1Z9CBK5      DKADTPLN--PVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVL
A0A2D6ZI96      DKADTPLN--PVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVL
A0A358KGZ3      DKADTPLR--AVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVL
A0A2E9ZQX4      DKADTPLR--AVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVL
A0A3D5JZU0      DKADTPLR--AVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVL
A0A2E6HCR0      DKADNPIR--PVRPNIPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVL
A0A1Z8WN04      DKADNPIR--PVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVL
A0A2D7L1N4      DKADNPIR--PVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVL
A0A2E2R937      DKADNPIR--PVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVL
A0A520QQY4      DKADNPIR--PVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVL
A0A2D5MR66      DKADNPIR--PVRPNITLNIVLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVL
A0A2E0PDQ1      DKADNPIR--PVRPNITLNIALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERALNTAVL
A0A2E2ZZP9      DKADNPIR--PVRPNITLNIALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERALNTAVL
A0A2A2RGF2      DFAEAAIK--AAYPKMVLNVALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERALSAPVL
A0A2G4I5Y6      DFAEAAIK--AAYPKMPLNVALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERALQAPVL
A0A3M1I883      DPAVPALK--PVRPDLFLNLVLGVVFGLVMGVGLAFFIEYLDTSVKTIDDVERSLEATVV
A0A1V6JZ45      DPAEPALR--PVRPNIPLNIALGIMVGLVMGVGLAFFIEYLDTSVKTIDDVERSLSAPVL
A0A520RRW5      DPAEPNPD--PVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVL
A0A356NPK0      DPAEPNPD--PVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVL
A0A2D7B5P5      DPAEPNPD--PVRPKIFLNIALGVVVGLVVGIGXAFFIEYLDTSVKTIDDVEQALDAPVL
A0A3D3XGB5      DPAEPNPD--PVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVL
A0A2V6F8A1      DHAEPGRK--PVSPDFKLNIILGILVGLIVGVGLAFFIEYLDTSVKTIDDVERALQAPVL
A0A2V5TNH4      DQAEPGRK--PVSPSFKLNIALGIIVGLIVGISLAFFIEYLDTSVKTIDDVERALQAPVL
A0A2V5X5Q6      DNAEPGRR--PVSPNFKLNIALGIIVGLIVGIGLAFFIEYLDTSVKTIDDVERALQAPVL
A0A4P5QM05      QRAQPGLY--HEKPSVILYTIIAAIFGIVAGIGLAFFVEYLDTSVKTVDDIERHLSLPVL
A0A4Q3C001      EKAEPPMG--YAKPPVKLYLTLAALIGLVVGVGLAFFIEYLDTSVKTLDDVERFLQIPVL
B4DB23          EKAEKAEY--PSEPNVPAYMGMAAIIGLVLGVGLAFFIDYLDTSVKTLDDVERYLQIPVL
A0A6B3L938      EEASIPP---PSKYKHLITLAAGTVLGSGVGVGLVFLLSLLDYKIYNVRTAEEATGMACL
A0A2V5URB2      DRAEIPRQ--PSQPQKRRNLMLGALLGLMGGLGLALLLEHLNNTLRTPDEVERYLRLPNL
A0A5R8KA81      ETPQVAED--PSKPRKMRTWLIGLGVGLVFGLALAFGIHAFDDTLRTVDQAEAATDVPVI
A0A5B5WU87      DGVRGGAG--PLAPNVPKILLVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESLTDIPVY
R7DZW0          DGVRGGNG--PLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVY
A0A2N8HID1      DGVRGGNG--PLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVY
A0A2N8HS06      DGVRGGNG--PLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVY
A0A3R5R2M8      ESAHGPDI--PIAPQTVQYLAAGILGGGALCFFALLGIAMLNNKVKNKYDLPAQVRQPVI
A0A411SUQ6      ETAHGSNL--PISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANRQPVI
A0A2N8HZF2      ETAHGPNI--PISPKTIKYVAGGTAGGVLLSILAFMGAAMLNNKVNNKHDLPAANRQPVI
A0A354E720      EAAHGPNL--PISPKTIKYVAGGTAGGALLSILAFMGVAMLNNKVNNKHDLPSVNRQPVI
B2UPB6          ETAHGSNL--PISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANRQPVI
A0A2A2XXW5      DPAFAPLK--PVSPNKPLIFVGSVVGGLAVALGLALFFNFLDDSIKSQEDVENILHLPFL
A0A2V6JLK8      QVAEAPSY--PARPRVGLNLTLGMLVGLVIGIGLAFFIEYLDTSVKTMDDVESLLGVPVL
A0A2W5Z1A5      QVAEPPTF--PARPRVGLNLALGGLIGLGIGLGLAFFIEYLDTSVKTMEDVETLLGVPVL
A0A2V6EA09      QVAEPPNF--PARPRVVLNLALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENLLGLPVL
A0A2V6GQI7      QVAEPPNF--PARPRVVLNLALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENLLGLPVL
A0A3C1HEJ2      QRATVPER--PIKPNRKQVMLMGALAGLVSGLAVAFGLAATDSSLKSVEQAENFLKVPLL
A0A522ULD9      DPAEPSNV--PVSPNLFFNVLVGIIAGIVTGISLAFFLEYLDTSIKTVDDVEKYLGLPVL
A0A1V6JU76      DYAYAATM--PVKPRVLLTLFLGAFGGLGLAIGLAFFVNFLDDSIKSQDDVELYLHLPFL
A0A1Q6UHJ9      DKASPGIR--PVRPNIPMNITLGILGALAGGVMVAFIVAFMDDRAKSAYDIESVVGLPLL
A0A2V2BXR0      DKASPGIR--PVRPNIPMNITLGILGALAGGVMVAFIVAFMDDRAKSAYDIESVVGLPLL
A0A2D8V0G3      DLAYEPFN--PIKPRKALTLLLGLVGGLGMGFAFAFFANYLDDSVKSQDDIESYLKLNFL
A0A348S017      DKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFL
A0A3C1UUV7      DKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFL
A0A350I3V2      DKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFL
A0A520RGV5      DKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFL
A0A3D3XF90      DKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFL
A0A2D7B522      DKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFL
A0A356NIC2      DKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFL
A0A2U8DZK4      SKAEPKLE--PERPSWPINITFAILFGVVLGIGTALLIDMFDASFRSVADVERRLQRPVL
A0A2T6DFL8      NTAEAPRF--PIRPSWPLNLTFAFVFGAVLAVGVAVVLEYFDTSFRNVADVEARLGLPVL
A0A1D8AWD4      NTAEPARF--ASRPNWPLNILFACVFGTILGVGAAVLLEYFDTSFRNVADVEGKLSLPVL
A0A4Q1C9S2      NTAEPASY--ASKPNWPLNILFAFVFGSILGVGAAVLLEYFDTSFRNVADVEGKLGLPVL
A0A178IH18      NTAEPARR--AARPSWPLNLTFAFLFGAVLGVGAAVLIEFFDASFRGVADVERRLQRPVL
A0A2T6DT99      NVAEPARR--ASRPNWSLNLVFAVLFGTILGVGTAVLVEYFDTSFRNVAEVEARLQRPVL
A0A1G3ZT33      NQAEPARR--PSRPNWPLNIFFALLFGSLLGVGAAVLVEYFDTSFRNVADVEDHLKLPVL
A0A3E1E2T2      NTAEPARR--PSRPSWPLNSAFAVLFGSILGVGAAVLLEYFDTSFRNVADVETRLKLPVL
B1ZMW1          NTAEPPRY--PSRPNWTLSIALALVFGSLLGVGAALLLEYFDTSFRTVGDVETRLKLPVL
A0A2N8HDG3      EAAHGSDS--PIAPNTRKSVLTAAAGGAIVCILGFLGLALLNNKVKNKKDLNAITSLPVV
A0A146GCJ0      EEPMVPNV--PSKPRIKLILLVSLVAGLGLGVALVVVIDLLDASLRTVDEAESYLGLPAL
A0A2T6D6H8      EEPMVPSA--PAKPRVKVILAAGLLLGVMAGVGLVFVLDLLDHSLRTVDEAESFLDLPAL
A0A3D1TI55      ETAVEPRS--PFSPSWTLNILASIFGGLFLGVALAYFIEYMDTSVKTIDDVERFLGLPVL
A0A3R8IT45      ARAVQPREDEYVEPRIVLNLAAGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLL
A0A1H1MGC9      DRAA--PALKPFSPNIPLNLALGFLGGLALGTAFAFFVAYIDDRVKSSFDIESVVGLPLI
A0A2A2PYE8      DKAAPSPESKPISPNVPLNLGLGIAGGLGLGLAFAFFVAFIDDRVKSSYDIEGVVGLPLI
A0A2T6CN73      DLAQESPEGRPISPNVPLNLGLGVIGGLGLGLAFAFFVAFIDDRVKSSFDIEGVVGLPLI
A0A3E1ET42      QVATPEPR--PSKPNMMLLFSIGAGLGLVLGLLLAFFLEYLDTSVKSLDDVERYLGVPVL
A0A2A2YDW8      EEPVVARF--PSSPKVNIALILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERYLQVPVL
A0A352XLN9      EEPVVARF--PSSPKVNIALILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERYLQVPVL
A0A3D0YP62      QIPEINDI--AVSPNIPLNLALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERFLQVPVL
A0A3D3DV47      QIPEINDI--AVSPNIPLNLALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERFLQVPVL
A0A2E5XJ49      EEPKQAKD--AVYPKVSLFLGLGAAVGLIFGVAIAFFLEYLDTSVKSLEDVERYLQVPVL
A0A2E6SBY8      EDPKQAKD--AVYPKVSLFLGLGAAVGLIFGIAIAFFLEXLDTSVKSLEDVERYLQVPVL
A0A2E5QMS4      EDPKMSKN--PVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERYLQVPVL
A0A2E7YXQ3      EDPKMSKN--PVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERYLQVPVL
A0A2E3H787      EDPKLGKX--PVYPKVTLFLSLGAAVGLIFGVAIAFFLEYLDTSVKTLEDVERYLQIPVL
A0A2E7AGN1      ENPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVL
A0A2E7AKY7      ENPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVL
A0A3D4CU34      ENPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVL
A0A2E8M146      EHPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVL
A0A355S8S2      EHPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVL
A0A2D6DVN8      EEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVL
A0A3C1W2R2      EEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVL
A0A2E3NAY6      EDPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVL
A0A2E3II01      EEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVL
A0A368B8C5      EEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVL
A0A3R7RBB5      EEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVL
A0A2A2QX62      EEPVVSQV--PVSPNVTLNLALGTVVGLIFGIAVAFFLEYLDTSVKTLEDVERYLQVPVL
A0A4Q3BWH6      EEPMISQV--PVSPNVTLNLTLGAIVGMIFGIGVAFFLEYLDTSVKSLEDVERYLQVPVL
A0A3N5WCF1      DPPVISNS--PVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKTLEDVERYLQVPVL
A0A4Q3C1K5      EEPQIAQG--PVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKSLEDVERYLQVPVL
A0A2G4G428      VLDSPSVADRPTNKNFYLNAIIGLAMGAIFGLGLIILLGTFDDRIKSPKEVEIALGIPIL
A0A139TV24      ETAHGSNA--PIAPNTRKFVLGGAAGGAALCLFAFMGVAILNNKVKNRHDLDAITTLPVI
A0A2N8HT11      ESAHGTDY--PISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVV
R7DS70          ESAHGTDY--PISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVV
A0A2N8HNL6      ESAHGTDY--PISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVV
A0A6I1K459      EPANLPSS--PIRPNKRMILIYSLAMGFGLSFGLVWLIAQLDTSIKSVDQAESLLGLPVL
A0A139TUL1      EPAFGSNS--PVAPKLPLMTLGGMAGGAFLCLLSLMVSNALNTNVKDKNDLVGLVSLPLA
A0A2N8HCB0      EPAFGSNA--PVAPKLFLMTVGGMTGGALVSLLALLAGNALNTKVRDKKDLAGLTDLPLA
A0A2N8HP04      EPAFGSNA--PVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLPLA
A0A2N8HRJ0      EPAFGSNA--PVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLPLA
A0A366HAG0      QPAEPDTT--PSKPNVKLNLLLGGIIGLMFGFGMAFFLEYLDTSVRTMDDLERTLSVPVL
A0A3M1I8A3      DPATIPTE--FVKPNIPVVLTAGVLGGILLGIGLALFVNYLDDSIKSQDDVELHLQMPFL
A0A4V0XS84      DLADAPLK--PIKPSVGLTLLLGILGGLAVAIGLAFFVDYVNDTIKTQEDIEAHLQVPFL
A0A0R2XQ77      DQAFPPLRH--SSPNIAMNLAAGFFGGLAVGAGLIFAVAFLDDRVKSVFDIEGTIGLSML
A0A2E9IN28      DEAFPPSEDNPSSPNVTMNLAAGFFGGIAVGVGLIFVVAFLDDRVKSAFDIEGTIGLPML
D5ENH7          DKAFAPLRH--SSPNILMNLAAGIFGGLVVGAGLVFLVAFLDDRVKSAFDIEGTIGLPLL
A0A351WE84      EPAEPANK--PSSPLVMLNILLSIFLGFGAGIGLAYFIEYLDTSVRTVDDVEQFLGLPVL
A0A1V5QDZ6      DPAVPPSR--PVSPNLFLNILLSVLLGLGAGVGLAYFIEYLDTSVKTVDDIERYLGLSVL
A0A4Y8P964      ETSAIPKI--PIKPQKTRNILFALVFGSLASCGLALGLAKLDTRIRSKEEIEKEFGLPVL
A0A3D4HF88      DKATPPIY--PSHPKILLNLFLGFSGGIMLSLIFVGLLAFFDDRVKTAYDVEGILNLPLI
A0A351MR11      ILDTPVVSERPINKNYYLNVFVGIGLGLASGVGLVVLLGVFDDRVKSAVDIEGGLGLPLV
A0A6G6K641      EPAVASYA--PVRPDKRKILLQWSIGGIVLGLGLTLGLHFLDNSIKAVAEAETMTGLPVL
A0A5B5WI95      ETAHGSDL--PIAPKTEQYIAAGTLGGAALCFFAFLGLGMMNNKVKNKHDLTGQTRQPII
A0A2N8I9W1      ETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVI
A0A4Q5IH27      ETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVI
A0A2N8IBZ6      ETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVI
A0A2N8IJW9      ETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVI
R6J100          ETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVI
A0A1V6J089      EEADPPDR--PSSPLVVLNIFLSVVLGLMAGTGLAFFVEYLDVSIKTVDEVEKYLGLPVL
A0A3C1BZR1      EEAEAPQR--PSSPLVVLNIFLSVVLGLLAGTGLAFFVEYLDVSIKTVDEVEKYLGLPVL
A0A1H6KPB7      TQAREAKV--PSSPNVKMNLILGAVVGVVFGIGVAFLLNYMDTSVKTLEDVERNLNLPVL
A0A2E9ISN4      KIQAPQASEKPIKPQVIKIIAASLFLGAAFGAGAILGLEYLKPNPINVTHLEREYHIDLL
B9XAX1          EPAMLPGA--TVKWSLLLVIGGAVVTGLLMSLCMIYLMSLFDSSIRTVDQAEFVLGLPVL
A0A5R8KKM9      KSADEPET-APAKPNVKVNLALGAVVGLMFGFGLAFFLEYLDTTVKSIDEVERLLGVPVL
A0A139TS01      DNPLLPTA--PYKPDVTLNLAVGAVAGLLLGMGLALLLEFMDTSVKTMEDVERALQVPVL
A0A3E1EJT7      DRAYEPGN--PVSPKVFFNLTLGVLAGLVAGFSVAFLIATLDDRIKTISAVETLVDLPLL
A0A317ZP96      DEAYPPADDNPSSPNVVMNLAAGFFGGLAVGTALVFAVAFLDDRVKSAFDIEGTIGLPML
A0A2D5WGA5      DDADLPEK--PVKPNIPLNIALGMVVGLILGVGLAFFLEYLDTSVKTIDDVEHALGAAVL
A0A2E7SSH2      DKADIPLR--PVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVL
A0A349GXM8      DITTRED---PVWPDPLKILMAALAGGLGLGFGLAFLAQVVDNKVQTIKDVENILGVRFL
A0A4P5YP61      QPAIAPER--PSKPQKVKIMAAAVLVGLMGGLMLALLLNQIDSSIKSVDQAEEFLQLPVL
A0A6B2LYM4      DRAVEPVR--PFKPNITMNLAIGLVMGTGVGLGLVFLLAFLDDKVKSAFDIESTLGVPLV
A0A6D1VXB3      ETSPIPKV--PVKPQKIRNILFALVFGSLTSCGLALGLAKLDTRIRSKEEIEKQLGIPVL
I0JYY7          ETSPIPKV--PVKPQKIRNILFALVFGSLTSCGLALGLAKLDTRIRSKEEIEKQLGIPVL
A0A4R7S1J2      QLPSAPGY--QIWPQPSRIISSGVGGGFALAAGVIFLLFFMDRTIKSVDQAEKILRLPVL
A0A2A2XV69      ERAEPAEY--PSRPRVLLNMILGVVVGIGFGVGLAFFIEYLDTSVKTLQDLESILKIPVL
A0A651H7X9      DSAMVPLR--PASPNVRLNLGLGLLGGLGLGLGVAFFIAILDDRVKSAFDIESVVGLPLI
A0A4Y8P842      ETSPIPKK--PVKPKKMLNLLLALFGGSIGGIGLALGLAMLDNRFRGKEEIEKFLKIPVL
B3DZK9          ETASIPKK--PVKPKKMLNLLLGLFGGSVGGIGLALGLALLDNRFRGKDDIEKFLKIPVL
A0A5E6MPC4      EHASVPQS--PSRPKKGRNLLLGFLGGGLGGLGLAVGLARFDTRLRGKEEVERTLGLPVL
A0A4V1SB02      EEPLINAA--PVRPNPKKIMSIAGLLALLLGSGLVLLMDRLDSSIRTVDEAENILELGVL
A0A3C1VB86      QPALVPEL--PASPKIKLIFALALFGGLAVGLGISFVLNSMDTSFRTVDEVEHYLALPVL
A0A146G2Q9      ESAEISLV--PAKPNVVLNMVLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESFLKVPVL
A0A2T6D3Y2      ETAEISLV--PAKPNVVLNMVLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESFLKVPVL
A0A2V2SDV4      TTHAVPDA-HAVRPNKPFNIALGIIVGLVVGVGLAFFIEYLDTSVKTIDDVERSLNSPVL
A0A2V5PK75      MDKAEPGT-KPVKPNKALNIALGIIIGLVVGIGLAFFIEYLDTSVKTIDDVERSLQSPVL
A0A1V6DME1      VDTAKPGL-RPVRPNKPLNIALGVIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQSPVL
A0A3D3DIJ3      VDRAMPGL-RPVRPNKPLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQCPVL
A0A2D5VY59      YDPAEPND-EPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVL
A0A2D8UZZ4      YDPAEPND-EPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVL
A0A353DV86      YDPAEPND-EPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVL
A0A2E5EPT8      IDPAEPAI-RPAKPKVALNIALGVVLGAVMGIGMAFFIEYLDTSVKTIDDVEHTLQAPVL
A0A6I1K583      TDFAEPAV-KPASPKVVLNIALGAFVGLLLGVGLAFFIEYLDTSVKTIDDVERALSAPVL
A0A350EWA4      INPAEEGL-RPVRPNKTLNIALGVIVGLVVGVGLAFFIEYLDTSVKTIDDVERALQAHVL
A0A5B5WZ91      DNPLLPSA--PYKPDVTLNLAVGAVAGLLLGVGLALLLEFMDTSVKTMEDVERALQVPVL
A0A2N8HD92      DLPEYPAV--AYKPSITINLAVGASVGLLLGIGLALFLEFMDTSVKTMEDVERALQVPVL
A0A2N8HIT2      QLPTYPAA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A354EBD3      QLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A355VEB2      QLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A2N8IMT3      QLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
R6K1U5          QLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A2N8IWC2      QLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A2N8I441      QLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A2N8I3A6      QLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A410SCC4      QLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A3R5VEW0      QLPTYPAA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A411SSG2      QLPTYPAA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
B2UKW3          QLPTYPAA--PYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVL
A0A1M6RLZ4      KVPSEPAADEYVSPNWTLNMALGAVAGLVFGVGIAFALELMDTSVKTLEDVERFLQVPVL
A0A354T7G8      AEAEPE--GKPAKPNVPLHLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERHLGVPVL
A0A2S7U4L6      SYPQEPEVADYVSPNWILNMALGSVAGMIFGIGIAFSLELMDTSVKSLEDVERYLQVPVL
A0A512MBZ2      AKAEAE--GRPSKPNISLNLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERFLGVPVL
A0A2E8MEZ0      ERAKKAKA--PAYPNVTLNLLLGAGVGLIFGIGIAFLLEHLDTSVKSLEDVERYLQVPVL
A0A4Q2YKS3      E--EPVIAASPVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKSLEDVERYLQVPVL
A0A6B3LBV6      DKAVAGDF--PVTPNKPLNLILGSVLGLAFGLGIAFALEFMDTSVKTIDDVERYLNVPVL
A0A2E3EC33      EIAEAADPGNPARPNIKLHLVLGATVGLVFGIGMAFFLEYLDTSVKSMDEVEHFLELPVL
A0A2E4GN01      EKAEASDPDNPARPNIKLHLVLGAAVGLVFGIGMAFFLEYLDTSVKSLDEVEHFLELPVL
A0A1Z8XU55      EQAEPSDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVL
A0A2E1RQR9      EQAEPSDVDKPARPNIKXHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVL
A0A2E3ISQ4      EEAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVL
A0A2D6W6F4      ELAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVL
A0A2D8Z5A8      ELAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVL
                                                                            

A0A2A2XVF1      VGIPNRTLKGFSQLKQTLERECAALPGRLRQARNIGKPHKKKESSVLGDIQELIRPAPIA
A0A2V5UHJ2      AMVPDFVSVNGTNGSYVSRLLKSAQAELPVSARKAAKAKHADSSVLLDHH----------
A0A2V5PST3      GVVPDLASLNRPLISYQPVSSGKPKRIAQLQAQQKTSNGKDLIVSYH-------------
A0A2V5PXM3      SAIPKFASVAGDQRK--LINAED-------------------------------------
A0A139SU05      GIVPDLASVKDEDKY--TLLLKD-------------------------------------
A0A1D8AZK8      GIIPELGDVPDTEKH--SLVNSN-------------------------------------
A0A1V5QB01      GLVPAASWDPEDLRT--HILSNID------------------------------------
A0A139SPN4      GIVPDLNNVKDEDKY--TLLLKD-------------------------------------
A0A1V6E7N1      GIVPDLADTPDDDRY--RMVLDH-------------------------------------
A0A2D9MYT1      GYVPNIKTTSIIERD--LQAHLH-------------------------------------
A0A258ANJ7      GMIANQRQIATASEQQKGHDFTQGLTPALI------------------------------
A0A139TLN4      GVLPRKPRKLKNQEI--VVNLEE-------------------------------------
A0A290QGD9      GIIPQVRKMPAPEKA--QVVANH-------------------------------------
A0A1D8AS58      GIIPEIKRMDQPDKA--QIVINN-------------------------------------
I6AQC1          GVIPQIKKMDQADKA--QVALNN-------------------------------------
W0ITH7          GVIPQIKKMDQADKA--QVALNN-------------------------------------
A0A1G3ZFT0      AIIPYSKEQFKD-----FQDLKRNVKKPIMLLSQKD------------------------
A0A1Z8ZMT6      SAIQKLPPEEELLEK--MESLRDLPVSMKHISPTLAVPGWK-------------------
A0A2E8MCT7      SAIQKLPPEEELLKE--MESIRDLPVSMKHICPTLAVPGWK-------------------
A0A290Q2Z2      GVIPHSSEAVPPAKS--GIVEDP-------------------------------------
A0A2A2RGK2      AAIPKLSLNARA-SV--LVTNEE-------------------------------------
A0A2A2XXF7      AAIPKLSLSTRA-SV--LVTNEE-------------------------------------
A0A2A2R5D6      AVIPD--------GV--GPLIRE---------GADS------------------------
A0A2V2DJ66      GVIPRIKRLSSAEKA--QVAASN-------------------------------------
R7L5A9          GVIPRIKRLNSAEKA--QVAASN-------------------------------------
A0A1J4XH17      GVIPRMANLNTQEKA--KTVVKG-------------------------------------
A0A3C1VJ32      GVIPQ--------NI--GYLLEE---------GAES------------------------
A0A2N9NTX7      GVIPQ--------NV--GLLVDE---------GVES------------------------
B9XK55          GVIPQ--------NV--GLLLDE---------GAES------------------------
A0A4P5YMI6      GVIPQ--------NV--GSLLDE---------GVDS------------------------
A0A2E6T482      GVIPQ--------NV--GSLLEE---------GDES------------------------
A0A3C0DQZ7      GVIPQ--------NV--GSLLEE---------GDES------------------------
A0A1Z9CBK5      GVIPQ--------NV--GSLVDE---------GDES------------------------
A0A2D6ZI96      GVIPQ--------NV--GSLVDE---------GDES------------------------
A0A358KGZ3      GVIPQ--------NV--GSLMDE---------GDES------------------------
A0A2E9ZQX4      GVIPQ--------NV--GSLMDE---------GDES------------------------
A0A3D5JZU0      GVIPQ--------NV--GSLMDE---------GDES------------------------
A0A2E6HCR0      GVIPQ--------NV--GSLVDE---------GEES------------------------
A0A1Z8WN04      GVIPQ--------NV--GSLVDE---------GEES------------------------
A0A2D7L1N4      GVIPQ--------NV--GSLVDE---------GEES------------------------
A0A2E2R937      GVIPQ--------NV--GSLVDE---------GEES------------------------
A0A520QQY4      GVIPQ--------NV--GSLVDE---------GEES------------------------
A0A2D5MR66      GVIPQ--------NV--GSLVDE---------GEES------------------------
A0A2E0PDQ1      GVIPQ--------NV--GSLVDE---------GEES------------------------
A0A2E2ZZP9      GVIPQ--------NV--GSLVDE---------GEES------------------------
A0A2A2RGF2      AVIPQ--------NV--GALLDE---------GMDS------------------------
A0A2G4I5Y6      AVIPQ--------NV--GALLDE---------GMDS------------------------
A0A3M1I883      GVIPQ--------NI--GLLIKE---------GPDS------------------------
A0A1V6JZ45      GVIPQ--------NV--GILVNE---------GPDS------------------------
A0A520RRW5      GVIPQ--------NV--HSLLME---------GPDS------------------------
A0A356NPK0      GVIPQ--------NV--HSLLME---------GPDS------------------------
A0A2D7B5P5      GVIPQ--------NV--HSLLME---------GPDS------------------------
A0A3D3XGB5      GVIPQ--------NV--HSLLME---------GPDS------------------------
A0A2V6F8A1      GVIPQ--------NV--GSLIQE---------GPES------------------------
A0A2V5TNH4      GVIPQ--------NV--SSLILE---------GSES------------------------
A0A2V5X5Q6      GVIPQ--------NV--SSLILE---------GPES------------------------
A0A4P5QM05      AVIP---------TEIVILLQQK-------------------------------------
A0A4Q3C001      AVVP---------KGVSALMKES-------------------------------------
B4DB23          AVIP---------NNVSILMKNA-------------------------------------
A0A6B3L938      AAIPLGSDFRRSGQKFESVIAIE-------------------------------------
A0A2V5URB2      AIVPDFYRLPNHRNG--QKSLIHYDKYNKVKFDNKLCLPSKKSSLSDR------------
A0A5R8KA81      AALPQSSKFKSPAHS--LVMVKD-------------------------------------
A0A5B5WU87      GVLPRKPRKLKNQEI--VVNLEE-------------------------------------
R7DZW0          GELPRKPRKLKNQEI--VVNLEE-------------------------------------
A0A2N8HID1      GELPRKPRKLKNQEI--VVNLEE-------------------------------------
A0A2N8HS06      GELPRKPRKLKNQEI--VVNLEE-------------------------------------
A0A3R5R2M8      AELPKMSKKERK-NN--TPLIRN-------------------------------------
A0A411SUQ6      AELPQMSKKESK-NT--KLFIQD-------------------------------------
A0A2N8HZF2      AELPQMNKKESR-NT--GLFIQD-------------------------------------
A0A354E720      AELPQMSKKESR-NT--KLFIQD-------------------------------------
B2UPB6          AELPQMSKKESK-NT--KLFIQD-------------------------------------
A0A2A2XXW5      GYIPNIKSISIVERD--LQSHLH-------------------------------------
A0A2V6JLK8      AIIP-------K-NI--NLLHKA---------EGDT------------------------
A0A2W5Z1A5      AIIP-------K-NV--TLLHHE---------IGDS------------------------
A0A2V6EA09      AIIP-------K-NI--KLLHRE---------AGDT------------------------
A0A2V6GQI7      AIIP-------K-NI--KLLHRE---------AGDT------------------------
A0A3C1HEJ2      GAIPQMKELQSSDSS--QVIMAD---------PRLV------------------------
A0A522ULD9      GAIP-------Q-RV--KPLHEE---------GPDS------------------------
A0A1V6JU76      GYIPNIKTNSVVESG--LQAHLH-------------------------------------
A0A1Q6UHJ9      GVIPRIRRLNSSQKA--QVAVSN-------------------------------------
A0A2V2BXR0      GVIPRIRRLNSSQKA--QVAVSN-------------------------------------
A0A2D8V0G3      GYIPNIKSQSLVERD--LQAHLH-------------------------------------
A0A348S017      GYIPNIKTNSLVERD--MQAHLH-------------------------------------
A0A3C1UUV7      GYIPNIKTNSLVERD--MQAHLH-------------------------------------
A0A350I3V2      GYIPNIKTNSLVERD--MQAHLH-------------------------------------
A0A520RGV5      GYIPNIKTNSLVERD--MQAHLH-------------------------------------
A0A3D3XF90      GYIPNIKTNSLVERD--MQAHLH-------------------------------------
A0A2D7B522      GYXPNIKTNSLVERD--MQAHLH-------------------------------------
A0A356NIC2      GYIPNIKTNSLVERD--MQAHLH-------------------------------------
A0A2U8DZK4      GVIPSSLTARKP--------------------AEEP------------------------
A0A2T6DFL8      GVIPFAQDPLAR--------------------G--G------------------------
A0A1D8AWD4      GVIPHMAEAGEL--------------------H--D------------------------
A0A4Q1C9S2      GVIPHLPEPPAL--------------------H--D------------------------
A0A178IH18      GVIPASATARRP--------------------NEDS------------------------
A0A2T6DT99      GVIPNAPDPLKK--------------------DAAG------------------------
A0A1G3ZT33      SVIPLSRTPARL--------------------D--P------------------------
A0A3E1E2T2      GVIPFHRDPLDE--------------------E--G------------------------
B1ZMW1          GVIPRQTDPLGG--------------------D--E------------------------
A0A2N8HDG3      AELPAMTKKEQR-QV--ARMFTD-------------------------------------
A0A146GCJ0      TAVPEQRSKSVGEQV--AEAWND---------KTLGSLPKDLAQKQVLEPLRRSLNRKER
A0A2T6D6H8      AAIPEKRIETVLNQV--GEAIRE---------KKLSKIPQEIAGKGVVEPVRKFLNAREA
A0A3D1TI55      GIIP-------Q-RV--RPLVEE---------GPDS------------------------
A0A3R8IT45      GVIPQIKKMDQA-DK--AQVVSN---------NADR------------------------
A0A1H1MGC9      GIVPEIKRLDQP-EK--AQIVAN---------NQDK------------------------
A0A2A2PYE8      GIIPQIKRMDQP-DK--AQIVIN---------NADR------------------------
A0A2T6CN73      GIIPEIKKLEQV-EK--AQIVAT---------NTDR------------------------
A0A3E1ET42      AVIP-------K-DV--GILHKQ---------SGLS------------------------
A0A2A2YDW8      AVIP-------K-DI--GVLHKQ---------SGMS------------------------
A0A352XLN9      AVIP-------K-DI--GVLHKQ---------SGMS------------------------
A0A3D0YP62      AVIP-------K-DV--GVLHRQ---------SGMS------------------------
A0A3D3DV47      AVIP-------K-DV--GVLHRQ---------SGMS------------------------
A0A2E5XJ49      AVIP-------K-DV--GVLHKQ---------SGMS------------------------
A0A2E6SBY8      AVIP-------K-DV--GVLHKQ---------SGMS------------------------
A0A2E5QMS4      AVIP-------K-DV--GTLHKQ---------SGMS------------------------
A0A2E7YXQ3      AVIP-------K-DV--GILHKQ---------SGMS------------------------
A0A2E3H787      AVVP-------T-DV--NVLHKQ---------SGMS------------------------
A0A2E7AGN1      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A2E7AKY7      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A3D4CU34      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A2E8M146      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A355S8S2      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A2D6DVN8      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A3C1W2R2      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A2E3NAY6      AVVP-------T-DV--GVLHKQ---------SGMS------------------------
A0A2E3II01      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A368B8C5      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A3R7RBB5      AVIP-------T-DV--GVLHKQ---------SGMS------------------------
A0A2A2QX62      AVIP-------K-DV--GVLYKQ---------SGMS------------------------
A0A4Q3BWH6      AVIP-------K-DV--GVLYKQ---------SGMS------------------------
A0A3N5WCF1      AVIP-------K-DV--GILHKQ---------SGMS------------------------
A0A4Q3C1K5      AVIP-------K-DV--GVLHKQ---------SGMS------------------------
A0A2G4G428      GTIPQITKSVGP-ER--ALLAMH---------EKDV------------------------
A0A139TV24      AELPAMSKKEQK-QV--SLMLPD-------------------------------------
A0A2N8HT11      AELPAMTKKEQR-QV--ARMFTD-------------------------------------
R7DS70          AELPAMTKKEQR-QV--ARMFTD-------------------------------------
A0A2N8HNL6      AELPAMTKKEQR-QV--ARMFTD-------------------------------------
A0A6I1K459      GAVPKNKLVKDG-KS--RLFMSD---------DPQS------------------------
A0A139TUL1      GELPLLSGKERK-KL--PLVVIN-------------------------------------
A0A2N8HCB0      GALPLLSGKERA-KL--PLVVMN-------------------------------------
A0A2N8HP04      GELPLLSGKERK-KL--PMVVTN-------------------------------------
A0A2N8HRJ0      GELPLLSGKERK-KL--SLVVTN-------------------------------------
A0A366HAG0      AVVP-------K-GV--GTLMHA---------TGIT------------------------
A0A3M1I8A3      GYVPSIKSAKEV-ER--YLQCHL---------HPQS------------------------
A0A4V0XS84      GYVPSIKRESVV-ER--DLEAHS---------NPTS------------------------
A0A0R2XQ77      GVVPRIKKLDSS-SK--AQAVAS---------NIDR------------------------
A0A2E9IN28      GVVPRIKKLDSN-TK--AQAVAS---------NVDR------------------------
D5ENH7          GVVPRIKKLDSN-SK--AQAVAS---------NVDR------------------------
A0A351WE84      GVIP-------Q-KI--RPLIHE---------GPES------------------------
A0A1V5QDZ6      GIIP-------Q-KV--RPLTEE---------GPDS------------------------
A0A4Y8P964      GSVPDVEFLQGE-GI--DEIPKDIPFALTTHAAPES------------------------
A0A3D4HF88      GVVAKLQELSAK-EK--AIAVAS---------NADR------------------------
A0A351MR11      GTVPRTTDTYGP-DR--ALLARQ---------TKDK------------------------
A0A6G6K641      TAII-------A-KK--TSARKNPLPDLEIVHQKNS------------------------
A0A5B5WI95      AELPRMSKKERK-NT--SLFIKE-------------------------------------
A0A2N8I9W1      AELPQMNKKESR-NT--GLFIQD-------------------------------------
A0A4Q5IH27      AELPQMNKKESR-NT--GLFIQD-------------------------------------
A0A2N8IBZ6      AELPQMNKKESR-NT--GLFIQD-------------------------------------
A0A2N8IJW9      AELPQMNKKESR-NT--GLFIQD-------------------------------------
R6J100          AELPQMNKKESR-NT--GLFIQD-------------------------------------
A0A1V6J089      AVIP-------Q-QS--RPLTEA---------GQSS------------------------
A0A3C1BZR1      AVIP-------Q-QS--RPLTEA---------GQSS------------------------
A0A1H6KPB7      GVIP-------Q-DI--GLLHLM---------NGSS------------------------
A0A2E9ISN4      GQIR-------RWDL--YLPIDKFNPESDIFVAAKG------------------------
B9XAX1          AAIPVAKKGRNG-TP--AHIVAD---------DPGS------------------------
A0A5R8KKM9      AVIP-------K-NV--GALHRT---------TGLN------------------------
A0A139TS01      GIIP-------K-NV--PILHSA---------GSLG------------------------
A0A3E1EJT7      GVIPEVKRMDQP-DK--AQIVSN---------GSDP------------------------
A0A317ZP96      GVIPRIKKLDTN-TK--AQAVAS---------NVDR------------------------
A0A2D5WGA5      GVIP-------Q-NV--GSLLDE---------GDES------------------------
A0A2E7SSH2      GVIP-------Q-NV--GSLMDE---------GDES------------------------
A0A349GXM8      GGIPYWAHSQLESSI--RPIVTE---------EHST------------------------
A0A4P5YP61      SAIPQITAFG-N-NR--GLVVVD---------DAKS------------------------
A0A6B2LYM4      GIVPHIFSIDSQ-EK--ARIAAD---------EHDK------------------------
A0A6D1VXB3      GSIPDIELIKGE-GI--DEIPKDIPFALTTYSSPES------------------------
I0JYY7          GSIPDIELIKGE-GI--DEIPKDIPFALTTYSSPES------------------------
A0A4R7S1J2      ATINKAKYS--D-EA--GAILKH---------AEHS------------------------
A0A2A2XV69      AVIP-------K-EI--SLLING---------NDDN------------------------
A0A651H7X9      GLIPRLRKMEVH-EK--AQIVLN---------NEDR------------------------
A0A4Y8P842      GVIPDIEKLKKS-HP--ETYEGEIPYALMTYALPES------------------------
B3DZK9          GVIPDIEKLKKH-QP--ETYEGDIPYALMTYALPES------------------------
A0A5E6MPC4      GQVPDTEKLKAK-GI--DEIPADLPMAFAAHVAPDS------------------------
A0A4V1SB02      AAVPDGDSSKIP-KG--GTVMTD---------DANS------------------------
A0A3C1VB86      GAIPKLPKTEGK-GN--DLAAAQ---------DSNS------------------------
A0A146G2Q9      AVIP-------K-GI--SLLVNE---------AKDN------------------------
A0A2T6D3Y2      AVIP-------K-GI--SLLVNE---------TKEN------------------------
A0A2V2SDV4      GVIP-------Q-NV--GAILDE---------GAES------------------------
A0A2V5PK75      GVIP-------Q-NV--GLILDE---------GVDS------------------------
A0A1V6DME1      GVIP-------Q-NV--GSLLQE---------GAES------------------------
A0A3D3DIJ3      GVIP-------Q-NV--GLLVDE---------GTES------------------------
A0A2D5VY59      GVIP-------Q-NV--QSLLLE---------GPDS------------------------
A0A2D8UZZ4      GVIP-------Q-NV--QSLLLE---------GPDS------------------------
A0A353DV86      GVIP-------Q-NV--QSLLLE---------GPDS------------------------
A0A2E5EPT8      AVIP-------Q-NV--GVLMNE---------DPDT------------------------
A0A6I1K583      AVIP-------Q-NV--GALLDE---------GMDS------------------------
A0A350EWA4      GVIP-------Q-NV--GSLLDE---------GPDS------------------------
A0A5B5WZ91      GIIP-------K-NV--PILHSA---------GSLG------------------------
A0A2N8HD92      GIIP-------K-NV--PILHSS---------DVLG------------------------
A0A2N8HIT2      GIIP-------K-NV--PILHSS---------DVMG------------------------
A0A354EBD3      GIIP-------K-NV--PILHSS---------GVMG------------------------
A0A355VEB2      GIIP-------K-NV--PILHSS---------GVMG------------------------
A0A2N8IMT3      GIIP-------K-NV--PILHSS---------DAMG------------------------
R6K1U5          GIIP-------K-NV--PILHSS---------DAMG------------------------
A0A2N8IWC2      GIIP-------K-NV--PILHSS---------DAMG------------------------
A0A2N8I441      GIIP-------K-NV--PILHSS---------DAMG------------------------
A0A2N8I3A6      GIIP-------K-NV--PILHSS---------DAMG------------------------
A0A410SCC4      GIIP-------K-NV--PILHSS---------DAMG------------------------
A0A3R5VEW0      GIIP-------K-NV--PILHSS---------DVMG------------------------
A0A411SSG2      GIIP-------K-NV--PILHSS---------DVMG------------------------
B2UKW3          GIIP-------K-NV--PILHSS---------DVMG------------------------
A0A1M6RLZ4      AVIP-------R-DV--GVLHKQ---------SGAS------------------------
A0A354T7G8      AVVP-------K-GV--GVLHRS---------SGFN------------------------
A0A2S7U4L6      AVVP-------R-DV--GVLYKM---------STAS------------------------
A0A512MBZ2      AVVP-------K-NV--GVLHRT---------SGFN------------------------
A0A2E8MEZ0      AVIP-------K-DV--GVLHKQ---------SGMS------------------------
A0A4Q2YKS3      AVIP-------K-DV--GVLHKQ---------SGMS------------------------
A0A6B3LBV6      AVIP-------K-DV--GVLHRE---------GGMS------------------------
A0A2E3EC33      AVIP-------Q-AV--GVLXRQ---------SGLS------------------------
A0A2E4GN01      AVIP-------Q-DV--GILHRQ---------SGLS------------------------
A0A1Z8XU55      AVIP-------K-DV--GVIHKQ---------SGLS------------------------
A0A2E1RQR9      AVIP-------K-DV--GVIHKQ---------SGLS------------------------
A0A2E3ISQ4      AVIP-------K-DI--NVLHKE---------SGLS------------------------
A0A2D6W6F4      AVIP-------K-DI--NVLHKE---------SGLS------------------------
A0A2D8Z5A8      AVIP-------K-DI--NVLHKE---------SGLS------------------------
                                                                            

A0A2A2XVF1      RTDSEKYPIATIEEPESGLAEAYRTLRVSIS--ML-GPEEERRVLLFVSAIPEEGKTYTS
A0A2V5UHJ2      --------------SLSVVAEAYRSFRSALL--LS-QAGGPPHTILVTSAARGEGKTTTL
A0A2V5PST3      --------------PLSIFSESYRTIRTALL--LS-EPEATRKVILLTSPSPGEGKTATT
A0A2V5PXM3      --------------AESGEAEAFRTLRTAIS--ML-GRKEERRVFLFTSAVPSEGKTFCS
A0A139SU05      --------------THPTAVEAFMGIYGAAK--TH-SLVDYPKSMLVTSTIPGEGKTLVS
A0A1D8AZK8      --------------KTSPGSEAFLSVYSAVK--IQ-SKLDFPKSVLVTSTIPGEGKTMIS
A0A1V5QB01      --------------QKSGMVEAYRNVRSALL--FS-VAGSQSKFIAMTSAVPKEGKTTTC
A0A139SPN4      --------------TNPTAVEAFTGIYSAAK--TH-SLVDYPKAMLVTSTIPGEGKTLVS
A0A1V6E7N1      --------------RQSPGLEAFLSIYSSVK--IH-SKLDFPKSILVTSTIPGEGKTLVS
A0A2D9MYT1      --------------PQSNSAEAFRTVRAAIS--LS-VRAGDLQILSVTSTVPSEGKSLVA
A0A258ANJ7      --------------AHKAVAESFREFRAIIAR----MARCPHTCHMVVSAVPDEGKTFVS
A0A139TLN4      --------------PSEL-SESFPLLAERLVSLAD-ENGPGGFSILLTSSCPGEGKTYLA
A0A290QGD9      --------------ADRQVSEAFLTLHSSLR--LK-DDARAAKCILVTSTIPGEGKSFTT
A0A1D8AS58      --------------QDKQVVESFLTLHSSLR--LK-DESKAAQAILVTSTIPGEGKSFTT
I6AQC1          --------------ADRQVAEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTT
W0ITH7          --------------ADRQVAEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTT
A0A1G3ZFT0      --------------PRNLSIESLRSLRTSLQ--VN-LSCANNNIISILGASPGVGKTFVS
A0A1Z8ZMT6      --------------TDFVHSEMFRVLRASIS--LL-GDANQRKITMITSSIPGEGKTFCA
A0A2E8MCT7      --------------TDFVHSEMFRVLRASIS--LL-GDTNQRKITMITSSVPGEGKTFCA
A0A290Q2Z2      --------------AE---LEPFRVLHTNLN--LALKGVTPGRSLVMLSAGPGEGKSTTV
A0A2A2RGK2      --------------RSGIVAESFRSLRASLT--LH-RINEDARTFLFTSSMPSEGKTFCS
A0A2A2XXF7      --------------RSGIVAESFRSLRASLT--LH-RLNESARTFLFTSSMPSEGKTFCS
A0A2A2R5D6      --------------PH---AEGYRILRAKID--LN-PKSGAGNTLTVVSGGPGEGKSTTL
A0A2V2DJ66      --------------ADRASTEAFRTLYSTLK--IN-NVSKDAKVILATSTTPSEGKSFVI
R7L5A9          --------------ADRATTEAFRSLHSTLK--VN-NFSKNAKVILFTSTTPSEGKSFIV
A0A1J4XH17      --------------TEKTVLESFRAIDSLLR--LN-KASKPARVITVTSTLPSEGKSFFT
A0A3C1VJ32      --------------KH---AEAYRVLRTNLL--FS-RKDEKLNTIVIVSAGAGEGKSTTT
A0A2N9NTX7      --------------PH---AEAYRVLRTNLL--FS-RKDEKLNTVAVVSAGAGEGKSTTV
B9XK55          --------------PH---AEAYRVLRTNLM--FS-RKDDKLNTMAVVSAGAGEGKSTTV
A0A4P5YMI6      --------------PH---AEAYRVLRTNLM--FA-RKDPKANSLIVVSSGAGEGKTTTV
A0A2E6T482      --------------PH---AEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTM
A0A3C0DQZ7      --------------PH---AEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTM
A0A1Z9CBK5      --------------PH---AEAYRVLRTNIL--FAGRTSEXXTTFSVVSGGAGEGKTTTM
A0A2D6ZI96      --------------PH---AEAYRVLRTNIL--FAGRTSEXXTTFSVVSGGAGEGKTTTM
A0A358KGZ3      --------------PH---AEAYRVLRTNIL--FAGRKSEDQTTFTVVSGGAGEGKTTTM
A0A2E9ZQX4      --------------PH---AEAYRVLRTNIL--FAGRKSEDQTTFTVVSGGAGEGKTTTM
A0A3D5JZU0      --------------PH---AEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTM
A0A2E6HCR0      --------------PH---AEAYRVLRTNIL--FAARKSEDQTTFTVVSGGAGEGKTTTM
A0A1Z8WN04      --------------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTM
A0A2D7L1N4      --------------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTM
A0A2E2R937      --------------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTM
A0A520QQY4      --------------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTM
A0A2D5MR66      --------------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTM
A0A2E0PDQ1      --------------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTM
A0A2E2ZZP9      --------------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTM
A0A2A2RGF2      --------------PH---AEAYRVLRTNVL--FT-RKDDQANAITVVSGGAGEGKSTTV
A0A2G4I5Y6      --------------PH---AEAYRVLRTNVL--FT-RKDDAANAITVVSGGAGEGKSTTV
A0A3M1I883      --------------PH---AEAYRVLRTNVL--FS-RKNPNDNTITVVSGGAGEGKSTTI
A0A1V6JZ45      --------------PH---GEAYRVLRTNIL--FS-RKEPGANTLTVVSGGAGEGKSTTI
A0A520RRW5      --------------PH---AEAYRVLRTNIL--FS-RKNEKANTLTVVSGGAGEGKSTTI
A0A356NPK0      --------------PH---AEAYRVLRTNIL--FS-RKSEKATTLTVVSGGAGEGKSTTI
A0A2D7B5P5      --------------PH---AEAYRVLRTNIL--FS-RKXEKAXTLTVVSGGAGEGKSTTI
A0A3D3XGB5      --------------PH---AEAYRVLRTNIL--FS-RKNEKANTLTVVSGGAGEGKSTTI
A0A2V6F8A1      --------------PH---AEAYRVLRTNVL--FS-RKREDANSITVVSGGAGEGKSTTI
A0A2V5TNH4      --------------PH---AEAYRVLRTNVL--FS-RKREDANSLTVVSGGAGEGKSTTI
A0A2V5X5Q6      --------------PH---AEAYRVLRTNVL--FS-RKREDANSLTVVSGGAGEGKSTTI
A0A4P5QM05      --------------RDTADAEAYRILKGNIE--LN-LPDHGANTYTLVSGGPGEGKSTTL
A0A4Q3C001      --------------NDSQHAEAYRILRANVE--FN-KPGRDANTFTLISGGPGEGKSTTL
B4DB23          --------------GDTSDAEAYRILRAAVE--FN-KPYRDANTFTLISGGPGEGKSTTL
A0A6B3L938      --------------PKTVHAESIRNLRASIR--LL-GRKERNQVICLTSALPGEGKTTTA
A0A2V5URB2      --------------RISVVTESYRKLRAAIF--LS-RPEAPPKTILFTSGTASEGKTITV
A0A5R8KA81      --------------PNSPIAESFRILRSSLE--LM-EDHDKDEVVLFTSSIPSEGKSFCS
A0A5B5WU87      --------------PSEL-SESFPLLAERLVSLAE-ENGPGCFSILLTSSCPGEGKTYLA
R7DZW0          --------------PSEL-SECFPLLAERMVALSD-GNEGNPLSVLITSTCSGEGKTYLS
A0A2N8HID1      --------------PSEL-SECFPLLAERMVALSD-GNEGNPLSVLITSTCSGEGKTYLS
A0A2N8HS06      --------------PSEL-SECFPLLAERMVALSD-GNGGNPLSVLITSTCSGEGKTYLS
A0A3R5R2M8      --------------DHSVIAECFHILRNNVDSLLP-RPDAGGYVILLTSTCPAEGKTFAS
A0A411SUQ6      --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
A0A2N8HZF2      --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
A0A354E720      --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
B2UPB6          --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
A0A2A2XXW5      --------------PTSSPAEGFRTLRAAIS--LA-KNADKLRVMAFTSTIPSEGKSLVA
A0A2V6JLK8      --------------PD---AEAYRILRTNIE--FN-RANPEANTISLVSGGPGEGKSTTI
A0A2W5Z1A5      --------------PD---AEAYRILRTNIE--FN-RRNPEANTISIASGGPGEGKSTTV
A0A2V6EA09      --------------PD---AEAYRILRTNIE--FN-RKNPEANTISLVSGGPGEGKSTTI
A0A2V6GQI7      --------------PD---AEAYRILRTNIE--FN-RKNPEANTISLVSGGPGEGKSTTI
A0A3C1HEJ2      --------------AG---AEAFRSLRTTLS--ML-GPVNERRTFLFTSAVPDEGKTFCT
A0A522ULD9      --------------PH---AEAYRVLRANIQ--F--ANKGNGGAFSFISGGAGEGKSTTL
A0A1V6JU76      --------------PQSNAAESFRTVRAAIA--LG-AKAEKMRVFTVTSTIPSEGKSLVA
A0A1Q6UHJ9      --------------ADRATTEAFRSVHSMLK--VN-NIAKDSKVLLFTSTTPSEGKSFVV
A0A2V2BXR0      --------------ADRATTEAFRSVHSMLK--VN-NIAKDSKVLLFTSTTPSEGKSFVV
A0A2D8V0G3      --------------PQSNAAEGFRTVRAAVS--LV-HKSDKFKVLSMTSTIPSEGKSLVA
A0A348S017      --------------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVT
A0A3C1UUV7      --------------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVT
A0A350I3V2      --------------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVT
A0A520RGV5      --------------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVT
A0A3D3XF90      --------------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVT
A0A2D7B522      --------------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVT
A0A356NIC2      --------------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVT
A0A2U8DZK4      --------------LDPAEDEPFRVLQTNITLALRNKPSHGAQTLVMLSAGPGEGKSTTL
A0A2T6DFL8      --------------DDPAELEPYRVLYTNLNLAL--KPGQAH-ALVFSSAGPGEGKSTTL
A0A1D8AWD4      --------------PSSPEGEPYRVLQTNLNLAL--TAGKTS-VLVVLSSGPGEGKSTTL
A0A4Q1C9S2      --------------ATAPEGEPYRVLQTNLNLAL--PARQSS-VLVVLSSGPGEGKSTTL
A0A178IH18      --------------GDPADAEPFRVLQTNISLAR--KDAAPGRTLVMLSAGPGEGKSTTL
A0A2T6DT99      --------------EDPAELEPFRVLHTNLNLAL--KSDARGRTLILLSAGPGEGKSTTL
A0A1G3ZT33      --------------DNPAESEPFRVLQTNLNLAL--PPGQPG-SLVVVSAGPGEGKSTTV
A0A3E1E2T2      --------------D-PAETEPFRVLHTNLNLAL--KPGEAA-SLVLFSAGPGEGKSTTL
B1ZMW1          --------------D-PAEAEPYRVLQTNLNLAL--KPGQPA-SLVIFSAGPGEGKSTTL
A0A2N8HDG3      --------------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFIS
A0A146GCJ0      EAQLKKHPLIFVEDPSSMQAEAIRTLRTSIS--LL-GKQDDRKTFLFASAIPQEGKSFTS
A0A2T6D6H8      TAQAKRHPLVFIDDPASLQAEAIRTLRTSLS--LL-GKQETRRTFLFASSIPEEGKTFTS
A0A3D1TI55      --------------PH---AEAYRVLRTNLQ--FA-AKDPGANAITIVSGGVGEGKSTTL
A0A3R8IT45      --------------QV---SEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTT
A0A1H1MGC9      --------------QV---VESFLTLHSSLR--LK-DESKRAQAILVTSTIPGEGKSFTT
A0A2A2PYE8      --------------QV---SEAFLTLHSSLR--LK-DESKNAKCILVTSTIPGEGKSFTT
A0A2T6CN73      --------------LA---SEAFLTLHSSLR--LK-DESKNAKCILTTSTIPGEGKSLTT
A0A3E1ET42      --------------PD---AEAYRILRTNIE--FN-RRSADANAITIVSGGAGEGKSTTL
A0A2A2YDW8      --------------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGAAGEGKSTTL
A0A352XLN9      --------------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGAAGEGKSTTL
A0A3D0YP62      --------------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTL
A0A3D3DV47      --------------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTL
A0A2E5XJ49      --------------PD---AEAYRILRTNIE--FN-RKNPEDNAITIVSGGAGEGKSTTL
A0A2E6SBY8      --------------PD---AEAYRILRTNIE--FN-RKNPEDNAITIVSGGAGEGKSTTL
A0A2E5QMS4      --------------PD---AEAYRILRTNIE--FN-RNNPEDNAITIVSGGAGEGKSTTL
A0A2E7YXQ3      --------------PD---AEAYRILRTNIE--FN-RNNPEDNAITIVSGGAGEGKSTTL
A0A2E3H787      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITVVSGGAGEGKSTTL
A0A2E7AGN1      --------------PD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTL
A0A2E7AKY7      --------------PD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTL
A0A3D4CU34      --------------PD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTL
A0A2E8M146      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTL
A0A355S8S2      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTL
A0A2D6DVN8      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTL
A0A3C1W2R2      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTL
A0A2E3NAY6      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTL
A0A2E3II01      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTL
A0A368B8C5      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTL
A0A3R7RBB5      --------------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTL
A0A2A2QX62      --------------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTL
A0A4Q3BWH6      --------------PD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTL
A0A3N5WCF1      --------------PD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTL
A0A4Q3C1K5      --------------PD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTL
A0A2G4G428      --------------VA---VEAVRTIYSSMR--VN-PASMSSHVFLITSTRPSEGKTFVA
A0A139TV24      --------------EHSVMAEYFHIMCHNVDSMLP-FSEHQGHVILLASTTPGEGKTFIS
A0A2N8HT11      --------------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFIS
R7DS70          --------------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFIS
A0A2N8HNL6      --------------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFIS
A0A6I1K459      --------------LC---AEAFRSMRASLA--LL-GREEDRKVVFFTSAVPSEGKSFCC
A0A139TUL1      --------------SRSFMEECFHILRNNTELLLLPNPEKASRVVFLTSTRTGEGKTFTA
A0A2N8HCB0      --------------GRSLMEECFHILRNNAELMLLPNPEEASRVLFMTSTRAGEGKTFTA
A0A2N8HP04      --------------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTA
A0A2N8HRJ0      --------------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTA
A0A366HAG0      --------------PD---AEAYRILRTNLE--FN-RRDPNANCISVASGSPGEGKSTTM
A0A3M1I8A3      --------------NA---SESIRSIRAAVA--LG-DHGEKLRVLTVTSTIPSEGKSIIA
A0A4V0XS84      --------------IS---SEGFRTLRAAIS--LT-QQPENLRTIVVTSTIPSEGKSLVA
A0A0R2XQ77      --------------HV---TESFRSIHSALR--LS-DESRHAKVLVTTSTVPGEGKSFIS
A0A2E9IN28      --------------HV---TETFRTIHSALK--LN-DESKNAKIILTTSTVPSEGKSFVS
D5ENH7          --------------HV---TETFRSIHSAMK--LN-DESKNAKIIVTTSTVPSEGKSFVS
A0A351WE84      --------------PH---GEPYRVLRTNMQ--FS-NKGIHGGAFAVISGGVGEGKSTTL
A0A1V5QDZ6      --------------PH---AEAYRVLKTNLQ--FA-NKGTLGGAFALVSGGVGEGKSTTL
A0A4Y8P964      --------------LI---SNAYRQIRTLLH--YA-IPNRKPQLIALTSTYPSEGKSSTV
A0A3D4HF88      --------------RV---TEAFRSVHSALN--LN-EISKNAQIILMTSTVPSEGKSFVS
A0A351MR11      --------------MA---IESLRAIHSVMK--IN-PSAANAKVLLTTSTRPGEGKTFVT
A0A6G6K641      --------------PV---SESFRTLRSAIM--LL-GRFDERRVFMFTSALPAEGKTFCA
A0A5B5WI95      --------------EQSVMAECFHILRNNVDSLLP-RPDEGGHVIMLTSTTPGEGKTFTS
A0A2N8I9W1      --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
A0A4Q5IH27      --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
A0A2N8IBZ6      --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
A0A2N8IJW9      --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
R6J100          --------------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTS
A0A1V6J089      --------------GQ---GEAYRSLRTSMA--LL-GREDNKKIFAVISGGVGEGKSTTL
A0A3C1BZR1      --------------GQ---GEAYRALRTSLA--LL-AREGKQKIFTVISGGVGEGKSTTL
A0A1H6KPB7      --------------PD---AEAYRILRTNIE--LK-RKDTNVVTLALVSGNAGEGKTTTL
A0A2E9ISN4      --------------TNQIATETYRRIRLNLL--KQ-FGQDENISFTVTSSQSGDGKTFNV
B9XAX1          --------------IC---SEAFRTLRTTTG--IL-GHEEGKRITLFTSADPNEGKTFFS
A0A5R8KKM9      --------------PD---AEAYRILRTNIE--FN-RKRPDANVISVVSGGSSEGKSTTM
A0A139TS01      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A3E1EJT7      --------------AI---VEAFLSLYSNLR--IN-DESRNARLILVTSTLPSEGKSFIT
A0A317ZP96      --------------HV---TETFRTIHSALK--LN-DESKNAKVIITTSTVPGEGKSFIS
A0A2D5WGA5      --------------PH---AEAYRVLRTNIL--FAGRKDESQTTFSVVSGGAGEGKTTTM
A0A2E7SSH2      --------------PH---AEAYRVLRTNIL--FAGRQSEDQTTFSVVSGGAGEGKTTTM
A0A349GXM8      --------------GA---IEAYRALRTSVL--AE-LAKKHEKILMITSADSREGKTLTA
A0A4P5YP61      --------------IG---AEAIRTLRTSLS--ML-GKAENRRVYLFTSAIPAEGKTFCS
A0A6B2LYM4      --------------HA---VEAFRSIHSTLK--LN-EESRNAKVILSTSTIPSEGKTFIS
A0A6D1VXB3      --------------FV---SNAFRQIRTLLH--YA-IPNRKPQLIAITSTYPSEGKSSTI
I0JYY7          --------------FV---SNAFRQIRTLLH--YA-IPNRKPQLIAITSTYPSEGKSSTI
A0A4R7S1J2      --------------PV---AESFRSLRVMAN--LL-GKEEDRRVFVVTSALPSEGKTFCS
A0A2A2XV69      --------------PD---AEAYRIMRTNIE--FN-RKNPASNSITIVSGGPGEGKSTTL
A0A651H7X9      --------------QA---VEAFRTLHSSLK--LH-DESKNAQALLITSTTPGEGKSFTA
A0A4Y8P842      --------------EI---SNGFRSIRTLLH--YT-IPGRRPQVITITSTQESEGKSGTT
B3DZK9          --------------EV---SNGFRSIRTLLH--YT-IAGRRPQVITVTSTLESEGKSGTT
A0A5E6MPC4      --------------AV---SNSFRQIRTLLH--YS-LPDRRPQVMLITSCQMGEGKTSTT
A0A4V1SB02      --------------SQ---AEAYRTLRASLS--LL-GEESQRRVLLVTSAVPAEGKTFTA
A0A3C1VB86      --------------PN---AEVFRTLRATLS--ML-GRENDRKTYLFTSSLPGEGKTFTS
A0A146G2Q9      --------------AD---AEAYRILRTNIE--FN-RKNPDANTITMISGGAGEGKSTTM
A0A2T6D3Y2      --------------AD---AEAYRILRTNIE--FN-RKNPDANTITMISGGAGEGKSTTM
A0A2V2SDV4      --------------PH---AEAYRVLRTNLL--FS-RKDDKLNTVAIVSAGAGEGKSTTV
A0A2V5PK75      --------------PH---AEAYRVLRTNLL--FS-RKDDKLNSVAVVSAGAGEGKSTTV
A0A1V6DME1      --------------PH---AEAYRVLRTNLL--FS-RKDDKLNSIAVVSAGAGEGKTTTV
A0A3D3DIJ3      --------------PH---AEAYRVLRTNLL--FS-RKDDKLNTIAIVSAGAGEGKSTTV
A0A2D5VY59      --------------PH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTI
A0A2D8UZZ4      --------------PH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTI
A0A353DV86      --------------PH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTI
A0A2E5EPT8      --------------PH---AEPYRVLRTNIL--FT-NKKPNANTITVVSGGAGEGKSTTV
A0A6I1K583      --------------PH---AEAYRVLRTNVL--FT-RKDEHANAITVVSGGAGEGKSTTV
A0A350EWA4      --------------PH---AEAYRVLRTNIL--FS-RKSEDQNTITVVSGGAGEGKSTTL
A0A5B5WZ91      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A2N8HD92      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A2N8HIT2      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A354EBD3      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A355VEB2      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A2N8IMT3      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
R6K1U5          --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTL
A0A2N8IWC2      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A2N8I441      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTL
A0A2N8I3A6      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A410SCC4      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTL
A0A3R5VEW0      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A411SSG2      --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
B2UKW3          --------------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTL
A0A1M6RLZ4      --------------PD---AEAYRILRTNIE--FN-RKNPDDNSITVVSGGAGEGKSTTL
A0A354T7G8      --------------PD---AEAYRILRTNIE--FN-RKSPDANCFSVVSGGAGEGKSTTM
A0A2S7U4L6      --------------PD---AEAYRILRTNIE--FN-RPSQDDNAITVVSGGAGEGKSTTL
A0A512MBZ2      --------------PD---AEAYRILRTNIE--FN-RRNPEANCITVTSGGAGEGKSTTL
A0A2E8MEZ0      --------------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTL
A0A4Q2YKS3      --------------PD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTL
A0A6B3LBV6      --------------PD---AEAYRILRTNIE--FN-RRSADANSITMVSGGAGEGKSTTL
A0A2E3EC33      --------------PD---AEAYRILRTNIE--FN-RKTADANSMTIVSGGAGEGKSTTL
A0A2E4GN01      --------------PD---AEAYRILRTNIE--FN-RKTSDANSMTIVSGGAGEGKSTTL
A0A1Z8XU55      --------------PD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTL
A0A2E1RQR9      --------------PD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTL
A0A2E3ISQ4      --------------PD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTL
A0A2D6W6F4      --------------PD---AEAYRILRTNIE--FN-RKNADANAITLVSGGAGEGKSTTL
A0A2D8Z5A8      --------------PD---AEAYRILRTNIE--FN-RKNADANAITLVSGGAGEGKSTTL
                                    :    .                      .     **:   

A0A2A2XVF1      LNTAVVFAQQGLKTLLIDADLRRPSLHKALLTVDTLPN-------GLTDYFSG-NSRLAS
A0A2V5UHJ2      VNSAIVFAQLGIRVLIIDADLRRPRCHALL--RMENLA-------GLSDLLAG-QIELQS
A0A2V5PST3      LNLGIALAQDSFKVLIIDADLRRGSCHSRL--GIGNHR-------GLSNLLAG-NVSIEE
A0A2V5PXM3      LNFAISLAQQGLRTLIIDCDLRRPMVENTLQNNNQRGF-------GLTDYLTG-QKDFKA
A0A139SU05      ANLAASFARHGKRTLLVDCDLRRPMLHRRF--DLANTS-------GIIAFYEA-DGDLDC
A0A1D8AZK8      CNLAASFARHGKRVLIIDCDMRRPMLHRHF--KLTNEV-------GLIAWFEA-GAKIPA
A0A1V5QB01      LNLAVSLAQAGARILMVDSDMRRGELHKFF--GLEGGR-------GLSDLLAG-QAKPEA
A0A139SPN4      ANLAASFARHGKRTLLVDCDLRRPMLHRRF--DLANTS-------GLIPFYES-GASLDT
A0A1V6E7N1      ANLAASFARHGRRTLLIDCDLRRPMMHRHF--KQSNQA-------GIITWFEK-GADLSV
A0A2D9MYT1      SNHAIVTAQTGAKTLLVDCDLRRPSVHKAF--QIQSPK-------GLSSYLLGKVDTIDS
A0A258ANJ7      THLAVSLASQGFRTLLIDMDLRHSQLAQVF--GIPNTRK------GVVDLLLE-EVSFAE
A0A139TLN4      VNLALSLAVAGKKVLLMDMDLRKGTLSSLL--GGEGKP-------GTGDLDRVGEGGWRS
A0A290QGD9      TNLALTFAAHGEKVVVIDCDLRRPNIHKSF--RIANQR-------GVIDLCGG-DTRVED
A0A1D8AS58      TNLALTFAAHGEKVVVIDCDLRKPNIHKSF--RLENIK-------GVIDVCAG-THTIDQ
I6AQC1          TNLALTFAAHGDRVVVLDCDLRKPNIHKSF--RRENLK-------GVIDVCAG-SATIDD
W0ITH7          TNLALTFAAHGDRVVVVDCDLRKPNIHKSF--RRENLK-------GVIDVCAG-SATIDD
A0A1G3ZFT0      TNLAYLLATADKRILLVDADLRKGTVHKYF--NLDPSP-------GFAELIQG-SVNIEE
A0A1Z8ZMT6      ANLALAYAKQGTRTLLIDFDLRKPAVHKIFNEERAARP-------GIVNVLNG-TAAANQ
A0A2E8MCT7      ANLALAYAKQGTRTLLVDFDLRKPAVHKIFNEERAARP-------GIVNVLNG-TAAANQ
A0A290Q2Z2      LRLARSMGAAGERVLLVDSDLRRPTQHQLA--ALPKEP-------GLADLLQG-KATLEK
A0A2A2RGK2      SNFAVTLAQQGFNTLFIDADLRKPGGSIVF-FGENRKP-------GLSEVLMR-TCTMKN
A0A2A2XXF7      SNFAVTLAQQGFNTLFIDADLRKPGGSIVF-YGENRKP-------GLSELLMR-SCAMKN
A0A2A2R5D6      FNLAYVCAQSGQSVLLVDADLRRPTVHTIL--GIENEA-------GISEAMRG-LGEAHQ
A0A2V2DJ66      SNLAFTCALNGEKCIIIDADLRLPALAKVL--GISASK-------GLVSYIEE-GDSLDD
R7L5A9          TNLAFTYALHGEKTIIIDADLRLPAMAKVL--GITAKD-------GLIGHIEE-GKPLED
A0A1J4XH17      TNLGLTFAANDEKVLIIDADLRMPSIGSSL--QLDKKK-------GILQYCEE-GATLDD
A0A3C1VJ32      INLSTVFAQAGNRVLIVDSDLRRPTLHKLF--KVANNL-------GLTNYLLK-QNTVVE
A0A2N9NTX7      FNLACVFAQGSQRVLIVDSDLRRPTLHRML--RVSNSI-------GLTNYLLK-QNTLEE
B9XK55          YNMATVFAQSGHRVVMVDSDLRRPTLHKLV--NVSNTI-------GLTNYLLK-QNTLEE
A0A4P5YMI6      LNLAVIFAHNGHKVLLVDTDIRRPSLHKRL--NVSNSI-------GVTNVLLK-QCPVEE
A0A2E6T482      FNLAVVFAQQGDRCLIVDSDLRRPSMHRYL--QVSNNI-------GLTNYLLG-QVXIDE
A0A3C0DQZ7      FNLAVVFAQQGDRCLIVDSDLRRPSMHRYL--QVSNNI-------GLTNYLLG-QVTIDE
A0A1Z9CBK5      FNLAVIFAQMGDRILVVDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTLDE
A0A2D6ZI96      FNLAVIFAQMGDRILVVDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTLDE
A0A358KGZ3      FNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLG-QNTLDE
A0A2E9ZQX4      FNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLG-QNTLDE
A0A3D5JZU0      FNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLG-QNTLDE
A0A2E6HCR0      FNLAVIFAQLGDRILVVDSDLRRPSMHRYF--KVTNSI-------GLTNLLLG-QNTLDE
A0A1Z8WN04      FNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTVEE
A0A2D7L1N4      FNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTVEE
A0A2E2R937      FNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTVEE
A0A520QQY4      FNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTVEE
A0A2D5MR66      FNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLG-QNTVEE
A0A2E0PDQ1      FNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLG-QNTVEE
A0A2E2ZZP9      FNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLG-QNTVEE
A0A2A2RGF2      LNLATIFAQNGDKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLG-QNKLEE
A0A2G4I5Y6      LNLATIFAQNGDKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLG-QNTLEE
A0A3M1I883      MNLATVFAQNGERVLLVDSDLRRPSLHKFI--GVSNSI-------GLTNYLMK-QNTLEE
A0A1V6JZ45      LNLATVFAQNGQRVLVVDSDLRRPSLHKFL--AVSNSI-------GLTNYLMK-QNTLEE
A0A520RRW5      FNLATVFAQNGSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLA-TKSLEE
A0A356NPK0      FNLATVFAQNDSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLA-TKSLEE
A0A2D7B5P5      FNLATVFAQNXSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLA-TKSLEE
A0A3D3XGB5      FNLATVFAQNGSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLA-TKSLEE
A0A2V6F8A1      FNLGVVFAQNGQRVLLVDSDLRRPSLHKLL--NVSNAV-------GLTNYLLR-QNTLEQ
A0A2V5TNH4      FNLAVVFAQNGQRALLVDSDLRRPSLHKLL--NVSNSV-------GLTSYLLR-QNTLEE
A0A2V5X5Q6      FNLAVVFAQNGQRALLVDSDLRRPSLHKLL--NVSNSV-------GLTNYLLR-QNTLEE
A0A4P5QM05      SNLAYIYAKGGANVLVVDADLRRPSQHRFF--NVDNSI-------GLVDYLHG-RKTLDE
A0A4Q3C001      NNLAYTCAKGGYNVLVVDADLRRPTQHRIF--EVDNNY-------GLTDYLTG-KASIDE
B4DB23          NNLAYTCAKGGYNVLVVDADLRRASQHHFF--DVDNSF-------GLTDYLLG-RAEIDE
A0A6B3L938      TELAAGFALAGERVLLVDFDLRKPRVHAEF-PDLKGKP-------GTVELLTG-QAEFSQ
A0A2V5URB2      ANTAIMFARLGNRVLLMDADLRRPTCHKAL--KVQGAT-------GLADYLAG-QEELDK
A0A5R8KA81      ANYAISSANLGKRTLLIDADLRRPMVNELF-FKGRVSV-------GLADVLQG-KVTLEE
A0A5B5WU87      VNLALSLAVAGKKVLLMDMDLRKGTLSSLL--GGQGKP-------GIGNLDRSGEGGWRS
R7DZW0          VNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRS
A0A2N8HID1      VNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRS
A0A2N8HS06      VNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRS
A0A3R5R2M8      ANLAAAFAKAGRKVLLIDGDLRKRSLSRQL--GGYGRR-------GLTSILLNRLQTAAL
A0A411SUQ6      ANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQTTDTTG
A0A2N8HZF2      ANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQQNPDTTG
A0A354E720      ANLAAAFAYAGKKVLLIDGDLRKSSLTRRL--GGSGRK-------GLTSILLRQNPDTAG
B2UPB6          ANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQTTDTTG
A0A2A2XXW5      SNFAIVTSQTGLKTLLVDADLRRPSVHKAF--QLQSPV-------GLSAYLSGRTDNFSE
A0A2V6JLK8      ANLAFICAQGGYSTLIVDADLRRPVQHLLF--DLSNEI-------GLTNYLTT-DMDLDQ
A0A2W5Z1A5      TNLGYICAQGGYSTLIVDADLRRPVQHMHF--DLDNKI-------GLSNYLTS-NMRIEE
A0A2V6EA09      ANLAFVCAQGGYSTLIVDADLRRPIQHEFF--GVSNTA-------GLTSYLTT-EMPLEK
A0A2V6GQI7      ANLAFVCAQGGYSTLIVDADLRRPIQHEFF--GVSNTA-------GLTSYLTT-EMPLEK
A0A3C1HEJ2      INFAYSLAQQGMRTLLIDCDLRCPTVEEYLLGRNTESP-------GVSDYLSG-KKDFSD
A0A522ULD9      FNLAYICAQQGDKVLIVDSDLRRPTQHTIL--GLSNRL-------GLTNVLMR-DVPIEE
A0A1V6JU76      SNLAVVVAQTGLRTVLVDADLRRPSLHKAF--QLHSPM-------GLTAYLTEQTNRVDD
A0A1Q6UHJ9      TNLALMCAMHGEKTIIIDADLRLPAMAKVL--GIESRD-------GIVGYVED-GRPLED
A0A2V2BXR0      TNLALMCAMHGEKTIIIDADLRLPAMAKVL--GIESRD-------GIVGYVED-GRPLED
A0A2D8V0G3      SNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GLSAYLTGQITDPSE
A0A348S017      SNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAE
A0A3C1UUV7      SNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAE
A0A350I3V2      SNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAE
A0A520RGV5      SNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAE
A0A3D3XF90      SNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAE
A0A2D7B522      SNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAE
A0A356NIC2      SNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAE
A0A2U8DZK4      LRLARAMGAAGERVLLIDADLRRPTQHRLF--NVAKTP-------GLADLLQS-KVTLDQ
A0A2T6DFL8      HRLTRLMGEMGDRVLLIDADLRRPTQHRIA--ERPRSP-------GLSDLLTA-QKTLDE
A0A1D8AWD4      RQLALCMAAAGEKVLLIDSDVRRPTQHKLA--GLSRDP-------GLTDIVLN-KVPWTA
A0A4Q1C9S2      RQLALCMAAAGEKVLLIDSDVRRPTQHKLA--TLPREP-------GLTDIVLN-KVGWEA
A0A178IH18      LRLARAMGEAGARVLLIDSDLRRPTQHQLT--GAAKEP-------GLADLLQG-KATLDD
A0A2T6DT99      LRLARAMAKAGERVLLIDSDLRRPTQHQLA--GLRKEP-------GLAEVLQG-KATLQS
A0A1G3ZT33      HHLVRVMAAAGERVLLVDSDVRRPAQHRLM--DQTREP-------GLIDLLLN-KATLES
A0A3E1E2T2      HRLVRVMAAGGERVILIDSDVRRPTQHHLA--DRPREP-------GLSEFLLN-RKTLDE
B1ZMW1          FRLARLAAAAGERVVLIDSDFRRPAQHRLA--ERPREP-------GLSDWLMN-RQPLET
A0A2N8HDG3      ANLALAFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFS
A0A146GCJ0      LNFAHALAQKGLRTVVIDADLRRPRLKDDLLPDAGDID-------GLTDYLSG-GAPLDQ
A0A2T6D6H8      LNFAHSLAQQGLRTVIIDADLRKPRLKADLLPEEGDIS-------GLTNYLSG-TATLTE
A0A3D1TI55      FNLAYVCAQLGDKVLLVDSDLRRPALHKIL--GMSNDF-------GLTNVLMR-DVPIEE
A0A3R8IT45      TNLALTFAAHGDKVVIVDCDLRKPNIHKSF--RRENLK-------GVIDVCAG-SATIDD
A0A1H1MGC9      TNLALTFAAHGEKVVIVDCDLRKPNIHKSF--RLENLK-------GVIDVCAG-TQTVDQ
A0A2A2PYE8      TNLALTFAAHGERVVVIDCDLRKPNIHKSF--RLENLK-------GVIDICAG-KATIAD
A0A2T6CN73      TNLALTFAAHGEKVIVVDCDLRKPNIHKSF--RIENIR-------GVIDVCSG-KATLDE
A0A3E1ET42      VNLAYICAQGGYNTLMIDGDLRRPKLHTFF--DINNSV-------GLTNYLTT-ALMLED
A0A2A2YDW8      VNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLSNYLTT-ELMLED
A0A352XLN9      VNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLSNYLTT-ELMLED
A0A3D0YP62      CNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-DLLLED
A0A3D3DV47      CNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-DLLLED
A0A2E5XJ49      VNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-DLMLED
A0A2E6SBY8      VNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-DLMLED
A0A2E5QMS4      VNLAYVCAQGGYTTLMIDSDLRRPTLHTFF--DINNSV-------GLTNYLTT-DLMLED
A0A2E7YXQ3      VNLAYVCAQGGYTTLMIDSDLRRPTLHTFF--DINNSV-------GLTNYLTT-DLMLED
A0A2E3H787      VNLAYVCAQGGYTTLMIDADLRRPQLHTFF--DINNSV-------GLTNYLTT-DLMLED
A0A2E7AGN1      VNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A2E7AKY7      VNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A3D4CU34      VNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A2E8M146      VNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A355S8S2      VNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A2D6DVN8      VNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A3C1W2R2      VNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A2E3NAY6      VNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A2E3II01      VNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A368B8C5      VNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A3R7RBB5      VNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLED
A0A2A2QX62      VNLAYICAQGGYTTLMIDADLRRPRLHTFF--EINNSV-------GLTNYLTT-ELMLED
A0A4Q3BWH6      VNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-ELMLED
A0A3N5WCF1      VNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-ELMLED
A0A4Q3C1K5      VNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-ELMLED
A0A2G4G428      TNLALGFSQHGERVLVIDADLRLPNVGPSL--GLTGTE-------GISRWFND-ESTIDE
A0A139TV24      ANLAQAFSKIGKRVLLIDGDLRKTSLSSQL--GGKGRK-------GLSTILLNKVSDLSS
A0A2N8HT11      ANLAMSFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFS
R7DS70          ANLAMSFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFS
A0A2N8HNL6      ANLAISFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFS
A0A6I1K459      VNYAVAYAQQGRRTLVIDFDLRKPTLAESF--GLKEDLA------GVSDVLLG-KATLDQ
A0A139TUL1      LNLAAAYAQTGKKVLLIDGDLRKASLSAFC--VGKNSR-------GLAHLLMNPLASPDS
A0A2N8HCB0      LNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDS
A0A2N8HP04      LNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDS
A0A2N8HRJ0      LNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDS
A0A366HAG0      VNLATICAQGGYNTLIIDADMRRPRQHTFF--NVPHTF-------GLSNYLSS-NVPLEE
A0A3M1I8A3      ANLAIAMAQTGYRTLLVDADMRRPRLHKAF--QLHNPV-------GLPAYLHG-KTDQFE
A0A4V0XS84      SNYAIVSAQSGLRTLLVDADLRRPSVHKAF--GIENNI-------GLSAYLMD-QVTDPT
A0A0R2XQ77      SNLALTFANHGEKTLLLDGDLRLPNVARSL--QLQNDF-------GLLDHIEK-GVALDE
A0A2E9IN28      SNLSLTFANHGEKTLLIDCDLRLPNVARSL--QLENDF-------GVLDHIDK-GVDLDE
D5ENH7          SNLALTFANHGEKTLLLDADLRLPNVAASM--QLENER-------GVLDHVEK-GMPIED
A0A351WE84      FNLAYTCAQLGYKTIVVDSDLRRPVQHSIL--SMSNRI-------GLTNVLMK-DSTLEE
A0A1V5QDZ6      FNLAYVCAQLGDKVLIVDSDLRRPVQHRIL--GVSNRF-------GLTNVLMR-DVPIEE
A0A4Y8P964      VNLATVLGQQG-TVLIIDGDLRRPMLHKVL--GLRPRP-------GLSEILTG-QVNVEE
A0A3D4HF88      TNLAYTYASHGERVVLIDCDLRMPNVAKSM--NLSNEK-------GLQQCLKD-GSRPED
A0A351MR11      TNIALTFAQHGERVLVVDADLRLPNVAPSM--GIETDN-------GISKYFNN-EITLDE
A0A6G6K641      SNFAVSLAQQGLKTVLVDCDLRKPAISEVF-LGKAAPI-------GVSDVLAG-QCALDE
A0A5B5WI95      ANLAATFAKAGRKVLLIDGDLRKFSLTRQM--GGHGRR-------GLTSILLN-QVDDPF
A0A2N8I9W1      ANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ-QSSDTT
A0A4Q5IH27      ANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ-QSSDTT
A0A2N8IBZ6      ANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ-QSSDTT
A0A2N8IJW9      ANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ-QSSDTT
R6J100          ANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQ-QSSDTT
A0A1V6J089      FNLAYVCAEQGSKVLVIDSDLRRPVQHKMV--GLANRA-------GLVNVLTG-ELKPED
A0A3C1BZR1      FNLAYVCAEQGSKVLIIDSDLRRPVQHKMV--GLANRT-------GMVNVLTG-DLKAED
A0A1H6KPB7      CNLAYVFAQGGFSTLMIDADLRRSKLAEYN--DVECEY-------GLSNFLTS-DLALQD
A0A2E9ISN4      ANIALPFAWVGKRVLLIDADLRLGNLTRRL---LGRELRH-----GLADWLAD-DSCDAN
B9XAX1          LNHAICQAQGGKLTLLIDLDLRRPSVGESF-SHPPGTP-------GVTNYLLG-KESLST
A0A5R8KKM9      VNLATVCAQGGYNTLIIDGDLRRPRMHTFF--DVTNDV-------GLTTYLSS-PMELEE
A0A139TS01      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEA-------GLTSYLLE-DYPLEE
A0A3E1EJT7      TNLGLTFASQGQRTVIVDCDLRKPNVERSF--RLQTTA-------GVISYCLQ-GSALDD
A0A317ZP96      SNMALTFANHGEKTLLLDGDLRLPNVARSL--QLENEK-------GLLDHVEQ-GKDLDD
A0A2D5WGA5      FNLAVVFAQQGDRVLIVDSDLRRPSMHRYL--KVTNNT-------GLTNYLLG-QNTIEE
A0A2E7SSH2      FNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVTNNI-------GLTNLLLG-QNTLDE
A0A349GXM8      LNLSIMVVQMGKRVLLVDMDLRRGRIHRSL--GLDREP-------GVTDVLRH-GKSLRE
A0A4P5YP61      LNYAVSLAQQGSKTLLIDGDLRRPAVEKAISGKDKKAV-------GVTDYILG-QKTLKE
A0A6B2LYM4      TNLSITFAAHGERTIVVDADLRMPNVSKEL--NIDGKR-------GIIQLIAD-KGDLDS
A0A6D1VXB3      VNLATVLGQQG-TVLIIDGDLRKPSLHKSL--GLRPRP-------GLSEILTG-QVNIEE
I0JYY7          VNLATVLGQQG-TVLIIDGDLRKPSLHKSL--GLRPRP-------GLSEILTG-QVNIEE
A0A4R7S1J2      CNYALSLAQQGLKTLLIDADLRRPKVSASV-YGEDRKP-------GLTEYLLG-QATFTD
A0A2A2XV69      NNLAYTFAKGGYTTLVVDADLRRPSQHRIF--GIDNKN-------GLSDLLTK-QLSLEQ
A0A651H7X9      TNLALTYAQHGEKTLLIDCDLRKPNIHQGL--QLENDT-------GLIDFVRG-NANFDA
A0A4Y8P842      VNLATVLGQQG-TVLIIDADLRRPAIHKNL--GLRPRP-------GLSEILTG-QAQVEE
B3DZK9          VNLATVLGQQG-TVLVIDADLRRPSIHKIL--GLRPRP-------GLSEILTG-QAQVEE
A0A5E6MPC4      VNTATVLGQQG-TVLLIDADLRRPNLHKIL--GLRPHP-------GLSELLTN-QASLGN
A0A4V1SB02      TNLAAALATQGLSTLLIDADLRRPALSATM---LERDVRQNEEFRGLTDVLSG-LCTPDE
A0A3C1VB86      VNYAVSLAQQGLRTLLVDIDLRRPMIEKFFLGKTSRLP-------GVTDYFLG-RKKFDE
A0A146G2Q9      SNLASIFASGGYSTLIVDADLRRPSQHRIF--GVENEV-------GLTDFLTT-DVHLEE
A0A2T6D3Y2      SNLASIFASGGYSTLIVDADLRRPSQHRIF--GVENEV-------GLTDFLTT-DVHLEE
A0A2V2SDV4      FNLAAVFAQGGQRVLIVDSDLRRPTLHKML--RVSNHI-------GLTNYLLK-QNTVEE
A0A2V5PK75      FNLACVFAQSRQRVLIVDSDLRRPTLHKML--RVPNDL-------GLTNYLLK-QNSLED
A0A1V6DME1      FNLATVFAQGNQRVIIVDSDLRRPTLHKRF--GVSNSI-------GLTNYLLK-QNKLEE
A0A3D3DIJ3      FNLAAVFAQSGQRTIIVDSDLRRPTLHKML--RVTNAI-------GLTNYLLR-QNTLEE
A0A2D5VY59      FNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLG-QKSVEE
A0A2D8UZZ4      FNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLG-QKSVEE
A0A353DV86      FNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLG-QKSVEE
A0A2E5EPT8      LNLATIFAQNGNRVLLVDSDLRRPSLHKRL--DIENSP-------GLTDYLLG-QGKLED
A0A6I1K583      LNLATIFAQNGNKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLG-QNKLEE
A0A350EWA4      FNLACIFAQNGARVLIVDSDLRRPSIHKIL--RVSNSV-------GLTNYLLG-QQPIEE
A0A5B5WZ91      CNLAYICAQGGYATLMIDGDLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLED
A0A2N8HD92      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A2N8HIT2      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A354EBD3      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEL-------GLTSYLLE-DYPLEE
A0A355VEB2      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEL-------GLTSYLLE-DYPLEE
A0A2N8IMT3      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
R6K1U5          CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A2N8IWC2      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A2N8I441      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A2N8I3A6      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A410SCC4      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A3R5VEW0      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A411SSG2      CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEA-------GLTSYLLE-DYPLEE
B2UKW3          CNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEE
A0A1M6RLZ4      VNLAYICAQGGYSTLMIDADLRRPKLHTFF--DINNTV-------GLTNYLTT-DLMLED
A0A354T7G8      VNLAYVCAQGGYNVLLIDADLRRPSLHHHF--DVSHAT-------GLTNYLTT-DISLED
A0A2S7U4L6      VNLAYICAQGGYSTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-TLPLED
A0A512MBZ2      CNLATVCAQGGYSVLLIDADLRRPSLHRLF--DVSNAN-------GLTNYLTM-NIRLED
A0A2E8MEZ0      VNLAYVCSQGGYTTLMVDADLRRPRLHSFF--DINNSV-------GLTNYLTT-DLALED
A0A4Q2YKS3      VNLAYICAQGGYTTLMIDGDLRRPRLHTFF--DINNAV-------GLTNYLTT-ELALED
A0A6B3LBV6      VNLAYVCAQGGYNTLIIDGDLRRPTLHGHF--DTSNSV-------GLTNYLTT-NMPLEE
A0A2E3EC33      VNLAYVCAQGGYNTLMIDADLRRPQLHTFF--NXNNSV-------GLTNYLTT-DLALED
A0A2E4GN01      VNLAYVCAQGGYNTLMIDGDXRRPQLHTFF--NINNSV-------GLTNYLTT-DXALED
A0A1Z8XU55      VNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLQLED
A0A2E1RQR9      VNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLQLED
A0A2E3ISQ4      VNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLKLED
A0A2D6W6F4      VNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLXLED
A0A2D8Z5A8      VNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLKLED
                              :.:* * *                       *              

A0A2A2XVF1      VII-PTEI------E----NLALLPAGRRA-PNPAELLSSADIPKLFA-QLLKRYDRIVI
A0A2V5UHJ2      AIR-PTSA------E----NLSFISAGALP-PNPAELLGSKKMHDLLE-QLREQFEFIFV
A0A2V5PST3      VVQ-RTSI------A----GLSVLTRGACP-PNPTELLRMRKMKEILT-GLGGSFDFILI
A0A2V5PXM3      VVH-ASGS------E----NFFYIPAGSHA-PNPAELLARTGIDGLID-EALLHFERVII
A0A139SU05      DLPNDSTLGIVKLSE----NLSLLRSGGRS-RRPTELLESPFFGDLLQ-KLGHYYDLIII
A0A1D8AZK8      DPFTDAALGLAKVDE----NLYLLRSGGRS-KSPTELLENPVFGQFIE-AMKQHFDLIVV
A0A1V5QB01      VIQ-RTGL------P----NLDLVATGPFP-PNPAELVLRPEFKAFMD-HARRQYDRILF
A0A139SPN4      DLSTDPTLGIVKLNE----NLSLLRSGGRS-RRPTELLESDLFGDLLK-KLGRYYDLIVI
A0A1V6E7N1      EPQKNPDLGIISLGE----NLSLLCSGGRS-KTPSSLLETPAFTQLLE-RLKQQYELVVV
A0A2D9MYT1      IVH-QTEV------A----NLDIICCGAVP-NNPSELAGSQRMIDFVE-EVRXKYEKIVF
A0A258ANJ7      VCL-SGGI------A----HLAIMPAGKRV-ANPAELLSTCGVERLKEMAFSAGFDRIVI
A0A139TLN4      LLEKSSVS------D----HLDYLFAGTLP-DHPSRLLLHDRVRELMK-ELKEHYDFIFM
A0A290QGD9      VVV-KGPH------P----NLDIIPAGGRA-KNPTHVLNSAGFEHMIA-DLRTRYDRVFI
A0A1D8AS58      VVI-KGVH------P----NLDVIPAGGRA-KNPTQILNSRNFEHLLA-DLRKRYDRVFI
I6AQC1          VVM-RDVH------P----NLDVIATGGRA-KNPTQILNSKNFEIMIA-ELRKRYDRIFI
W0ITH7          VVM-RDVH------P----NLDVIATGGRA-KNPTQILNSKNFEIMIA-ELRKRYDRIFI
A0A1G3ZFT0      ALK-LTSH------H----NLTILPRGNYP-VDPAELLSSERCKELIS-LFSKQFDIILI
A0A1Z8ZMT6      AITVYPGL------D----TLSVIYSGPKS-PNPGELLEPGRLRALIG-MFAANFDHIVI
A0A2E8MCT7      AITVYPGL------D----TLSVIYSGPKS-PNPGELLEPGRLRDLVE-MFSSNFDHIVI
A0A290Q2Z2      VTQ-RGVS------P----GLDFIPCGAVG-GFTLSLLYIDRLKALLA-ELRGRYDRVIF
A0A2A2RGK2      AIV-PTHI------D----NLQIMTAGGRA-PNPSELLTYENIDRVLK-EALSKYDRVVV
A0A2A2XXF7      AVM-PSHI------D----GLSILTAGGRA-PNPSELLTYENLERVMS-EALSKYDRIVV
A0A2A2R5D6      YIR-ATSV------P----NMHVITAGDMP-ASEMGAFSGLKLREILN-DLKLRYDIVLL
A0A2V2DJ66      VII-KDYF------Q----NLDVLVCERRA-KNPSQMLNSEEFVSMIE-SFREKYDKVFI
R7L5A9          AII-HDYF------P----NLDVLVCEKRA-KNPTQTLNSEEFAAMIE-KFRDTYDRIFI
A0A1J4XH17      IVN-KNVY------S----NFDVITAGGKA-TNPTQIFLSPRFQQLLE-EAKSRYSKIII
A0A3C1VJ32      VVQ-TTSV------P----NLDFMASGKLP-SSSMGILGSAQMKELIA-ELKQRYDFIFF
A0A2N9NTX7      VIQ-TTNL------P----SMDFLASGKLP-SSSLGILSSSQMRDLIN-ELKQRYDFVFF
B9XK55          VIQ-TTRL------P----NLDFMASGKLP-SSSLGILSSAQMKDLIT-ELKQRYDYVFF
A0A4P5YMI6      AIQ-TTPI------P----NLHFLPSGRLQ-SSSLGILNSPQMREFID-EMKRRYDFVFF
A0A2E6T482      VIQ-TTQI------P----SLHFIPSGKLP-SSSMGILSSSKMREFVS-EMKSRYDYVFL
A0A3C0DQZ7      VIQ-TTQI------P----SLHFIPSGKLP-SSSMGILSSSKMREFVS-EMKSRYDYVFL
A0A1Z9CBK5      VIQ-TSDS------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFF
A0A2D6ZI96      VIQ-TSDS------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFF
A0A358KGZ3      VIQ-TSES------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFF
A0A2E9ZQX4      VIQ-TSES------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFF
A0A3D5JZU0      VIQ-TSES------T----NLHFIPSGKLP-SSSMGVLNSAKMKQFVA-EMKSRYDYVFF
A0A2E6HCR0      VIQ-TTDI------P----NMHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKSRYDYVFF
A0A1Z8WN04      VVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFF
A0A2D7L1N4      VVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFF
A0A2E2R937      VVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFF
A0A520QQY4      VVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFF
A0A2D5MR66      VVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKGFVA-DMKSRYDYVFF
A0A2E0PDQ1      VVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKGRYDYVFF
A0A2E2ZZP9      VVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKGRYDYVFF
A0A2A2RGF2      VVQ-HSTL------A----NLHFLPSGRLP-SSALGILNSPQMKDFIK-EAKQRYDFVFF
A0A2G4I5Y6      VIQ-HSPL------A----NLHFLPSGRLP-SSALGILNSPQMKDFIK-EAKRRYDFVFF
A0A3M1I883      VIQ-TTSL------P----TLDFLPSGKLP-SSALGIINSPRMKELVD-EVRNRYDFVFF
A0A1V6JZ45      VIQ-TTKL------P----MMDFLASGKLP-SSSLGILNSTRMKEFIK-DVQRRYDFVFF
A0A520RRW5      VVQ-TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFF
A0A356NPK0      VVQ-TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFF
A0A2D7B5P5      VVQ-TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFF
A0A3D3XGB5      VVQ-TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFF
A0A2V6F8A1      VIQ-TTSI------P----TLDFLPSGKLP-SSSLGILNSVQMKDFIK-EAKKRYDFVFF
A0A2V5TNH4      VIQ-TTSI------P----TLDFLPSGKLP-SSSLGILNSAQMKDFIK-EAKRRYDFVFF
A0A2V5X5Q6      VIQ-TTSI------P----TLDFLPSGKLP-SSSLGILNSTQMKDFIK-EAKRRYDFVFF
A0A4P5QM05      ITH-PSRL------E----NLAIIPSGSLA-MEDVGILNGPRMTELIL-QLKKRYDVVFF
A0A4Q3C001      ITR-TTKI------D----NLSFIPSGQLP-SDAIGILNSQRMTDMMQ-KVKHQYDLVFF
B4DB23          IIK-TTKI------D----NLSFIPSGLLP-GDSVGILNSQRMTDLIA-KVKSQYDLVFF
A0A6B3L938      AVH-ATGT------E----NLYVMVSGKKA-PSPSELLLPEDIQSLFD-HAAEHFDRVIV
A0A2V5URB2      VIK-LTSI------P----NLWILNGGSVP-PSPTELIGSKKMQDTLA-LLKESYDFIFI
A0A5R8KA81      ALH-VSNT------E----NLFILSAGTEI-RNPAELLASPALAEFFD-SLKGKFDRVVL
A0A5B5WU87      LVEKSSVS------D----HLDYLFAGTLP-DHPSRLLLHDRVRVLME-ELKEHYDFIFM
R7DZW0          LVEQSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFM
A0A2N8HID1      LVEQSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFM
A0A2N8HS06      LVEQSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFM
A0A3R5R2M8      PIR---RI------EETGISFDFLGAGPAV-PNPVSLLSQPILGQMLE-HLKKQYDTVII
A0A411SUQ6      IIR---PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKKQYDAVII
A0A2N8HZF2      IIR---PL------GGNSRGMDILYTGPMV-PNPVILLSHPLLGHILG-ILKKQYDAVII
A0A354E720      VIR---PV------GEDTRGMDVLYTGPTV-PNPVTLLSHPLLGQILS-ILKKQYDAVII
B2UPB6          IIR---PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKKQYDAVII
A0A2A2XXW5      FVH-TTEV------P----NLDVICCGAVP-PNPSELIGSNRMVRFLE-EASRRYDRVIL
A0A2V6JLK8      AIL-PTNV------E----NLSILPSGILP-SDAVGILNSQRMSDTIA-QLKMRYDIVFF
A0A2W5Z1A5      VIR-PTSV------E----NLSLLPSGVIP-SDAVGILNSQKMSDLIA-ELKTRYDIIFF
A0A2V6EA09      VIL-PTAV------E----NLSILPSGVLP-ADAVGILNSQRMSDTIA-ELKSRYDLIFF
A0A2V6GQI7      VIL-PTAV------E----NLSILPSGVLP-ADAVGILNSQRMSDTIA-ELKSRYDLIFF
A0A3C1HEJ2      IIQ-KSQT------E----NFCFIGAGTKS-PNPSELLAQPGFKQLLT-EALSHFDQVVI
A0A522ULD9      TIK-PTAI------P----NLHFLPSGKLP-KTSIGLLDSQRMRELVK-DLKARYDYVFF
A0A1V6JU76      VIQ-TTEV------T----NLDVACCGQIR-SQPSELLGSQRMVQFMQ-ELSKRYDRVIL
A0A1Q6UHJ9      CVI-KDYY------P----NLDVLPCEKRS-QNPTQALSSEEFISMIA-KFREQYDKVFI
A0A2V2BXR0      CVI-KDYY------P----NLDVLPCEKRS-QNPTQALSSEEFISMIA-KFREQYDKVFI
A0A2D8V0G3      ITQ-TTEV------P----NLDLICCGAVP-NNPSELVGSKRMGELLD-SLRDRYDRIFV
A0A348S017      ITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFV
A0A3C1UUV7      ITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFV
A0A350I3V2      ITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFV
A0A520RGV5      ITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFV
A0A3D3XF90      ITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFV
A0A2D7B522      ITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFV
A0A356NIC2      ITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFV
A0A2U8DZK4      CRS-RNIA------P----GLDFIPSGTIS-GFTLSLFYADRLKEILA-DLRTQYDRIVF
A0A2T6DFL8      VIQ-KSIS------P----GLDFIASGAAG-NFTLSLIYANRLRELMT-TLRGRYDRIVF
A0A1D8AWD4      AVV-RDKS------G----LIDFIPAGAAANNVTLGLLYATKLKALVE-EFRGRYDKVLF
A0A4Q1C9S2      AVQ-RDKS------G----LIDFIPAGALANNITLGLLYANKLRELVA-HCRSRYDKVLF
A0A178IH18      VTR-RSIA------P----NLDFIPCGSVG-GFTLSLLYADRLKALLA-GLGKSYDRIMF
A0A2T6DT99      VTQ-REIQ------P----NFDFIPCGSVG-SFSLTLLYVDRLKALIQ-ELRGQYDRIVF
A0A1G3ZT33      VVR-RDVV------P----GLDFIASGTPG-GFTLSLLYANRLRELIA-QCKGRYGRIVF
A0A3E1E2T2      VIQ-KGLA------P----NLDFIPSGHAP-GFTLGLLHLNRLKDLIA-TLSGRYDKIVF
B1ZMW1          IVQ-RELA------P----NLDFIPSGGVP-GFTLGLLQVNRLKELIA-TLRGRYDKILF
A0A2N8HDG3      VIRTLPEH------A----GVDILYAGPHV-PNPVTLLSLPELGTLIQ-MFKERYDAVII
A0A146GCJ0      VVR-KTDQ------D----NLFLLPAGHRA-PNPSELLGGSEFREMLA-KLLLTYDRVVV
A0A2T6D6H8      VVK-KTPY------E----NLFLLPGGHRA-PNPAELLNEDDFQKMLD-ELLKSYDRIVV
A0A3D1TI55      TIK-STSV------P----NLHFLPSGKLP-RTSVGILNSQRMRELIK-TLKSRYDYIFF
A0A3R8IT45      VVM-RDVA------P----NLDVIATGGRA-KSPTQILNSKNFEIMIA-ELRKRYDRIFI
A0A1H1MGC9      VLC-RNVH------P----NLDVIPAGGRA-KNPTQILNSKNFELMLS-ELRKRYDRIFI
A0A2A2PYE8      VAI-RNVH------P----NLDVIPAGGRA-KNPTQILNSKGFELMIS-DLRKQYDRVFI
A0A2T6CN73      VIV-RNQQ------P----NLDVLPTGGRA-KNPTHILNSKAFETMIA-DLRKRYDRVFI
A0A3E1ET42      VIL-QTPI------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKNRFDLVLI
A0A2A2YDW8      VIL-QTPV------E----NLFFMPSGILP-ADAAGILNSRRMSELIA-DVKQRFDLVLV
A0A352XLN9      VIL-QTPV------E----NLFFMPSGILP-ADAAGILNSRRMSELIA-DVKQRFDLVLV
A0A3D0YP62      VIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLV
A0A3D3DV47      VIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLV
A0A2E5XJ49      VIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELIE-DVKQRFDLVLV
A0A2E6SBY8      VIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELIE-DVKQRFDLILV
A0A2E5QMS4      VIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELVQ-DVKQRFDLILV
A0A2E7YXQ3      VIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELVQ-DVKQRFDLILV
A0A2E3H787      VIL-QTPV------D----NLYXLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A2E7AGN1      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A2E7AKY7      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A3D4CU34      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A2E8M146      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A355S8S2      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A2D6DVN8      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A3C1W2R2      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A2E3NAY6      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A2E3II01      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A368B8C5      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A3R7RBB5      VIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLV
A0A2A2QX62      VIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLV
A0A4Q3BWH6      VIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLV
A0A3N5WCF1      VIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLV
A0A4Q3C1K5      VIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLV
A0A2G4G428      SIV-KNVA------P----NLDVLPVGMSC-RNPTQVISSAKFIEMLT-DMRSRYDRIFI
A0A139TV24      VIHPLPDH------P----GVDILYGGPHV-PNPVSLLSRPEIEQLIQ-SFKRSYDAVII
A0A2N8HT11      VIRTLPEH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVII
R7DS70          VIRTLPEH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVII
A0A2N8HNL6      VIRTLPEH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVII
A0A6I1K459      SVQ-KTRF------E----NLFLLTAGRTV-PNPAELLSGQWARQLIR-EAAGKFDHVVL
A0A139TUL1      VLQSGENF------P----GFDMVPAGPVP-PNPAALLTQGRFEDLIR-YWRTRYDRIIV
A0A2N8HCB0      VLQSGRKF------P----GFDLVTAGPVP-PNPVALLTQDRFEELLR-YWRARYDRIIL
A0A2N8HP04      VLQSGKRF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRARYDRIIL
A0A2N8HRJ0      VLQSGKRF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRARYDRIIL
A0A366HAG0      VVV-QTQV------D----HLYFMPSGVMP-ADSAGLLNSQKFVDLLT-DVKSRFDLVLI
A0A3M1I8A3      ELVTATEV------P----NLDMISCAGGS-SQSTELVASRRMVQFLD-EARKRYDRVIL
A0A4V0XS84      EIINTSKV------P----NLDVVCCGSIP-MIPSELIGSKRMEKFLL-DMRERYDRVVF
A0A0R2XQ77      VIL-KEVY------P----NLDVLPSGGKS-KNPTQVLNSARFEAMIA-DLRDRYDRIVI
A0A2E9IN28      VII-KEVY------P----NLDVLPTGGKS-KNPTQVLNSARFEAMFA-DLRDRYDRIVV
D5ENH7          VTI-REVY------P----NLDVIPTGGKS-KNPTQVLVSAPFEAMLA-DLRDRYDRIVI
A0A351WE84      CVK-PTIV------P----NLSFLPSGRLP-RSMMGIIDSQRMRELVK-DLKSRYDYVFF
A0A1V5QDZ6      TIK-TTSV------P----NLHFLPSGKLP-RTSLGLLDSQRMRELVK-NLKARYDYVFF
A0A4Y8P964      AIQ-STAI------P----NVWAIGGGRAA-IHPADLLGSESMQYLTQ-LVRQYFGYVLI
A0A3D4HF88      VVH-KDVY------P----NLDVMGSGGHS-QKSTQILNDKRFIALLE-DLRGSYDRVFI
A0A351MR11      AIL-KDFE------P----NLDILPVGGIC-KNPTQVINSPRFDELIR-ELRTRYDRIFI
A0A6G6K641      VLQ-STPV------A----DLDVLPAGSRS-PNPSELLSGKSLPRLIR-DLLERYDKVVI
A0A5B5WI95      HII--RQA------GENNTPFDFLGTGPAA-PNPVTLLSQPLLAQILE-CFRKKYDAVII
A0A2N8I9W1      GII--RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVII
A0A4Q5IH27      GII--RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVII
A0A2N8IBZ6      GII--RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVII
A0A2N8IJW9      GII--RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVII
R6J100          GII--RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVII
A0A1V6J089      VIQ-ETGV------P----NLWMLTSGRLR-RGTIGIMNNTRLRNLLD-HLKEQYDYILL
A0A3C1BZR1      VIQ-ETGV------P----NLWMMTSGRLR-RGSLGIMNNARLRALMD-SLKEKYDFVLL
A0A1H6KPB7      VIL-QTHV------D----NLYILPAGPTP-SDASGVLNSYRMRELLD-EVRRRFDIVLI
A0A2E9ISN4      IHIVKLKH------E----PISILPAGVFD-DSLPEKVNAARLRGLVH-SLQQDYDVIII
B9XAX1          LVL-KTPY------P----NLYILTAGPKV-ANPAEELGGDAIKQLLL-EASNQFDRIVI
A0A5R8KKM9      VVL-ETPI------E----NLFLMPSGLMP-ADSSGMLNSPRFRQLLD-DVKSRFDIVLI
A0A139TS01      VIF-QTPV------E----NLYVMPAGPVP-FDPSGALNSRKFSELLQ-EVKQRFDIVLV
A0A3E1EJT7      IIV-KNVH------P----YLDIISTGGRA-KNPIQLFNSKEFETLVV-ELSKRYDRVLF
A0A317ZP96      VIV-KEVY------P----NLDVLPSGGKS-KNPTQILNSASFESMLA-ELRDRYDRIII
A0A2D5WGA5      VIQ-TTEL------P----SLHFIPSGKLP-SSSMGILSSAKMKEFVT-EMKSRYDYVFL
A0A2E7SSH2      VIQ-TSDS------P----NLHFIPSGKLP-SSSMGVLNSSKMKEFVA-EMKSRYDYVFF
A0A349GXM8      VIQ-PARI------E----NLFVAPSGGDI-DDSAELLQTVDVRGFFV-DVQDDYDYIFV
A0A4P5YP61      IVQ-QTGI------E----NFSFIPAGTTA-PNPAELLGQHGIDGLVA-EALLNYDRVVI
A0A6B2LYM4      YIY-KDFL------P----NLDLLPAGGNT-KKPTQILGSEEFANLIH-ELRLRYDRVII
A0A6D1VXB3      ALQ-LSTI------P----NVWAISGGRAA-IHPTDLLGSESMHSLIQ-LVRQYFCYILI
I0JYY7          ALQ-LSTI------P----NVWAISGGRAA-IHPTDLLGSESMHSLIQ-LVRQYFCYILI
A0A4R7S1J2      VIH-SSPI------PAHSGTFRVIPAGFRS-PNPAELLASNAFPQLLE-LALKHFDRVVI
A0A2A2XV69      VVH-KTKV------E----NLFFMPSGLLP-RDAVGILNSQRMMEVIQ-ETKSRFDIVFF
A0A651H7X9      LAK-RSPH------E----NLDVILTGGRA-KQPSQILNSADFERFIA-EARQRYQRIII
A0A4Y8P842      AVQ-ATSL------P----NVWAIVGGRAA-IHPADLLGAESFGQLCR-YLREYFAYILI
B3DZK9          AVQ-PTSL------P----NVWAIVGGRAA-LHPADLLGAESFSQLCR-SLREYFTYILI
A0A5E6MPC4      AVQ-ATAL------P----NVWAIGAGRTP-CHPADLLGAAAMAYLCQ-WARGHFTYVIL
A0A4V1SB02      AIR-ATAV------Q----HLSLMPSGRRA-PNPAELLAQGGVEKLIQ-QLLAKYDRIVF
A0A3C1VB86      LCQPHQDV------P----KLSWMAAGSSV-PNPSELLMSADFQKLLS-EGLAHYDRIVI
A0A146G2Q9      VVN-QTKI------D----NLFLMTSGRLP-ADAVGILNSQRMVDLIE-EVKHRFDIVFF
A0A2T6D3Y2      VVN-QTKI------D----NLFLMTSGRLP-ADAVGILNSQRMVDLIE-EVKHRFDIVFF
A0A2V2SDV4      VIQ-TTSL------P----TLDFMASGKLP-SSSLGILNSPQMKELIG-QLKQHYDFVFF
A0A2V5PK75      VIR-TTPL------P----TLDFLASGKLP-SSSLGILSSAQMKELIN-ELKQRYDFVFF
A0A1V6DME1      VIQ-TSPL------A----TLDFLPSGKLP-SSSLGILNSAQMKDLIA-QLKQRYDFVFF
A0A3D3DIJ3      VIQ-TTSL------P----TLDFLSSGKLP-SSSLGILSSTQMKDLIG-ELKQRYDFVFF
A0A2D5VY59      VIQ-TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFF
A0A2D8UZZ4      VIQ-TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFF
A0A353DV86      VIQ-TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFF
A0A2E5EPT8      VIQ-KTDQ------A----DLDLLPSGKLP-SSAMGILNSQQMRDFVK-EVQSRYDFILL
A0A6I1K583      VIQ-TTSL------P----NLNFLPSGRLP-SSALGILNSPQMKEFIK-EAKRRYDFVFF
A0A350EWA4      VVQ-TSSL------P----SLDVMPSGKLP-SSSMGILSSVRMKQLVK-ELKSRYDFVFF
A0A5B5WZ91      VIF-QTPV------E----NLYVMPAGPIP-FDPSGALNSRKFSELLQ-EVKQRFDIVLV
A0A2N8HD92      VIF-QTPI------E----NLYVMPAGPTP-FDPSGTLNSRKFSELLQ-EVKQRFDMVLV
A0A2N8HIT2      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A354EBD3      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A355VEB2      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A2N8IMT3      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
R6K1U5          VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A2N8IWC2      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A2N8I441      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A2N8I3A6      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A410SCC4      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A3R5VEW0      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A411SSG2      VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
B2UKW3          VIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLV
A0A1M6RLZ4      VIL-QTPI------D----NLFFMPSGILP-ADAAGILNSRRMSDLVQ-DVKQRFDLVLI
A0A354T7G8      VVI-RTQV------E----NLFFLPSGLLP-ADSAGLLNSQRMVDLIA-DVKSRFDLVLI
A0A2S7U4L6      VVL-QTSI------E----NLYFMPSGILP-ADASGILNSRRMSELIQ-EVKSRFDLVLV
A0A512MBZ2      VVV-RTPI------D----NLYFLPSGLLP-ADSAGILNSQRMSELIA-DVKSRFDLVLI
A0A2E8MEZ0      VIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELLQ-DVKQRFDLVLV
A0A4Q2YKS3      VIL-QTPV------D----NLYFMPSGILP-SDAAGILNSRRMSELIQ-DVKQRFDLVLV
A0A6B3LBV6      VIL-QTPI------E----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKSRFDLVLV
A0A2E3EC33      VIL-QTAY------E----NLYFMPSGILP-SDAAGILNSRRMSELIA-DVKSRFDLVLV
A0A2E4GN01      VIL-QTAY------E----NLYFMPSGILP-SDAAGILNSRRMSELXA-DVKSRFDLVLV
A0A1Z8XU55      VIL-QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFI
A0A2E1RQR9      VIL-QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFI
A0A2E3ISQ4      VIL-QTAY------E----NLYFMPSGILP-ADAAGILNSKRMSELIA-DVKSRFDLVFI
A0A2D6W6F4      VIL-QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-XVKSRFDLVFI
A0A2D8Z5A8      VIL-QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFI
                                    .                                 :  :..

A0A2A2XVF1      DSAPVNAVSDTLILAPH-ADKTILVIHA--GKTPRKAIQRSVHLLR-KAQAKVAGFVLNR
A0A2V5UHJ2      DSSPLMAVSDAVFLSTM-VDGTLLVIN---RRTPKPLLRKARARLT-TPHSKILGMLLNR
A0A2V5PST3      DSSPAIAVSDPVILSNV-ADGVILVFHA--QKTTAASARKTKERFD-AIRAPILGVILNG
A0A2V5PXM3      DSAPVHAVSDTLLILDR-VQTLCLVVRS--RKTPRNSVLRAVQMLN-EAGAPLAGVILNL
A0A139SU05      DSPPLGAVTDGLLIAER-VDEVAYVCRF--NRAHRKHIQLYMRALR-NAKTEVLGVVLNG
A0A1D8AZK8      DSPPMGAVTDSLLISER-TDEIIYVCRF--NRAYRKHIRLYIKQLR-ESKNELLGIVLNG
A0A1V5QB01      DCPPVMAVSEAAILTSL-AEGVVMVVWA--GHTSRKLVQLAAKLIQ-ERGARILGCVLNN
A0A139SPN4      DSPPLGAVTDGLLIAER-VDEVAYVCRF--NRAHRKHIQLYMRALR-NAKTEILGVILNG
A0A1V6E7N1      DSPPLGAVTDSLLLAER-TDEIVYVCRF--NKALRKHIQLYTKLLL-SGKNEVLGIVLNG
A0A2D9MYT1      DCPPVSAVSDPLIIAAN-TDGTVFVNKF--NKIRREHARKTVQRVQ-DAGINIVGVCIND
A0A258ANJ7      DTAPLIPVNDTLELGTL-ADSTFLVVRC--NRTPADIILEAIRKLH-QTGIPITGLVLNR
A0A139TLN4      DCVPYASLADARIAARL-ADATLYVMRA--GCVKKRDLSSLQKTWK-SGELKRMGIVLCD
A0A290QGD9      DTPPIAAVSDALIILPL-VDGSIFTVFF--NKVRRRAAQYAARRLI-DSHVPNFGAVLNG
A0A1D8AS58      DTPPLAAVSDALIILPL-VDGSIFTIFF--NRVRRKAAQFSARKLL-EANVPCFGAVLNG
I6AQC1          DTPPLAAVSDALIILPL-VSGSIFTIFF--NKVRRKAAQHAARKLL-ESNVPVYGAVLNG
W0ITH7          DTPPLAAVSDALIILPL-VSGSIFTIFF--NKVRRKAAQHAARKLL-ESNVPVYGAVLNG
A0A1G3ZFT0      DTAPVLLVTDAVLISAT-SATNYLVLGS--NVHQASHLEMAIKRLS-SAGVTVHGSIFNF
A0A1Z8ZMT6      DSAPLLPVPDTRILAPL-VDNLALVIRA--DHTPVKSIQGALEMLK-DDGVSSSGVILND
A0A2E8MCT7      DSAPLLPVPDTRILAPL-VDNLALVIRA--EHTPVKSIQRAFDMLE-DDGVFSSGVILND
A0A290Q2Z2      DAPPIIGVSDASVLASV-ADDVLLLVQH--RRNPHSMVVRAQQIIE-GLHKQIVGVVLNR
A0A2A2RGK2      DSAPLLAVSDTLLIAPH-IDLCTLVVRA--FTTPKKMVMRAIKSLE-ETKTTPAGLILNF
A0A2A2XXF7      DSAPLLAVSDTLLVAPH-VDLCTLVVRA--FGTPRKMVARAIKSLE-ETKTHPAGLILNF
A0A2A2R5D6      DAPPVLGISDGAVLAHE-VDFTLLVIQH--RRYPRDISMRAKRAVE-EVKGNLLGVVLNA
A0A2V2DJ66      DSPPIGAVSDAISLLPE-VDGVLYVIKF--NTAKRKVVRRCVRRMM-ESNVPILGAVMNM
R7L5A9          DSPPIGAVSDAITLLPT-VDGVIYVVKF--NTVKRKTIRAYIRRMM-ESNVPILGAVMNM
A0A1J4XH17      DTPPLGVVSDIMNILPY-TDGLIFVVKF--NSVKRKTAKAHLSRLL-ESNVPVFGAVINQ
A0A3C1VJ32      DSPPILGVSDASILASE-VDLVMQVIQY--RRYPQPMTIRAKQMIE-KVGGNFVGMVLNN
A0A2N9NTX7      DSPPIMGVSDASILASE-VDMTLQVIQY--RRYPQPMNIRAKQLIE-KVGGNLIGIVLNN
B9XK55          DSPPIMGVSDASILASE-VDMTLQVIQY--RRYPQPMNIRAKQLIE-KVGGNLIGIVLNN
A0A4P5YMI6      DSPPIMGVSDASILVSQ-MDLAMLVVQF--RKYPQAMSVRAKQTIE-KVGGNLMGAVLNN
A0A2E6T482      DAPPIMGVSDASVLASM-VDMCVLVVQY--RKYPQLMTQRAKEMVT-KVGGDLVGVVLNN
A0A3C0DQZ7      DAPPIMGVSDASVLASM-VDMCVLVVQY--RKYPQLMTQRAKEMVT-KVGGDLVGVVLNN
A0A1Z9CBK5      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQXMTQRAKDMVV-KVGGNLVGVVLNN
A0A2D6ZI96      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQXMTQRAKDMVV-KVGGNLVGVVLNN
A0A358KGZ3      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKDMVI-KVGGDLVGVVLNN
A0A2E9ZQX4      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKDMVI-KVGGXXVGVVLNN
A0A3D5JZU0      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKDMVI-KVGGDLVGVVLNN
A0A2E6HCR0      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKDMVI-KVGGDLAGVVLNN
A0A1Z8WN04      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKEMVT-KVGGNLIGVVLNN
A0A2D7L1N4      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKEMVT-KVGGNLIGVVLNN
A0A2E2R937      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKEMVT-KVGGNLIGVVLNN
A0A520QQY4      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKEMVT-KVGGNLIGVVLNN
A0A2D5MR66      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKEMVT-KVGGNLVGVVLNN
A0A2E0PDQ1      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKDMVT-KVGGNLVGVVLNN
A0A2E2ZZP9      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKDMVT-KVGGNLVGVVLNN
A0A2A2RGF2      DAPPIMGVSDATVLASG-ADLAILVIQY--RKYPQSLAIRSRQMVE-KVGGRLIGVVLNN
A0A2G4I5Y6      DAPPIMGVSDATVLASG-ADLAILVIQY--RKYPQSLAIRSRQMVE-KVGGRLIGVVLNN
A0A3M1I883      DSPPIMGVSDASILCSM-VDIALLVVQY--RKYPQAMTLRAKQMVQ-KVGNNLLGIVLNN
A0A1V6JZ45      DSPPIMGVSDASILASE-VDLSVLVVQY--RKYPQAMTLRAKQMVE-KVGGTMLGVVLNN
A0A520RRW5      DSPPIMGVSDASILASE-VDMAILVIQY--RKYPQAMTIRAKQMVE-KVGGNLLGVVLNN
A0A356NPK0      DSPPIMGVSDASILASE-VDMAILVIQY--RKYPQAMTVRAKQMVE-KVGGNLLGVVLNN
A0A2D7B5P5      DSPPIMGVSDASILASE-VDMAILVIQY--RKYPQAMTVRAKQMVE-KVGGNLLGVVLNN
A0A3D3XGB5      DSPPIMGVSDASILASE-VDMAILVIQY--RKYPQAMTVRAKQMVE-KVGGNLLGVVLNN
A0A2V6F8A1      DSPPIMGVSDASILASE-VDLALLVIQY--RKYPQAMTLRAKQMVE-KVGGTMLGVVLNN
A0A2V5TNH4      DSPPIMGVSDASILASE-VDLSLLVIQY--RKYPQAMTIRAKQMVE-KVGGALLGVVLNN
A0A2V5X5Q6      DSPPIMGVSDASILASE-VDLSVLVIQY--RKYPQAMTIRAKQMVE-KVGGAMLGVVLNN
A0A4P5QM05      DSPPILGVSDASILVSE-VDNTIMVVQY--RRFPRNMLQRVKSTVA-HVGGNLIGVVLNN
A0A4Q3C001      DSPPILGVSDGSVLASE-VDMTIMVVQH--RRFPRAMLQRVKQAVI-QVGGTLIGVVLNN
B4DB23          DSPPILGVSDGSVLASE-VDVTIMVVQH--RRFPRVMLQRVKQAVL-NVGGRLIGVVLNN
A0A6B3L938      DTPPVLPVSDTRLIAQH-AQKSILVVRA--LKTPVGAVLRARDLLQ-DAKISLAGVVVNA
A0A2V5URB2      DSPPIMPVSDAVVLSTL-TDGMIFVVRG--QNTPKHIVREAISQLG-NNRSKILGVVLNR
A0A5R8KA81      DTAPIHAVSDTLHMVSF-CKFVCLVARC--SKTPRKAVIRAAQMLE-EAGKAPSGIILNM
A0A5B5WU87      DCVPYASLADARIVARL-ADATLYVMRA--GCVRKRDLPCLQKTWK-NGKLKRMGIVLCD
R7DZW0          DCVPYSSLADARIVARL-ADVTLYVMRA--GCVKKRDLAGLQKIWK-NGELKRMGIVLCD
A0A2N8HID1      DCVPYSSLADARIVARL-ADVTLYVMRA--GCVKKRDLAGLQKIWK-NGELKRMGIVLCD
A0A2N8HS06      DCVPYSSLADARIVARL-ADVTLYVMRA--GCVKKRDLAGLQKIWK-NGELKRMGIVLCD
A0A3R5R2M8      DAPPYGILADTAILASW-SDISLYLTRS--GMIDKRYFPQVQKLAD-TGKLPNLAFIING
A0A411SUQ6      DAPPYGILADTAILASL-SDITLYAVRS--GKIDKRYLLQIQQLAD-QGKLPNMAYIING
A0A2N8HZF2      DAPPYGILADTAILASL-SDITLYTVRS--GKIDKRYLLQIQQLAD-QGKLPNMAYIING
A0A354E720      DAPPYGILADTAILASL-SDITLYTVRS--GKIDKRYLTQIQQLAD-QGKLPNMAYIING
B2UPB6          DAPPYGILADTAILASL-SDITLYAVRS--GKIDKRYLLQIQQLAD-QGKLPNMAYIING
A0A2A2XXW5      DCPPVSAVSDPLIVGAM-ADGMVFVTKF--NKIRREHALRSVQRIQ-DSGIHLVGLVLND
A0A2V6JLK8      DSPPILGVSDASVIASE-VDQTVIVVQH--RRFPRAMLTRVKQAIL-GVGGTVLGVVLNN
A0A2W5Z1A5      DSPPMLGVSDASVLASE-VDQTIIVVQH--RRFPRAMLTRVKQAIT-GSGGTVLGVVLNN
A0A2V6EA09      DSPPMLGVSDASVLASE-VDETIIVVQH--RRFPRAMLTRVKQAIL-SVGGTLLGVVLND
A0A2V6GQI7      DSPPMLGVSDASVLASE-VDETIIVVQH--RRFPRAMLTRVKQAIL-SVGGTLLGVVLND
A0A3C1HEJ2      DSAPVHPVSDTLLLAHR-AKTVCVVVRA--NKTPRKAALTAVQKLQ-KSRANIAGFILNG
A0A522ULD9      DSPPIIGVTDASILASE-VDGVMLVVQY--RKFPKVISMRAKRMIE-NTGSHILGVVLNN
A0A1V6JU76      DCPPVSAVSDPLILSAM-ADAVVFVTKF--NKVRRDHARRTIQRIQ-DAGIHICGVVLND
A0A1Q6UHJ9      DSPPVGAVSDAIALLPY-VDGVIYIVKF--NSVSRKAIQKNVRRLM-VSNVPVVGAIMNM
A0A2V2BXR0      DSPPVGAVSDAIALLPY-VDGVIYIVKF--NSVSRKAIQKNVRRLM-VSNVPVVGAIMNM
A0A2D8V0G3      DCPPVSAVSDPLMVGAR-TDGMVFVSKF--NKIRREHARKTVQRIQ-DAGIYILGTVIND
A0A348S017      DCPPVSAVSDPLMIASR-SDGIVFVSKF--NKIRRDHARKTIQRIQ-DAGIYILGTVIND
A0A3C1UUV7      DCPPVSAVSDPLMIASR-SDGIVFVSKF--NKIRRDHARKTIQRIQ-DAGIYILGTVIND
A0A350I3V2      DCPPVSAVSDPLMIASR-SDGIVFVSKF--NKIRRDHARKTIQRIQ-DAGIYILGTVIND
A0A520RGV5      DCPPVSAVSDPLMIASR-SDGIVFVSKF--NKIRRDHARKTIQRIQ-DAGIYILGTVIND
A0A3D3XF90      DCPPVSAVSDPLMIASR-SDGIVFVSKF--NKIRRDHARKTIQRIQ-DAGIYILGTVIND
A0A2D7B522      DCPPVSAVSDPLMIASR-SDGIVFVSKF--NKIRRDHARKTIQRIQ-DAGIYILGTVIND
A0A356NIC2      DCPPVSAVSDPLMIASR-SDGIVFVSKF--NKIRRDHARKTIQRIQ-DAGIYILGTVIND
A0A2U8DZK4      DAPPIIGVSDSAVITSL-IDHVLLLIQY--RRNPLSMVLRAQQTIL-GLDKEILGVVLNR
A0A2T6DFL8      DSPPIIGVSDTSVLMTV-VDGVVLLIQH--RRNPQSMVLRAQQIVG-GVKASILGIVLNQ
A0A1D8AWD4      DSPPIIGVSDASVLASL-ADGIVLLIQH--RRNPESMVQRAKQIID-GLKVPVIGVVLNQ
A0A4Q1C9S2      DSPPIIGVSDASVLGSL-ADGIVLLIQH--RRNPESMVQRAKQIIDQQVKVPVIGVVLNQ
A0A178IH18      DAPPIIGVSDASVITSL-VDDVLLLVQY--RRNPQSMVVRAQQIIA-GLHKEILGIVLNR
A0A2T6DT99      DAPPIIGVSDASVLASV-MDDVLLLVQH--RRNPQSMVMRAQQIIE-GLGKTIVGIVLNR
A0A1G3ZT33      DSPPVIGVSDASVLSSV-VDGVVLLIQH--RRNPQSMVLRAKQIIE-GLKTPLVGVVLNQ
A0A3E1E2T2      DSPPIIGVSDASVLASA-VDGTVLLIQH--RRNPQSMVVRAQQIVE-SLKAPLLGVVLNQ
B1ZMW1          DSPPIIGVSDASVLASV-MDGAVLLIQH--RRNPQSMVLRAQQIVE-AIKTPLLGVVLTQ
A0A2N8HDG3      DSPPYGILADTAILAGH-ADISLYVVRS--NRIDKRHISTVQQLAD-SGQLPNLGFIINA
A0A146GCJ0      DSAPVNAVSDALLIASC-VDTACLVVRA--GKTPKKASLRAVKQLQ-KSGAKLAGFIFNR
A0A2T6D6H8      DTAPVNAVSDVLLIANC-IQTTCLVVHA--GRTPKKAVLRAVRQLQ-KTGARLGGFVFNR
A0A3D1TI55      DSPPIVGVSDASVLASE-VDLALLVVQY--RKYPKVMSNRAKKMVE-NVGGRLVGVVLNN
A0A3R8IT45      DTPPLAAVSDALIILPL-ANGAIFTIFF--NKVRRKAAQHAARKLL-ESNVPVFGAVLNG
A0A1H1MGC9      DTPPLAAVSDALIILPL-LDGSLFTIFF--NRVRRKAAQFSARKLL-EVNVPCFGAVLNG
A0A2A2PYE8      DTPPLAAVSDALIILPL-VDGSIFTIFF--NKVRRKAAQFSAKKLL-EANVPNFGAVLNG
A0A2T6CN73      DTPPLAAVSDALIILPL-VDGSIFTIFF--NKVRRKAAQFAAKRLL-DSNVPNFGAVLNG
A0A3E1ET42      DSPPILGVSDASVLASE-VDLTIIVIQH--RKLPRSMLLRVKQAIE-NVGGNLLGVVLNN
A0A2A2YDW8      DSPPILGVSDASVLASE-VDLTIIVVQH--RKLPRNMLLRVKQAVE-NVGGHVLGVVLNN
A0A352XLN9      DSPPILGVSDASVLASE-VDLTIIVVQH--RKLPRNMLLRVKQAVE-NVGGHVLGVVLNN
A0A3D0YP62      DSPPILGVSDASVLASE-VDLTIVVVQH--RKLPRNMLVRVKQAVE-NVGGHVIGVVLNN
A0A3D3DV47      DSPPILGVSDASVLASE-VDLTIVVVQH--RKLPRNMLVRVKQAVE-NVGGHVIGVVLNN
A0A2E5XJ49      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLLRVKQAVE-NVGGQVIGVVLNN
A0A2E6SBY8      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRXMLLRVKQAVE-NVGGQVIGVVLNN
A0A2E5QMS4      DSPPILGVSDASVLASE-VDLTIVVVQH--RKLPRNMLMRVKAAVE-NVGGQVIGVVLNN
A0A2E7YXQ3      DSPPILGVSDASVLASE-VDLTIVVVQH--RKLPRNMLMRVKAAVE-NVGGQVIGVVLNN
A0A2E3H787      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLLRVXQAVE-NVGGQVIGVVLNN
A0A2E7AGN1      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLMRVKQAVE-NVGGYVVGVVLNN
A0A2E7AKY7      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLMRVKQAVE-NVGGYVVGVVLNN
A0A3D4CU34      DSPPILGVSDASVLASE-ADLTMIVVQH--RKLPRNMLLRVKQAVE-NVGGYVVGVVLNN
A0A2E8M146      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLVRVKQAVE-NVGGHVIGVVLNN
A0A355S8S2      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLVRVKQAVE-NVGGHVIGVVLNN
A0A2D6DVN8      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLVRVKEAVE-NVGGHVIGVVLNN
A0A3C1W2R2      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLVRVKEAVE-NVGGHVIGVVLNN
A0A2E3NAY6      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMXVRVKEAVE-NVGGHVIGVVLNN
A0A2E3II01      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLVRVKEAVE-NVGGHVIGVVLNN
A0A368B8C5      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLVRVKEAVE-NVGGHVIGVVLNN
A0A3R7RBB5      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLVRVKEAVE-NVGGHVIGVVLNN
A0A2A2QX62      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLMRVKQAVE-NVGGHVIGVVLNN
A0A4Q3BWH6      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLMRVKQAVE-NVGGHVIGVVLNN
A0A3N5WCF1      DSPPILGVSDASVLASE-VDLTMLVVQH--RKLPRNMLLRVKQAVE-NVGGHVIGVVLNN
A0A4Q3C1K5      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLLRVKQAVE-NVGGNVIGVVLNN
A0A2G4G428      DSPPIGAVSDALNLIPN-VDGVIYVVRY--NFVSTRNVAECITRLR-EVGVPILGAVLNR
A0A139TV24      DAPPYGILADTAIFAKL-ADISLYVIRS--NKIDKRYIATIQQLAN-EGKLPNMGFVINA
A0A2N8HT11      DSPPYGILADTAILASH-ADISLYVIRS--NRIDKRHIATVQQLAE-SGQLPNMGFVINA
R7DS70          DSPPYGILADTAILASH-ADISLYVIRS--NRIDKRHIATVQQLAE-SGQLPNMGFVINA
A0A2N8HNL6      DSPPYGILADTAILASH-ADISLYVIRS--NRIDKRHIATVQQLAE-SGQLPNMGFVINA
A0A6I1K459      DNAPVNAVSDALLIVKE-AQTVCLVANA--RKTSYRVVQRALEMLR-RAGAKPSGVVLNF
A0A139TUL1      DGCPYEAVADASLMARH-ADLVLYLIRC--GMIEKQYVPSIQEVAA-RGEFRSVALILNA
A0A2N8HCB0      DGCPYEAVVDASLMARH-ADLVLYVIRC--GMIEKQYVPAIQGLAD-KGEFRAVALILNA
A0A2N8HP04      DGCPYEAVADASLMARH-ADLVLYVIRC--GMIEKQYVPVIQGLAD-KGEFRSGAVILNA
A0A2N8HRJ0      DGCPYEAVADASLMARH-ADLVLYVIRC--GMIEKQYVPVIQGLAD-KGEFRSGAVILNA
A0A366HAG0      DSPPIIGVSDASVLAAE-ADMTIIVVQH--RKLPRQMLQRVKQTIE-QVGGKVAGAVLNN
A0A3M1I8A3      DTPPVSAVSDPLVVASL-SDGCVFVAKF--NKVRREHARKTLRRLL-DAGVHICGVLLND
A0A4V0XS84      DCPPVAAVSDALVLGTL-ADGVIFVVKF--NKIHRDHARKSIQRIQ-SAGINIFGTVVND
A0A0R2XQ77      DSPPLAAVSDVLNLLPL-ADGVLYVIKF--NTVKRKTAVVNVRRLW-ESNTPIFGAILNN
A0A2E9IN28      DSPPLAAVSDALNLLPL-VDGILYVIKF--NTVKRKTAVVNVRRLW-ESNTPVFGAILNN
D5ENH7          DSPPLAAVSDALNLLPL-VDGVVYVIKF--NTVKRKTAVANVRRLW-ESNTPVFGAILNN
A0A351WE84      DSPPIIGITDASILASE-VDGVLLVVQY--RKYPRVISSRAKRMVE-NVGGKLLGVVLNN
A0A1V5QDZ6      DSPPIMGVTDASILASE-VDGVLLVVQY--RKYPKIITSRAKRMIE-NVGGNVLGVVLNN
A0A4Y8P964      DTPPMHGMPDAAIIGTL-TDGLIYVIQN--GRTEKKDFLQNLQILA-SVNTKILGVVLNK
A0A3D4HF88      DSPPVAAVSDALNVLPH-VDGVLYVINY--NTVKRKTVKASVRRLF-ESNVPVFGVIMNQ
A0A351MR11      DSPPLGAVSDALHLVPK-VDGVIYVVRF--NLVKKRNAMSCIARLR-EAGVPIVGAVLNS
A0A6G6K641      DSAPIMAVSDTLVVAPH-VDTICLVVRS--HKTPAYAVMRASVALR-KTDKIPAGIVLNR
A0A5B5WI95      DTPPYGILADTAILAAL-SDISLYLIRS--GMIDKRYFNQIQKLAD-SGKLPNLAYIINA
A0A2N8I9W1      DAPPYGILADTAILASL-SDITLYAVRS--GKIDKRYLLQIQQLAD-QGKLPNMAYIING
A0A4Q5IH27      DAPPYGILADTAILASL-SDITLYAVRS--GKIDKRYLLQIQQLAD-QGKLPNMAYIING
A0A2N8IBZ6      DAPPYGILADTAILASL-SDITLYAVRS--GKIDKRYLLQIQQLAD-QGKLPNMAYIING
A0A2N8IJW9      DAPPYGILADTAILASL-SDITLYAVRS--GKIDKRYLLQIQQLAD-QGKLPNMAYIING
R6J100          DAPPYGILADTAILASL-SDITLYAVRS--GKIDKRYLLQIQQLAD-QGKLPNMAYIING
A0A1V6J089      DSPPILGVTDAAILASE-VDGVLLVVQY--RKYPKIISLRAKRMIE-NAGGQVLGAVLNN
A0A3C1BZR1      DSPPILGVTDAAILASE-ADGVLLVVQY--RKYPKIISLRAKRMIE-NAGGRLMGAVLNN
A0A1H6KPB7      DSPPVLGVSDASLIVSK-ADATIMVVQP--RKLPMKALVREKMVIE-NAGGHLMGVVMNN
A0A2E9ISN4      DTAPVSIFSESLAFCQA-TGGVLVMMDSLTSQASVQNCLNELRGIR-TLGFCVNGVNESY
B9XAX1          DTPPINAVSDTFILLPL-AQIICLVVRA--GKTPKHAIMRAVELMA-RANVPPTGIVLNF
A0A5R8KKM9      DSPPILGVSDASVLAAE-ADLTLLVVQH--RKLPRHMLQRVKHSVD-AVGGDVVGVVLNN
A0A139TS01      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A3E1EJT7      DTPPLGAVSDALNILPL-MDGAIYTIHF--NRVRRKAAQQCTRRLL-AVNVPVFGAVMNG
A0A317ZP96      DTPPLAAVSDALNLLPL-VDGILYVIKF--NTVKRKTAVVNVRRLW-ESNTPVFGAVLNN
A0A2D5WGA5      DAPPIMGVSDASVLASM-VDMCVLVVQY--RKYPQLMTQRAKEMVT-KVGGDLVGVVLNN
A0A2E7SSH2      DAPPIMGVSDASVLASA-VDLCVLVVQY--RKYPQLMTQRAKDMVI-KVGGNLVGVVLNN
A0A349GXM8      DTSPVLRVTDTVILASQGIGQVLYVARV--NFTPKPMIRYSLDMLK-D--ANILGLVMNS
A0A4P5YP61      DSAPVHAVSDTLLMLKR-VQTVCLVARA--NKTPRKATLRAVQMLR-QAEAPLAGLILNR
A0A6B2LYM4      DTPPIATVSDAMNILPL-VDGVLMVIRF--NMVKRKTASVNIRRLR-ESNVPIFGAVLNN
A0A6D1VXB3      DTPPMHGMPDAAIIGSV-TDGLIYVIQA--GRIERKDFLQNLQILA-TVNARILGVVLNK
I0JYY7          DTPPMHGMPDAAIIGSV-TDGLIYVIQA--GRIERKDFLQNLQILA-TVNARILGVVLNK
A0A4R7S1J2      DTAPIVAVSDTLVIVPH-VQTVLLVIHW--KKTPSTVIQRALNLLG-ESGKSPSGLILNN
A0A2A2XV69      DSPPILGVSDASVLSSE-LDLTIIVVQH--RRFPKEMIQRVKQAIE-NVGGNILGVVLNN
A0A651H7X9      DTPPLAAVSDSLILLPL-VDGALFTIQF--NRVKRKAAQTVVRRLS-ETSVPVFGAILNG
A0A4Y8P842      DTPPMRGIPDASIVSMQ-TEGVLYVIED--GKDDRKEVQNNVEAFS-RINTRILGIILNK
B3DZK9          DTPPMRGMPDAPIVSMQ-SEGVLYVIED--GRDDRKEVQNNIEAFS-RINSRVLGIILNR
A0A5E6MPC4      DCPPLVGMPDAAVVATL-TDGVLLVIRD--GAVDRSDARRVVETLS-VVNTRILGIVLNR
A0A4V1SB02      DSAPVNAVSDTLSIAPL-ANAVCIVLRY--GKTPRRAILRAVGLLR-KSNARMAGVIMNR
A0A3C1VB86      DTAPILPVSDTLLLAGK-VQTVVLVVQA--CKTSRKAVERSVQLLK-NASAPTGGVVLNL
A0A146G2Q9      DSPPILGVSDASVLSSA-VDLTIIVVQH--RRFPRAMLQRVKQAVL-NVGGNILGVVLNN
A0A2T6D3Y2      DSPPILGVSDASVLSSA-VDLTIIVVQH--RRFPRAMLQRVKQAVH-NVGGNILGVVLNN
A0A2V2SDV4      DSPPVMGVSDASIIASE-VDMTLQVIQY--RRYPQPLNIRAKQLIE-KVGGNLVGIVLNN
A0A2V5PK75      DSPPIMGVSDASILASE-VDMTLQVIQY--RRYPQPMNVRAKQLIE-KVGGNLVGIVLNN
A0A1V6DME1      DSPPIMGVSDASILASE-MDMTVQVIQY--RRYPQPMNIRAKQLIE-KVGGNLIGIVLNN
A0A3D3DIJ3      DSPPIMGVSDASILASE-VDMTIQVIQY--RRYPQPMNIRAKQLIE-KVGGNLVGIVLNN
A0A2D5VY59      DSPPIMGVSDASILASE-VDMAILVIQY--RKYPQAMTIRAKQMVE-KVGGNLLGVVLNN
A0A2D8UZZ4      DSPPIMGVSDASILASE-VDMAILVIQY--RKYPQAMTIRAKQMVE-KVGGNLLGVVLNN
A0A353DV86      DSPPIMGVSDASILASE-VDMAILVIQY--RKYPQAMTIRAKQMVE-KVGGNLLGVVLNN
A0A2E5EPT8      DSPPLMGVSDATVLTSM-VDLTLLVIQY--RKYPQSLAVRSRQMIE-KVGGTLLGIVLNN
A0A6I1K583      DAPPIMGVSDATVLASG-ADLAILVIQY--RKYPQSLAIRSRQMVE-KVGGRLIGVVLNN
A0A350EWA4      DSPPIMGVSDASVLASE-VDLTLQVIQY--RRYPQPMTIRAKQMIE-KVGGNLLGVVLNN
A0A5B5WZ91      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A2N8HD92      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A2N8HIT2      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A354EBD3      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A355VEB2      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A2N8IMT3      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
R6K1U5          DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A2N8IWC2      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A2N8I441      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A2N8I3A6      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A410SCC4      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLVGVVMNN
A0A3R5VEW0      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A411SSG2      DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
B2UKW3          DSPPILGVSDSAVIVSE-VDMTLMVVQP--RKLPLKALLRQKQVIE-SVGGNLAGVVMNN
A0A1M6RLZ4      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRKMLVRVKQAVE-NVGGTVLGVVLNN
A0A354T7G8      DSPPILGVSDASVLANE-ADMTMIVVQH--RKLPRHMLMRVKQSVE-NAGGKVVGVVLNN
A0A2S7U4L6      DSPPILGVSDASVISSE-VDLTMIVVQH--RKLPRNMLVRVKQAVE-NVGGTVLGVVLNN
A0A512MBZ2      DSPPILGVSDASVLSNE-ADMTMLVVQH--RKLPRHMLMRVKQTVE-NVGGRVLGVVLNN
A0A2E8MEZ0      DSPPILGVSDAAVLASE-VDLTMVVVQH--RKLPRNMLLRVKQAVE-NVGGQVIGVVLNN
A0A4Q2YKS3      DSPPILGVSDASVLASE-VDLTMIVVQH--RKLPRNMLIRVKQAVE-NVGGHVIGVVLNN
A0A6B3LBV6      DSPPILGVSDASVLCSE-VDMTVVVIQH--RKLPRNMLQRVKKAVE-SVGGTLLGVVLNN
A0A2E3EC33      DSPPILGVSDASVLASE-VDLTIIVIQH--RKLPRGMLIRVKQAIE-NVGGKALGVVLNN
A0A2E4GN01      DSPPILGVSDASVLASE-VDLTIIVIQH--RKLPRGMLIRVKQAIE-NVGGKALGVVLNN
A0A1Z8XU55      DSPPILGVSDASVLSSE-VDLTIIVIQH--RKLPRGMLVRVKQAIQ-NVGGTALGVVLNN
A0A2E1RQR9      DSPPILGVSDASVLSSE-VDLTIIVIQH--RKLPRGMLVRVKQAIQ-NVGGTALGVVLNN
A0A2E3ISQ4      DSPPILGVSDASVISSE-VDLTIIVIQH--RKLPRGMLLRVKQAIQ-NVGGTALGVVLNN
A0A2D6W6F4      DSPPILGVSXASVISSE-VXLTIIVIQH--RKLPRGMLLRVKQAIQ-NVGGTALGVVLNN
A0A2D8Z5A8      DSPPILGVSDASVISSE-VDLTIIVIQH--RKLPRGMLLRVKQAIQ-NVGGTALGVVLNN
                *  *   .                                              .     

A0A2A2XVF1      LPTGRAA---------GYYYYYYGDKYEKDSVYGT-------------------------
A0A2V5UHJ2      INIHNNE---------YG--GYYQQYY----EYYSQDPPAITDNAPALSENGHGRLSRRS
A0A2V5PST3      INLEDPD----------Y--AYYRHYYGSDYGTVA-------------------------
A0A2V5PXM3      IPRSGGG----------YGYYYYDSYYAY--GYYG-------------------------
A0A139SU05      LTPRRVE---------YYSNYRYYRSY---GKYTE-------------------------
A0A1D8AZK8      LSPRRIE---------YYSNYRYYRSY---KKYYG-------------------------
A0A1V5QB01      LDFSRVG----------Y--YYYSTYY----GYYD-------------------------
A0A139SPN4      LAPRRVE---------YYSNYRYYRSY---GKYTN-------------------------
A0A1V6E7N1      LSPRRIK---------YYSNYRYYRSY---KKYYG-------------------------
A0A2D9MYT1      LDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A258ANJ7      LTQRTRS---------FD--QYYHR------SYYK-------------------------
A0A139TLN4      VENRSRP----------------SRKY----AMYR-------------------------
A0A290QGD9      LNMNVSG---------YYYGQYTDKSY---KDYYV-------------------------
A0A1D8AS58      LNLAVSG---------YYYAQYYDKSY---KDYYV-------------------------
I6AQC1          LNLAVAG---------YYYAQYYDKSY---KDYYV-------------------------
W0ITH7          LNLAVAG---------YYYAQYYDKSY---KDYYV-------------------------
A0A1G3ZFT0      HNATSKK--------SSY--QYYSSHY-----YYE-------------------------
A0A1Z8ZMT6      FTENRLQ----------------GGKYGYGYGYGQ-------------------------
A0A2E8MCT7      FTENRLQ----------------GGKYGYGYGYGH-------------------------
A0A290Q2Z2      VPVNSSD---------DY--GYYTRNY----AYYS-------------------------
A0A2A2RGK2      LPSGRGG---------YYAYYYSGKYY----GSYG-------------------------
A0A2A2XXF7      LPSGRGG---------YYAYYYSGKYY----GSYG-------------------------
A0A2A2R5D6      VAVKSDE---------AY--YYYSSYG----NYYY-------------------------
A0A2V2DJ66      VNTGAVS---------GYSINYYDKNY---QNYYM-------------------------
R7L5A9          VNPSSAS---------VYSMNYYDKSY---QNYYT-------------------------
A0A1J4XH17      ISLDIVN---------YYYSNYYDKTY---YDYYN-------------------------
A0A3C1VJ32      INMSQDE---------GY--YYYSGYY---HDYYY-------------------------
A0A2N9NTX7      INMSQDE---------SY--YYYSGYY---HDYYS-------------------------
B9XK55          INMSQDE---------SY--YYYSGYY---HDYYS-------------------------
A0A4P5YMI6      INIAQDS---------YY--YYYSGYQ---YTSEN-------------------------
A0A2E6T482      INISQDS---------YY--YYYSGYY---YDYYY-------------------------
A0A3C0DQZ7      INISQDS---------YY--YYYSGYY---YDYYY-------------------------
A0A1Z9CBK5      INISQDS---------YY--YYYSGYY---YDYYY-------------------------
A0A2D6ZI96      INISQDS---------YY--YYYSGYY---YDYYY-------------------------
A0A358KGZ3      INISQDS---------YY--YYYSGYY---YDYYY-------------------------
A0A2E9ZQX4      INISQDS---------YY--YYYSGYY---XDYYX-------------------------
A0A3D5JZU0      INISQDS---------YY--YYYSGYY---YDYYY-------------------------
A0A2E6HCR0      INISQDS---------YY--YYYSGYY---YDYYY-------------------------
A0A1Z8WN04      INISQDS---------YY--YYYSGYY---YDNYY-------------------------
A0A2D7L1N4      INISQDS---------YY--YYYSGYY---YDNYY-------------------------
A0A2E2R937      INISQDS---------YY--YYYSGYY---YDNYY-------------------------
A0A520QQY4      INISQDS---------YY--YYYSGYY---YDNYY-------------------------
A0A2D5MR66      INISQDS---------YY--YYYSGYY---YDNYY-------------------------
A0A2E0PDQ1      INISQDS---------YY--YYYSGYY---YDNYY-------------------------
A0A2E2ZZP9      INISQDS---------YY--YYYSGYY---YDNYY-------------------------
A0A2A2RGF2      INLASDA---------SY--YYYSG-----YNYHS-------------------------
A0A2G4I5Y6      INLASDA---------SY--YYYSG-----YNYRS-------------------------
A0A3M1I883      INISQDS---------YY--YYYSGYY---YDYYY-------------------------
A0A1V6JZ45      INISQDS---------YY--YYYSGYY---YDYYS-------------------------
A0A520RRW5      INISQDS---------YY--YYYSGYY---YDYYS-------------------------
A0A356NPK0      INISQDS---------YY--YYYSGYY---YDYYS-------------------------
A0A2D7B5P5      INISQDS---------YY--YYYSGYY---YDYYS-------------------------
A0A3D3XGB5      INISQDS---------YY--YYYSGYY---YDYYS-------------------------
A0A2V6F8A1      INISQDS---------YY--YYYSGYY---YDYYS-------------------------
A0A2V5TNH4      INISQDS---------YY--YYYSGYY---YDYYA-------------------------
A0A2V5X5Q6      INISQDS---------YY--YYYSGYY---YDYYA-------------------------
A0A4P5QM05      VDIHQDD---------SY--RYYSNYK----DYYG-------------------------
A0A4Q3C001      VDTRHDE---------GY--SYYNNYN----DYYA-------------------------
B4DB23          VDAKHDD---------GY--SYYYNYN----EYYG-------------------------
A0A6B3L938      LRVKHTG------GSGYY--GYHGYGEYGHEGYYG-------------------------
A0A2V5URB2      VDVRSAE------YRDYY--RYYNPEF-----YYP-------------------------
A0A5R8KA81      LPARRNS---------GLYYHYYSGSY-GKPVYGK-------------------------
A0A5B5WU87      VENHSRS----------------SRKY----AMYR-------------------------
R7DZW0          VEPHGRS----------------SRGY----AVYR-------------------------
A0A2N8HID1      VEPHGRS----------------SRGY----AVYR-------------------------
A0A2N8HS06      VEPHGRS----------------SRGY----AVYR-------------------------
A0A3R5R2M8      VNFKSAS----------Y--NYYGYGYGYGYGTGS-------------------------
A0A411SUQ6      VNFKSAS----------Y--SYYGYGYGYQYGYGT-------------------------
A0A2N8HZF2      VNFKSAS----------Y--SY--YGYGYQYGYGT-------------------------
A0A354E720      VNFKSAS----------Y--SYYGYGYGYQYGYGA-------------------------
B2UPB6          VNFKSAS----------Y--SYYGYGYGYQYGYGT-------------------------
A0A2A2XXW5      IDFEGKD-------------SYYYSYHYYQNQYYS-------------------------
A0A2V6JLK8      VDLKHDQ---------NY--YYYTNYY----GYYQ-------------------------
A0A2W5Z1A5      VDLRHDQ---------NY--YYYTNYY----GYYQ-------------------------
A0A2V6EA09      VDLKHDQ---------NY--YYYTHYY----AYYQ-------------------------
A0A2V6GQI7      VDLKHDQ---------NY--YYYTHYY----AYYQ-------------------------
A0A3C1HEJ2      ITLLHRS---------DY--YDYSDYY----ARYR-------------------------
A0A522ULD9      INIMRDD---------YY--YYYHSYY---ADYYY-------------------------
A0A1V6JU76      IDFEGRD-------------SYYYSYTYYQNRYYS-------------------------
A0A1Q6UHJ9      VSQGSAA---------GYSLNYYDKSY---QNYYT-------------------------
A0A2V2BXR0      VSQGSAA---------GYSLNYYDKSY---QNYYT-------------------------
A0A2D8V0G3      IDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A348S017      IDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A3C1UUV7      IDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A350I3V2      IDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A520RGV5      IDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A3D3XF90      IDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A2D7B522      IDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A356NIC2      IDFEGKD-------------SYYYSYYYYQNRYYA-------------------------
A0A2U8DZK4      VPKNAGA---------DY--AYYSKNY----AYYG-------------------------
A0A2T6DFL8      IPGNAGG---------DY--GYYTSNY----AYYH-------------------------
A0A1D8AWD4      VPTGTGE---------DY--SYYTNNY----SYYS-------------------------
A0A4Q1C9S2      VPTGSGE---------DY--GYYTNNY----SYYS-------------------------
A0A178IH18      VPKNAGD---------DY--GYYTNNY----AYYS-------------------------
A0A2T6DT99      VPRNSGE---------DY--GYYTHNY----AYYS-------------------------
A0A1G3ZT33      VPHGSGD---------DY--GYYTGNY----DYYS-------------------------
A0A3E1E2T2      VPLNSGD---------DY--GYYTNNY----SYYS-------------------------
B1ZMW1          VPENAGG---------DY--GYYTHNY----SYYS-------------------------
A0A2N8HDG3      VDFKAGS----------Y--SYYGYGY----HYGN-------------------------
A0A146GCJ0      LPVGGRS--------AGYYYYYYGGEYSKNSVYGE-------------------------
A0A2T6D6H8      LPVGGQS--------AGYYYYYYGGDYAKNGVYGA-------------------------
A0A3D1TI55      INVMRDD---------YY--YYYHTYY---SHYYG-------------------------
A0A3R8IT45      LNLAVAG---------YYYAQYYDKSY---KDYYV-------------------------
A0A1H1MGC9      LNLAVSG---------YYYAQYYDKSY---KDYYV-------------------------
A0A2A2PYE8      LNLAVSG---------YYYAQYYDKSY---KDYYV-------------------------
A0A2T6CN73      LNLVVSG---------YYYAQYYDKSY---KDYYV-------------------------
A0A3E1ET42      VDVRSDS---------QY--QYYTSYY----TYYS-------------------------
A0A2A2YDW8      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A352XLN9      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A3D0YP62      VDVRSDN---------QY--QYYTSYY----TYYA-------------------------
A0A3D3DV47      VDVRSDN---------QY--QYYTSYY----TYYA-------------------------
A0A2E5XJ49      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E6SBY8      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E5QMS4      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E7YXQ3      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E3H787      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E7AGN1      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E7AKY7      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A3D4CU34      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E8M146      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A355S8S2      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2D6DVN8      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A3C1W2R2      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E3NAY6      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2E3II01      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A368B8C5      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A3R7RBB5      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2A2QX62      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A4Q3BWH6      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A3N5WCF1      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A4Q3C1K5      VDVRSDS---------QY--QYYTSYY----TYYA-------------------------
A0A2G4G428      MSMRMAS---------VYTDSFDASYE----KYYN-------------------------
A0A139TV24      VDFKAAG----------H--HYYGYGY----HYNY-------------------------
A0A2N8HT11      VDFKSSS----------Y--SYYGYGY----HYGN-------------------------
R7DS70          VDFKSSS----------Y--SYYGYGY----HYGN-------------------------
A0A2N8HNL6      VDFKSSS----------Y--SYYGYGY----HYGN-------------------------
A0A6I1K459      LPQSAGS---------GY--YYYYSGN----KYYG-------------------------
A0A139TUL1      ENFKNSR----------F--HYYS-------EYSG-------------------------
A0A2N8HCB0      ENFKNSR----------F--HYYS-------EY---------------------------
A0A2N8HP04      ENFKNSR----------F--HYYD-------EY---------------------------
A0A2N8HRJ0      ENFKNSR----------F--HYYD-------EY---------------------------
A0A366HAG0      VNINSDA---------TY--GYYTSYY----GYYS-------------------------
A0A3M1I8A3      IDFEGRD-------------SYYYSYYFYQNRYYS-------------------------
A0A4V0XS84      IDYSNSQ---------YYYSEYYSNQI-ASPEFGE-------------------------
A0A0R2XQ77      ISSTLAS---------YYYSSYSDKAY-Q--DYYI-------------------------
A0A2E9IN28      ITSSLSS---------YYYSNYSDKAY-Q--DYYI-------------------------
D5ENH7          ITTSLSS---------YYYSQYSDKAY-Q--DYYI-------------------------
A0A351WE84      INIMRDD---------YY--YYYHASY----TQYN-------------------------
A0A1V5QDZ6      INIMRDD---------YY--YYYHSYY-S--QYYQ-------------------------
A0A4Y8P964      TDGSYQS---------YY--SYY--------AYKA-------------------------
A0A3D4HF88      ITAAMSS---------YYYTNYYEKSY---DKYYT-------------------------
A0A351MR11      MATRLAA---------FYTNSYDASYS----KYYT-------------------------
A0A6G6K641      MPAAAAG---------QY--YYYSSSHGERKVYGS-------------------------
A0A5B5WI95      VDFKSSS----------Y--SYYGYNYGYRYSYGS-------------------------
A0A2N8I9W1      VNFKSSS----------Y--SYYGYGYGYQYGYGS-------------------------
A0A4Q5IH27      VNFKSSS----------Y--SYYGYGYGYQYGYGS-------------------------
A0A2N8IBZ6      VNFKSSS----------Y--SYYGYGYGYQYGYGS-------------------------
A0A2N8IJW9      VNFKSSS----------Y--SYYGYGYGYQYGYGS-------------------------
R6J100          VNFKSSS----------Y--SYYGYGYGYQYGYGS-------------------------
A0A1V6J089      INIMRDD-------------YYYYYHY-TTRKYYG-------------------------
A0A3C1BZR1      INIMRDD-------------YYYYYHY-ATKKYYG-------------------------
A0A1H6KPB7      VDISGDT---------QY--QYYTTYY----SYYS-------------------------
A0A2E9ISN4      LRSNGYD---------AY--GSYGTRHIESAFLYG-------------------------
B9XAX1          LPQHSGY---------RY--YYHYTPR----NGYK-------------------------
A0A5R8KKM9      VDIHSDN---------TY--GYYTSYY----TYYN-------------------------
A0A139TS01      VDITSDH---------QY--QYYTTYY----SYYS-------------------------
A0A3E1EJT7      MNTGITG---------DYYMENNSKLF-K--EYYN-------------------------
A0A317ZP96      ITSTLSS---------YYYSQYSDKSY-Q--DYYI-------------------------
A0A2D5WGA5      INISQDS---------YY--YYYSGYY-Y--DYYY-------------------------
A0A2E7SSH2      INISQDS---------YY--YYYSGYY-Y--DYYY-------------------------
A0A349GXM8      IEMHKISSLYYAYQYPNY--AYYSNAYAYGYDYYY-------------------------
A0A4P5YP61      LPRRVGL---------GG--YYYDS-Y-YNYSYYG-------------------------
A0A6B2LYM4      LNTHVAG---------YYYSHYYDKSY-KSYKHYY-------------------------
A0A6D1VXB3      TTTSYQS---------YY--SYY--------AYKE-------------------------
I0JYY7          TTTSYQS---------YY--SYY--------AYKE-------------------------
A0A4R7S1J2      VPEGSRG---------YY--YHYSP------GYYG-------------------------
A0A2A2XV69      VDIRHDQ---------SY--GYYTS-Y-Y--NYYS-------------------------
A0A651H7X9      LNLSLAG---------YYYAQYYDKSY-K--DYYV-------------------------
A0A4Y8P842      ADPVSSS---------YY--YSYSYKY-R-------------------------------
B3DZK9          ADPLSHS---------SY--Y-YAYKY-R-------------------------------
A0A5E6MPC4      VQQANRS---------YY--AY----H-Y--AYRL-------------------------
A0A4V1SB02      MPARRGA---------SY--YYY---Y-YGDPYVK-------------------------
A0A3C1VB86      LPKRRLS---------GY--------Y-Y--SYHH-------------------------
A0A146G2Q9      VDVRHDQ---------HY--QYYTS-Y-Y--NYYY-------------------------
A0A2T6D3Y2      VDVRHDQ---------HY--QYYTS-Y-Y--NYYY-------------------------
A0A2V2SDV4      INMSQDE---------NY--YYYSGYY-H--E----------------------------
A0A2V5PK75      INMSQDE---------SY--YYYSGYY-H--DYYS-------------------------
A0A1V6DME1      INMSQDE---------SY--YYYSGYY-H--DYYY-------------------------
A0A3D3DIJ3      INMSQDE---------SY--YYYSGYY-H--DYYY-------------------------
A0A2D5VY59      INISQDS---------YY--YYYSGYY-Y--DYYS-------------------------
A0A2D8UZZ4      INISQDS---------YY--YYYSGYY-Y--DYYS-------------------------
A0A353DV86      INISQDS---------YY--YYYSGYY-Y--DYYS-------------------------
A0A2E5EPT8      INVSSDA---------SY--YYYSG---Y--HYHD-------------------------
A0A6I1K583      INLASDA---------SY--YYYSG-Y-----HYH-------------------------
A0A350EWA4      INMAQDE---------NY--YYYSGYY-Y--DYYS-------------------------
A0A5B5WZ91      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A2N8HD92      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A2N8HIT2      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A354EBD3      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A355VEB2      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A2N8IMT3      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
R6K1U5          VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A2N8IWC2      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A2N8I441      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A2N8I3A6      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A410SCC4      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A3R5VEW0      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A411SSG2      VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
B2UKW3          VDITSDH---------QY--QYYTT-Y-Y--SYYS-------------------------
A0A1M6RLZ4      VDVKSDS---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A354T7G8      VDLRSDA---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A2S7U4L6      VDLRSDS---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A512MBZ2      VDVRSDS---------QY--QYYTS-Y-Y--TYYS-------------------------
A0A2E8MEZ0      VDVRSDS---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A4Q2YKS3      VDVRSDS---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A6B3LBV6      VDVRSDS---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A2E3EC33      VDVRSDN---------QY--QYYTS-Y-Y--TYYS-------------------------
A0A2E4GN01      VDVRSDN---------QY--QYYTS-Y-Y--TYYS-------------------------
A0A1Z8XU55      VDVRSDN---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A2E1RQR9      VDVRSDN---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A2E3ISQ4      VDVRSDN---------QY--QYYTS-Y-Y--TYYA-------------------------
A0A2D6W6F4      VDVRSDN---------XY--QYYTS-Y-Y--TYYA-------------------------
A0A2D8Z5A8      VDVRSDN---------QY--QYYTS-Y-Y--TYYA-------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      RLNGSFPVTLKPVASEKSSNGVSTGALDVVRAKLGEAMGPMASLVLRDSIRALGESSESF
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      PEAKLEVLVQHVSQEILDDYQRQRFEEETLKEIKKTTEQHGAAQPDGPVKADSAISKKKP
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      -----------------------------------KT-----------------------
A0A2V5UHJ2      NGTAVDNPSLTSEPAAIQEPRDGADGATASGAASISEKTSEALPHRPSKNPAAIPKPATK
A0A2V5PST3      -----------------------------------AAENGNGGEHTDVEVLMNDGPFEKD
A0A2V5PXM3      -----------------------------------KYGHGQKEKARAAAA----------
A0A139SU05      -----------------------------------RVDRPERETKRPKKVVEEAEVSEIA
A0A1D8AZK8      -----------------------------------SQS----------------------
A0A1V5QB01      -----------------------------------YDHIRESKEDAKT------------
A0A139SPN4      -----------------------------------VEPARGELDREPARAPEAAPAAEPA
A0A1V6E7N1      -----------------------------------THG----------------------
A0A2D9MYT1      -----------------------------------SHYKSDKPXEEEAXQLPLQPGVKXA
A0A258ANJ7      -----------------------------------GSETDETAPLRPASRGLHTPSNFG-
A0A139TLN4      -----------------------------------SFDTSSPCPGK--------------
A0A290QGD9      -----------------------------------VMSKKDDTQSPLK------------
A0A1D8AS58      -----------------------------------TMAKQDGEPDAR-------------
I6AQC1          -----------------------------------MTESEEGEDTAEADDKVPEMPTSRS
W0ITH7          -----------------------------------MTESEEGEDTAEADDKVPEMPTSRS
A0A1G3ZFT0      -----------------------------------DESDHPKKKRRTLV-----------
A0A1Z8ZMT6      -----------------------------------YGDDA--------------------
A0A2E8MCT7      -----------------------------------YGDDT--------------------
A0A290Q2Z2      -----------------------------------ARENRSSERRDKRSRTEQAERAKSD
A0A2A2RGK2      -----------------------------------AKGVYGE------------------
A0A2A2XXF7      -----------------------------------AKGVYGE------------------
A0A2A2R5D6      -----------------------------------NRNGEKKPRSGAATPQRATLAKNDE
A0A2V2DJ66      -----------------------------------TPPEIENQQEGRRQPPEVSHSDGEE
R7L5A9          -----------------------------------APMESDEDEQPPEDVPPEMPSESKQ
A0A1J4XH17      -----------------------------------NGELPEKKSNLDKATKLATRVKSAL
A0A3C1VJ32      -----------------------------------SRDPSEQEAEAKKADLAAKGPG-DT
A0A2N9NTX7      -----------------------------------RNEDQEKGSGPD------EGPGDKT
B9XK55          -----------------------------------KNEDESE-TATD------AGEG-KA
A0A4P5YMI6      -----------------------------------QPEAPAVAKRATKGALAEKPAA---
A0A2E6T482      -----------------------------------KSREKEEENADKSEDG--AKEG-KL
A0A3C0DQZ7      -----------------------------------KSREKEEENADKSEDG--AKEG-KL
A0A1Z9CBK5      -----------------------------------KSREGEEDAGEEKKAD---KDQ-KL
A0A2D6ZI96      -----------------------------------KSREGEEDAGEEKKAD---KDQ-KL
A0A358KGZ3      -----------------------------------KSRETEDEPVEDKKDG---KEE-KL
A0A2E9ZQX4      -----------------------------------KSRETEEEPVEDKKDG---KEE-KL
A0A3D5JZU0      -----------------------------------KSRETEEEPVEDKKDG---KEE-KL
A0A2E6HCR0      -----------------------------------KSRENEEESEDVKESE---NGK-SL
A0A1Z8WN04      -----------------------------------KSREDEEGSDGTGSDNKEIKDK-SI
A0A2D7L1N4      -----------------------------------KSREDEEGSDGTGSDNKEIKDK-SI
A0A2E2R937      -----------------------------------KSREDEEGSDGTGSDNKEIKDK-SI
A0A520QQY4      -----------------------------------KSREDEEGSDGTGSDNKEIKDK-SI
A0A2D5MR66      -----------------------------------KSRENEEESLPEKGSD---QEK-SI
A0A2E0PDQ1      -----------------------------------KTRENEEESIAVKESD---KDK-LI
A0A2E2ZZP9      -----------------------------------KSRENEEEPIAEKESD---KDK-LI
A0A2A2RGF2      -----------------------------------NNNADEPGTNGKPPGKADRHKP-AA
A0A2G4I5Y6      -----------------------------------NNNDDESSTNGKPPGKVDRHKP-VA
A0A3M1I883      -----------------------------------GSSSEYGRRRRKSSRKRRKSRE-KD
A0A1V6JZ45      -----------------------------------KGEYGESKSSEDDESRKAAPKK-PA
A0A520RRW5      -----------------------------------KQDGDNTSSKKKSDGKSGKTSA-RG
A0A356NPK0      -----------------------------------KQDGDNTSSKKKSDGKSGKTSA-RG
A0A2D7B5P5      -----------------------------------KQDGDNTSSKKKSDGKSGKTSA-RG
A0A3D3XGB5      -----------------------------------KQDGDNTSSKKKSDGKSGKTSA-RG
A0A2V6F8A1      -----------------------------------KREEEP-S--KNNGEKKKPAGE-RA
A0A2V5TNH4      -----------------------------------KREEEPPA--KNNGEKKTPAGE-RA
A0A2V5X5Q6      -----------------------------------KREEEPAA--KNNGEKKKPAGE-RA
A0A4P5QM05      -----------------------------------PKRDTPE-DRKKPEVAAA-------
A0A4Q3C001      -----------------------------------PRTESPK-QASGQQPRRPAAAPTPA
B4DB23          -----------------------------------PRRGTPKIEAPAPQLARP-------
A0A6B3L938      -----------------------------------DND----------------------
A0A2V5URB2      -----------------------------------SARLT--------------------
A0A5R8KA81      -----------------------------------PVAS---------------------
A0A5B5WU87      -----------------------------------SFDTSSPCPGK--------------
R7DZW0          -----------------------------------SLDTSSPCAGK--------------
A0A2N8HID1      -----------------------------------SLDTSSPCAGK--------------
A0A2N8HS06      -----------------------------------SLDTSSPCAGK--------------
A0A3R5R2M8      -----------------------------------RSRRNEPETAPEDSDKQ--------
A0A411SUQ6      -----------------------------------K----EPQQTSRKQDK---------
A0A2N8HZF2      -----------------------------------K----KPQQTSRKQNK---------
A0A354E720      -----------------------------------K----DPQQTARKRD----------
B2UPB6          -----------------------------------K----EPQQTSRKQDK---------
A0A2A2XXW5      -----------------------------------SHYRNKSADEPADKKSASEKSKSA-
A0A2V6JLK8      -----------------------------------PRDKETHRRGRQKSRVAANGSADNG
A0A2W5Z1A5      -----------------------------------PQDRQS-RRSRSR-AGVGAESNGAS
A0A2V6EA09      -----------------------------------PRGKET-RRGRSRKAAATVAHNGAS
A0A2V6GQI7      -----------------------------------PRGKET-RRGRSRKAAATVAHNGA-
A0A3C1HEJ2      -----------------------------------EKDHSPAAPAPKAANSGK-------
A0A522ULD9      -----------------------------------RSQESMPKPETVGGVTAAEVRKEST
A0A1V6JU76      -----------------------------------SYHRERAESRRQAVVESSGSTPAPH
A0A1Q6UHJ9      -----------------------------------MPDVEEEDSEGEEAQEGGESEDPEN
A0A2V2BXR0      -----------------------------------MPDVEEEDSEGEEAQKGGESEDPEN
A0A2D8V0G3      -----------------------------------SYYSNEKKLGSKKGEGAKDGELVQG
A0A348S017      -----------------------------------SYYSNEKKLEPNK----KSKSVVQL
A0A3C1UUV7      -----------------------------------SYYSNEKKLEPNK----KSKSVVQL
A0A350I3V2      -----------------------------------SYYSNEKKLEPNK----KSKSVVQL
A0A520RGV5      -----------------------------------SYYSNEKKLEPNK----KSKSVVQL
A0A3D3XF90      -----------------------------------SYYSNEKKLEPNK----KSKSVVQL
A0A2D7B522      -----------------------------------SYYSNEKKLEPNK----KSKSVVQL
A0A356NIC2      -----------------------------------SYYSNEKKLEPNK----KSKSVVQL
A0A2U8DZK4      -----------------------------------SKSARTR-----------DKTAGDT
A0A2T6DFL8      -----------------------------------EGSRRTRRSARSDK--KPEAGGEDR
A0A1D8AWD4      --------------------------------------HEKPVPGAAGAAGPNEARGSDR
A0A4Q1C9S2      --------------------------------------HEKP-----AVAGKAAERGAER
A0A178IH18      -----------------------------------SRDVRRRSRRHRSGRDRDDEADA-R
A0A2T6DT99      -----------------------------------SHGRRRSRRSRRDDADGESDSRGDR
A0A1G3ZT33      -----------------------------------EGHKRRKSARTEAA--AVPAGGAER
A0A3E1E2T2      -----------------------------------EGSGRRRR---SAAKPKSPGRGGDE
B1ZMW1          -----------------------------------DGSHRRHRPGPSAAHQAAPAVEGDR
A0A2N8HDG3      -----------------------------------TSKNAHS------------------
A0A146GCJ0      -----------------------------------KSV----------------------
A0A2T6D6H8      -----------------------------------KAG----------------------
A0A3D1TI55      -----------------------------------PQEERTPDRPKELDVGEAY------
A0A3R8IT45      -----------------------------------MAGAEDAIDNSASNEEEDVVAPGSK
A0A1H1MGC9      -----------------------------------TMAKQDPGTVER-------------
A0A2A2PYE8      -----------------------------------VMSKNDTEQ-EK-------------
A0A2T6CN73      -----------------------------------V-SKGDTEQ-ER-------------
A0A3E1ET42      -----------------------------------PTNAEARKPRQAAPAGGAP----QR
A0A2A2YDW8      -----------------------------------PAESELPQPQPSTSSRPATPS----
A0A352XLN9      -----------------------------------PAESELPQPQPSTSSRPATPS----
A0A3D0YP62      -----------------------------------PTTGDEIARDTATAAPAPS------
A0A3D3DV47      -----------------------------------PTTGDEIARDTATAAPAPS------
A0A2E5XJ49      -----------------------------------PSADPDPVA--GGSPGGPPGGGSRT
A0A2E6SBY8      -----------------------------------PTADADPVP--XASPGGASAGRVRS
A0A2E5QMS4      -----------------------------------PSSDVDPISSPPRKMTVST-GASPT
A0A2E7YXQ3      -----------------------------------PSSDVDPISSPPRKMTVST-GASPT
A0A2E3H787      -----------------------------------PSADADPVPGAGFEAAAES-ATAEA
A0A2E7AGN1      -----------------------------------PSADADPVPGGGVTKSAER-ASVKT
A0A2E7AKY7      -----------------------------------PSADADPVPGGGVTKSAER-ATVKT
A0A3D4CU34      -----------------------------------PSADADPVPGGGVTKSAER-ASVKT
A0A2E8M146      -----------------------------------PSADSDPVPTVGATASATSGSALES
A0A355S8S2      -----------------------------------PSADSDPVPTVGATASATSGSALES
A0A2D6DVN8      -----------------------------------PSADSDPVPSVGATASGTS-AATES
A0A3C1W2R2      -----------------------------------PSADSDPVPSVGATASGTS-AATES
A0A2E3NAY6      -----------------------------------PSADSDPVPTGGTTSSGTT-EAIES
A0A2E3II01      -----------------------------------PSADSDPVPTVGTTASGTS-AAIES
A0A368B8C5      -----------------------------------PSADSDPVPTVGTTASGTS-AAIES
A0A3R7RBB5      -----------------------------------PSADSDPVPTVGTTASGTS-AAIES
A0A2A2QX62      -----------------------------------P-AESQSLPSQGSSSAPAKPAPPRS
A0A4Q3BWH6      -----------------------------------P-AESQPMPTQSGSQAPSQSPAPRS
A0A3N5WCF1      -----------------------------------P-AEAQVVAP--PPGSSSAPSKPQA
A0A4Q3C1K5      -----------------------------------P-AESQIGPPVSSPTSSTPAAKPQA
A0A2G4G428      -----------------------------------AAAGAAAKDDAGDAVASTENPEDNP
A0A139TV24      -----------------------------------GYNTTNS------------------
A0A2N8HT11      -----------------------------------TSKNNPS------------------
R7DS70          -----------------------------------TSKNNPS------------------
A0A2N8HNL6      -----------------------------------TSKNNPS------------------
A0A6I1K459      -----------------------------------KKGVYGATSSRG-------------
A0A139TUL1      -----------------------------------SETAG--------------------
A0A2N8HCB0      -----------------------------------SETDG--------------------
A0A2N8HP04      -----------------------------------SETDG--------------------
A0A2N8HRJ0      -----------------------------------SETDG--------------------
A0A366HAG0      -----------------------------------GDGKGDGTMKAKRKTRQSTPA----
A0A3M1I8A3      -----------------------------------SYRSRPDQIGAVRST----------
A0A4V0XS84      -----------------------------------AKSSSVATDSDRANGASRSASFNGG
A0A0R2XQ77      -----------------------------------SQDVELEDELAGSVEPEME--PRS-
A0A2E9IN28      -----------------------------------HHEEELEEEMAGSVEPQSELGPKA-
D5ENH7          -----------------------------------HQEDEFEEELAGSVEPDKQ------
A0A351WE84      -----------------------------------PDGQEK-------------------
A0A1V5QDZ6      -----------------------------------SDESKPADELADTSNRKKDAL----
A0A4Y8P964      -----------------------------------KDELQNKNETQNLSPFQSLRFLNGW
A0A3D4HF88      -----------------------------------GGSNPKA------------------
A0A351MR11      -----------------------------------DAADQGAEKPAPKKDPVV-------
A0A6G6K641      -----------------------------------A------------------------
A0A5B5WI95      -----------------------------------G--REAAGKN---------------
A0A2N8I9W1      -----------------------------------GEPRQTTRKQD--------------
A0A4Q5IH27      -----------------------------------GEPRQTTRKQD--------------
A0A2N8IBZ6      -----------------------------------GEPRQTTRKQD--------------
A0A2N8IJW9      -----------------------------------GEPRQTTRKQD--------------
R6J100          -----------------------------------GEPRQTTRKQD--------------
A0A1V6J089      -----------------------------------VVRHENDDNLTES------------
A0A3C1BZR1      -----------------------------------SSKHDKEDDATEA------------
A0A1H6KPB7      -----------------------------------PTE-GVEPSAALNPLPVTSRSSKRS
A0A2E9ISN4      -----------------------------------MESETPKNKRWKFR-----------
B9XAX1          -----------------------------------SIGVYGNDYPAKIPLNT--------
A0A5R8KKM9      -----------------------------------SDQRGKKDRQPVANAPQKTLASL--
A0A139TS01      -----------------------------------AESGASGGNADASSLKKAERSGK--
A0A3E1EJT7      -----------------------------------PGGEPPVTSQSS-------------
A0A317ZP96      -----------------------------------QQEEEFEHELEGEVEPEELQTKS--
A0A2D5WGA5      -----------------------------------KSREKEEESGDAAKDGKKEPK----
A0A2E7SSH2      -----------------------------------KSRETEEESTEDNKNGGND-K----
A0A349GXM8      -----------------------------------DEKGGNRRSRRQIRWRKQLEHAGAW
A0A4P5YP61      -----------------------------------KYGAKGVYGAKA-------------
A0A6B2LYM4      -----------------------------------LQNKGMEDLDE--------------
A0A6D1VXB3      -----------------------------------KNEIQNKNQTQSLSPFHSLQFLNDW
I0JYY7          -----------------------------------KNEIQNKNQTQSLSPFHSLQFLNDW
A0A4R7S1J2      -----------------------------------SKGVYGASA----------------
A0A2A2XV69      -----------------------------------PSKNVPEKSGQNAQ-----------
A0A651H7X9      -----------------------------------VTSEDEKEMR---------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      -----------------------------------SEEQRRAEALRAPSQPPS-------
A0A4V1SB02      -----------------------------------DGVYGSSVNPKKKRGKKANDEDAAW
A0A3C1VB86      -----------------------------------GYGYGNYGEKAADKTSD--------
A0A146G2Q9      -----------------------------------QKPQQQKADKKPAKKAPV-------
A0A2T6D3Y2      -----------------------------------QKPQQQKADKKPAKKAPV-------
A0A2V2SDV4      -------------------------------------EGTNDEEQEAAP-----------
A0A2V5PK75      -----------------------------------VNED---QESAARP-----------
A0A1V6DME1      -----------------------------------RSSESSDKDEAAGE-----------
A0A3D3DIJ3      -----------------------------------RSEE---QEPVVKE-----------
A0A2D5VY59      -----------------------------------KQDDSEGGSSAQPKTK---------
A0A2D8UZZ4      -----------------------------------KQDDSEGGSSAQPKTK---------
A0A353DV86      -----------------------------------KQDDSEGGSSAQPKTK---------
A0A2E5EPT8      -----------------------------------NPSSSGSLNIDSKPRELKGKVDR--
A0A6I1K583      -----------------------------------SNNNADEPGANGKPPGKVDRR----
A0A350EWA4      -----------------------------------KQNDDDGDQSGRKNGH---------
A0A5B5WZ91      -----------------------------------AESGASDGNADASSLKKAERSGK--
A0A2N8HD92      -----------------------------------ADGGSSGGNVDASSMKKAERSGK--
A0A2N8HIT2      -----------------------------------ADGGSSGENADASSMKKAERSGK--
A0A354EBD3      -----------------------------------TDGSSSGENAEASSMKKAERSGK--
A0A355VEB2      -----------------------------------TDGSSSGENAEASSMKKAERSGK--
A0A2N8IMT3      -----------------------------------ADGSSSGENADASSMKKVERSGK--
R6K1U5          -----------------------------------ADGSSSGENADASSMKKVERSGK--
A0A2N8IWC2      -----------------------------------ADGSSSGENADASSMKKVERSGK--
A0A2N8I441      -----------------------------------ADGSSSGENADASSMKKVERSGK--
A0A2N8I3A6      -----------------------------------ADGSSSGENADASSMKKVERSGK--
A0A410SCC4      -----------------------------------ADGSSSGENADASSMKKVERSGK--
A0A3R5VEW0      -----------------------------------ADGASSGENADASSMKKVERSGK--
A0A411SSG2      -----------------------------------ADGASSGENADASSMKKVERSGK--
B2UKW3          -----------------------------------ADGASSGENADASSMKKVERSGK--
A0A1M6RLZ4      -----------------------------------PSEAPQEVR----------------
A0A354T7G8      -----------------------------------PTNSPTGGAGGKTRRRKVKAETTAN
A0A2S7U4L6      -----------------------------------PGQNKSAAAE---------------
A0A512MBZ2      -----------------------------------PNNQAAAPGEQPQKRRR-RSDAPAA
A0A2E8MEZ0      -----------------------------------PSSLEETGTPQQMTAAP-ASS----
A0A4Q2YKS3      -----------------------------------PAEGQVGPPVNAETAPR-QQK----
A0A6B3LBV6      -----------------------------------SGD---DQAAKPKKRGK-KEV----
A0A2E3EC33      -----------------------------------PSNIDPNQKISSDKPKA-PSS----
A0A2E4GN01      -----------------------------------PSNMDPNQKISSDKTKS-SSS----
A0A1Z8XU55      -----------------------------------PRNLDPNMNSNSDDLFK-SGD----
A0A2E1RQR9      -----------------------------------PRNLDPNMNSNSDDLFK-SGD----
A0A2E3ISQ4      -----------------------------------PRNLDPNMESDSIGSTK-SES----
A0A2D6W6F4      -----------------------------------PRNLDPDMESGSIGSPK-AGS----
A0A2D8Z5A8      -----------------------------------PRNLDPDMESGSIGSPK-PGS----
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      KTMNKESREELSPEFLKLVIVRLTQAMGPIAPLVLREHISALGETLESFPQARLEELVQR
A0A2V5PST3      PWPKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARNRFPKNRLQELFDR
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      VAA---------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      GKEEXSA-----------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ERITFTERERDERRKS--------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      QSHGSEDF----------------------------------------------------
A0A2V2DJ66      KNS---------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A1J4XH17      SKKKNKEKTLV-------------------------------------------------
A0A3C1VJ32      EV-----------------NIKQKY-----------------------------------
A0A2N9NTX7      KL-----------------DIKPKY-----------------------------------
B9XK55          RT-----------------DIKPKY-----------------------------------
A0A4P5YMI6      -------------------ELNQKY-----------------------------------
A0A2E6T482      LAKADLGAG----------EDKPKY-----------------------------------
A0A3C0DQZ7      LAKADLGAG----------EDKPKY-----------------------------------
A0A1Z9CBK5      VAQANPGGS----------DVKPKY-----------------------------------
A0A2D6ZI96      VAQANPGGS----------DVKPKY-----------------------------------
A0A358KGZ3      IAQADAAGE----------DVNPKY-----------------------------------
A0A2E9ZQX4      IAQADAXGX----------DVXPKX-----------------------------------
A0A3D5JZU0      IAQADAVGE----------DVKPKY-----------------------------------
A0A2E6HCR0      VSEAASDRE----------DVKPKY-----------------------------------
A0A1Z8WN04      TTE-VDSSS----------DVKPKY-----------------------------------
A0A2D7L1N4      TTE-VDSSS----------DVKPKY-----------------------------------
A0A2E2R937      TTE-VGGSS----------DVKPKY-----------------------------------
A0A520QQY4      TTE-VDSSS----------DVKPKY-----------------------------------
A0A2D5MR66      TNESADRDG----------SVKPKY-----------------------------------
A0A2E0PDQ1      NTEATENNE----------SVEPKY-----------------------------------
A0A2E2ZZP9      NTEDAENNE----------SVEPKY-----------------------------------
A0A2A2RGF2      PTADAP-------------TIKPKY-----------------------------------
A0A2G4I5Y6      PVADAT-------------SIKPKY-----------------------------------
A0A3M1I883      SSAEAPATAATETEEAETPELKEKF-----------------------------------
A0A1V6JZ45      EA-----------------ELKTKY-----------------------------------
A0A520RRW5      DL-----------------ELKNKF-----------------------------------
A0A356NPK0      DL-----------------ELKNKF-----------------------------------
A0A2D7B5P5      DL-----------------ELKNKF-----------------------------------
A0A3D3XGB5      DL-----------------ELKNKF-----------------------------------
A0A2V6F8A1      QL-----------------DLKQKY-----------------------------------
A0A2V5TNH4      QL-----------------DLKQKY-----------------------------------
A0A2V5X5Q6      QL-----------------DLKQKY-----------------------------------
A0A4P5QM05      -NADNEDAY---------------------------------------------------
A0A4Q3C001      STGSKHGDY---------------------------------------------------
B4DB23          -RDTHREDY---------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      HIDTDEY-----------------------------------------------------
A0A2W5Z1A5      DNGRDEY-----------------------------------------------------
A0A2V6EA09      GSDEDEY-----------------------------------------------------
A0A2V6GQI7      -SDSDEY-----------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      A-----------------------------------------------------------
A0A1Q6UHJ9      SENSK-------------------------------------------------------
A0A2V2BXR0      SENSK-------------------------------------------------------
A0A2D8V0G3      GKAGKDDEPSKA------------------------------------------------
A0A348S017      DKTAKKSESEV-------------------------------------------------
A0A3C1UUV7      DKTAKKSESEV-------------------------------------------------
A0A350I3V2      DKTAKKSESEV-------------------------------------------------
A0A520RGV5      DKTAKKSESEV-------------------------------------------------
A0A3D3XF90      DKTAKKSESEV-------------------------------------------------
A0A2D7B522      DKTAKKSESEV-------------------------------------------------
A0A356NIC2      DKTAKKSESEV-------------------------------------------------
A0A2U8DZK4      INFSEKK-----------------------------------------------------
A0A2T6DFL8      LDLHE-------------------------------------------------------
A0A1D8AWD4      IEMRETREPERKR-----------------------------------------------
A0A4Q1C9S2      LDLDEK---PRRR-----------------------------------------------
A0A178IH18      ETFTEPER----------------------------------------------------
A0A2T6DT99      IEYVERERRRSKE-----------------------------------------------
A0A1G3ZT33      IVLDEPDSRRHG------------------------------------------------
A0A3E1E2T2      LKLS--------------------------------------------------------
B1ZMW1          LVLREPERKDPA------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      S-----------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      PAPAKAGAGRGENEDY--------------------------------------------
A0A2A2YDW8      ---STASTSNQNDTLY--------------------------------------------
A0A352XLN9      ---STASTSNQNDTLY--------------------------------------------
A0A3D0YP62      ---QQAQPARNDEDLY--------------------------------------------
A0A3D3DV47      ---QQAQPARNDEDLY--------------------------------------------
A0A2E5XJ49      VS-TS-APQDEDEALY--------------------------------------------
A0A2E6SBY8      AA-ASPSSQDDDGGLY--------------------------------------------
A0A2E5QMS4      AT-PSTPEEDDDGLSY--------------------------------------------
A0A2E7YXQ3      AT-PSTPEEDDDGLSY--------------------------------------------
A0A2E3H787      TG-SSKDENDDDGLTY--------------------------------------------
A0A2E7AGN1      PG-GKNETDDEEGLTY--------------------------------------------
A0A2E7AKY7      PG-GKNELDDEKGLTY--------------------------------------------
A0A3D4CU34      PG-GKNETDDEEGLTY--------------------------------------------
A0A2E8M146      KV-VANDSEEDEGLNY--------------------------------------------
A0A355S8S2      KV-VANDSEEDEGLNY--------------------------------------------
A0A2D6DVN8      TV-ATSDEDKDEGLTY--------------------------------------------
A0A3C1W2R2      TV-AANDEDKDEGLTY--------------------------------------------
A0A2E3NAY6      TV-ATNDADDDEGLTY--------------------------------------------
A0A2E3II01      AV-AATDADKDEGLTY--------------------------------------------
A0A368B8C5      AV-AANDADKDEGLTY--------------------------------------------
A0A3R7RBB5      AV-AANDADKDEGLTY--------------------------------------------
A0A2A2QX62      TS-RGDAADDAKQDLY--------------------------------------------
A0A4Q3BWH6      SS-RASSTDDSKQDLY--------------------------------------------
A0A3N5WCF1      AATRGADS-----ELY--------------------------------------------
A0A4Q3C1K5      PA-RGNDS-----ELY--------------------------------------------
A0A2G4G428      KV----------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      -KGAKVKSPRAKADEVF-------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      GKSATVPLASTLATSPRRPVGSEKSSFKMNRNS---------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      -VPAKTIAASADGKDSLF------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      VKKKSSDKTTDS------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      EVAKKTESTDQPGDDLY-------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      -QSPKSEKNRTSYQDAF-------------------------------------------
A0A139TS01      -AKELAATQSNDNEDLY-------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      -LLAKADVGGEDEKPKY-------------------------------------------
A0A2E7SSH2      -LIAQADIGGDDVKPKY-------------------------------------------
A0A349GXM8      IRKTLMPM----------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      -EVAASGPSDGPQETKTS------------------------------------------
A0A6D1VXB3      VQEKIKRPDK--------------------------------------------------
I0JYY7          VQEKIKRPDK--------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      -AASPATTKPTPQSGEY-------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      -SAVPSDSQEIMRKEKEG------------------------------------------
B3DZK9          -SQASSNSQELMRKEEEA------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      PESTPAVSPSQASRAKE-------------------------------------------
A0A3C1VB86      -DTRGNLASEARPENLL-------------------------------------------
A0A146G2Q9      -SAVQQLNGEKDQEDTY-------------------------------------------
A0A2T6D3Y2      -SAVQQLNGEKDQEDTY-------------------------------------------
A0A2V2SDV4      -GGPASQKS---------------------------------------------------
A0A2V5PK75      -DEPAGDKARRA------------------------------------------------
A0A1V6DME1      -KKADDSQAKVEIKKKY-------------------------------------------
A0A3D3DIJ3      -GAESGGKDKLDIKQKY-------------------------------------------
A0A2D5VY59      -SSKTASRGDVELKNKF-------------------------------------------
A0A2D8UZZ4      -SSKTASRGDVELKNKF-------------------------------------------
A0A353DV86      -SSKTASRGDVELKNKF-------------------------------------------
A0A2E5EPT8      -QRGQDSSEEPDLKSKY-------------------------------------------
A0A6I1K583      -KPVAPATDAPTIKPKY-------------------------------------------
A0A350EWA4      -PATKDEPASRLDLKKY-------------------------------------------
A0A5B5WZ91      -AKELAATQSSDNEDLY-------------------------------------------
A0A2N8HD92      -AKELAANQSHDSEDLY-------------------------------------------
A0A2N8HIT2      -AKELAATQSHDSEDLY-------------------------------------------
A0A354EBD3      -AKELAATQSHDSEDLY-------------------------------------------
A0A355VEB2      -AKELAATQSHDSEDLY-------------------------------------------
A0A2N8IMT3      -AKELAATQSHDSEDLY-------------------------------------------
R6K1U5          -AKELAATQSHDSEDLY-------------------------------------------
A0A2N8IWC2      -AKELAATQSHDSEDLY-------------------------------------------
A0A2N8I441      -AKELAATQSHDSEDLY-------------------------------------------
A0A2N8I3A6      -AKELAATQSHDSEDLY-------------------------------------------
A0A410SCC4      -AKELAATQSHDSEDLY-------------------------------------------
A0A3R5VEW0      -AKELAATQSHDSEDLY-------------------------------------------
A0A411SSG2      -AKELAATQSHDSEDLY-------------------------------------------
B2UKW3          -AKELAATQSHDSEDLY-------------------------------------------
A0A1M6RLZ4      -AAAQPQGAQSNSADLY-------------------------------------------
A0A354T7G8      ALTSPRTVSRPEGEDVF-------------------------------------------
A0A2S7U4L6      -ATAKSSSDSPKTNDLY-------------------------------------------
A0A512MBZ2      PNAAPSPASRAPQGDLF-------------------------------------------
A0A2E8MEZ0      -KTEEKKSERSSSEDLY-------------------------------------------
A0A4Q2YKS3      -SGGRENDSELY------------------------------------------------
A0A6B3LBV6      -SSSVGGGDVKLGDDVY-------------------------------------------
A0A2E3EC33      -KEPKGSSEEISIEDKF-------------------------------------------
A0A2E4GN01      -KESKSSSEEISAEDKY-------------------------------------------
A0A1Z8XU55      -KLASNDKDNLTAEDKF-------------------------------------------
A0A2E1RQR9      -KLASNDKDNLTAEDKF-------------------------------------------
A0A2E3ISQ4      -KVASNDQNNLSAEDKF-------------------------------------------
A0A2D6W6F4      -KLASNDQNNLSAEDKF-------------------------------------------
A0A2D8Z5A8      -KLASNDQNNLSAEDKF-------------------------------------------
                                                                            

A0A2A2XVF1      -------------------------
A0A2V5UHJ2      LCKEIVTDSFRQQFEEEMAKLTSDV
A0A2V5PST3      ICEEILDDKLKNDFQQSMQEELRVL
A0A2V5PXM3      -------------------------
A0A139SU05      -------------------------
A0A1D8AZK8      -------------------------
A0A1V5QB01      -------------------------
A0A139SPN4      -------------------------
A0A1V6E7N1      -------------------------
A0A2D9MYT1      -------------------------
A0A258ANJ7      -------------------------
A0A139TLN4      -------------------------
A0A290QGD9      -------------------------
A0A1D8AS58      -------------------------
I6AQC1          -------------------------
W0ITH7          -------------------------
A0A1G3ZFT0      -------------------------
A0A1Z8ZMT6      -------------------------
A0A2E8MCT7      -------------------------
A0A290Q2Z2      -------------------------
A0A2A2RGK2      -------------------------
A0A2A2XXF7      -------------------------
A0A2A2R5D6      -------------------------
A0A2V2DJ66      -------------------------
R7L5A9          -------------------------
A0A1J4XH17      -------------------------
A0A3C1VJ32      -------------------------
A0A2N9NTX7      -------------------------
B9XK55          -------------------------
A0A4P5YMI6      -------------------------
A0A2E6T482      -------------------------
A0A3C0DQZ7      -------------------------
A0A1Z9CBK5      -------------------------
A0A2D6ZI96      -------------------------
A0A358KGZ3      -------------------------
A0A2E9ZQX4      -------------------------
A0A3D5JZU0      -------------------------
A0A2E6HCR0      -------------------------
A0A1Z8WN04      -------------------------
A0A2D7L1N4      -------------------------
A0A2E2R937      -------------------------
A0A520QQY4      -------------------------
A0A2D5MR66      -------------------------
A0A2E0PDQ1      -------------------------
A0A2E2ZZP9      -------------------------
A0A2A2RGF2      -------------------------
A0A2G4I5Y6      -------------------------
A0A3M1I883      -------------------------
A0A1V6JZ45      -------------------------
A0A520RRW5      -------------------------
A0A356NPK0      -------------------------
A0A2D7B5P5      -------------------------
A0A3D3XGB5      -------------------------
A0A2V6F8A1      -------------------------
A0A2V5TNH4      -------------------------
A0A2V5X5Q6      -------------------------
A0A4P5QM05      -------------------------
A0A4Q3C001      -------------------------
B4DB23          -------------------------
A0A6B3L938      -------------------------
A0A2V5URB2      -------------------------
A0A5R8KA81      -------------------------
A0A5B5WU87      -------------------------
R7DZW0          -------------------------
A0A2N8HID1      -------------------------
A0A2N8HS06      -------------------------
A0A3R5R2M8      -------------------------
A0A411SUQ6      -------------------------
A0A2N8HZF2      -------------------------
A0A354E720      -------------------------
B2UPB6          -------------------------
A0A2A2XXW5      -------------------------
A0A2V6JLK8      -------------------------
A0A2W5Z1A5      -------------------------
A0A2V6EA09      -------------------------
A0A2V6GQI7      -------------------------
A0A3C1HEJ2      -------------------------
A0A522ULD9      -------------------------
A0A1V6JU76      -------------------------
A0A1Q6UHJ9      -------------------------
A0A2V2BXR0      -------------------------
A0A2D8V0G3      -------------------------
A0A348S017      -------------------------
A0A3C1UUV7      -------------------------
A0A350I3V2      -------------------------
A0A520RGV5      -------------------------
A0A3D3XF90      -------------------------
A0A2D7B522      -------------------------
A0A356NIC2      -------------------------
A0A2U8DZK4      -------------------------
A0A2T6DFL8      -------------------------
A0A1D8AWD4      -------------------------
A0A4Q1C9S2      -------------------------
A0A178IH18      -------------------------
A0A2T6DT99      -------------------------
A0A1G3ZT33      -------------------------
A0A3E1E2T2      -------------------------
B1ZMW1          -------------------------
A0A2N8HDG3      -------------------------
A0A146GCJ0      -------------------------
A0A2T6D6H8      -------------------------
A0A3D1TI55      -------------------------
A0A3R8IT45      -------------------------
A0A1H1MGC9      -------------------------
A0A2A2PYE8      -------------------------
A0A2T6CN73      -------------------------
A0A3E1ET42      -------------------------
A0A2A2YDW8      -------------------------
A0A352XLN9      -------------------------
A0A3D0YP62      -------------------------
A0A3D3DV47      -------------------------
A0A2E5XJ49      -------------------------
A0A2E6SBY8      -------------------------
A0A2E5QMS4      -------------------------
A0A2E7YXQ3      -------------------------
A0A2E3H787      -------------------------
A0A2E7AGN1      -------------------------
A0A2E7AKY7      -------------------------
A0A3D4CU34      -------------------------
A0A2E8M146      -------------------------
A0A355S8S2      -------------------------
A0A2D6DVN8      -------------------------
A0A3C1W2R2      -------------------------
A0A2E3NAY6      -------------------------
A0A2E3II01      -------------------------
A0A368B8C5      -------------------------
A0A3R7RBB5      -------------------------
A0A2A2QX62      -------------------------
A0A4Q3BWH6      -------------------------
A0A3N5WCF1      -------------------------
A0A4Q3C1K5      -------------------------
A0A2G4G428      -------------------------
A0A139TV24      -------------------------
A0A2N8HT11      -------------------------
R7DS70          -------------------------
A0A2N8HNL6      -------------------------
A0A6I1K459      -------------------------
A0A139TUL1      -------------------------
A0A2N8HCB0      -------------------------
A0A2N8HP04      -------------------------
A0A2N8HRJ0      -------------------------
A0A366HAG0      -------------------------
A0A3M1I8A3      -------------------------
A0A4V0XS84      -------------------------
A0A0R2XQ77      -------------------------
A0A2E9IN28      -------------------------
D5ENH7          -------------------------
A0A351WE84      -------------------------
A0A1V5QDZ6      -------------------------
A0A4Y8P964      -------------------------
A0A3D4HF88      -------------------------
A0A351MR11      -------------------------
A0A6G6K641      -------------------------
A0A5B5WI95      -------------------------
A0A2N8I9W1      -------------------------
A0A4Q5IH27      -------------------------
A0A2N8IBZ6      -------------------------
A0A2N8IJW9      -------------------------
R6J100          -------------------------
A0A1V6J089      -------------------------
A0A3C1BZR1      -------------------------
A0A1H6KPB7      -------------------------
A0A2E9ISN4      -------------------------
B9XAX1          -------------------------
A0A5R8KKM9      -------------------------
A0A139TS01      -------------------------
A0A3E1EJT7      -------------------------
A0A317ZP96      -------------------------
A0A2D5WGA5      -------------------------
A0A2E7SSH2      -------------------------
A0A349GXM8      -------------------------
A0A4P5YP61      -------------------------
A0A6B2LYM4      -------------------------
A0A6D1VXB3      -------------------------
I0JYY7          -------------------------
A0A4R7S1J2      -------------------------
A0A2A2XV69      -------------------------
A0A651H7X9      -------------------------
A0A4Y8P842      -------------------------
B3DZK9          -------------------------
A0A5E6MPC4      -------------------------
A0A4V1SB02      -------------------------
A0A3C1VB86      -------------------------
A0A146G2Q9      -------------------------
A0A2T6D3Y2      -------------------------
A0A2V2SDV4      -------------------------
A0A2V5PK75      -------------------------
A0A1V6DME1      -------------------------
A0A3D3DIJ3      -------------------------
A0A2D5VY59      -------------------------
A0A2D8UZZ4      -------------------------
A0A353DV86      -------------------------
A0A2E5EPT8      -------------------------
A0A6I1K583      -------------------------
A0A350EWA4      -------------------------
A0A5B5WZ91      -------------------------
A0A2N8HD92      -------------------------
A0A2N8HIT2      -------------------------
A0A354EBD3      -------------------------
A0A355VEB2      -------------------------
A0A2N8IMT3      -------------------------
R6K1U5          -------------------------
A0A2N8IWC2      -------------------------
A0A2N8I441      -------------------------
A0A2N8I3A6      -------------------------
A0A410SCC4      -------------------------
A0A3R5VEW0      -------------------------
A0A411SSG2      -------------------------
B2UKW3          -------------------------
A0A1M6RLZ4      -------------------------
A0A354T7G8      -------------------------
A0A2S7U4L6      -------------------------
A0A512MBZ2      -------------------------
A0A2E8MEZ0      -------------------------
A0A4Q2YKS3      -------------------------
A0A6B3LBV6      -------------------------
A0A2E3EC33      -------------------------
A0A2E4GN01      -------------------------
A0A1Z8XU55      -------------------------
A0A2E1RQR9      -------------------------
A0A2E3ISQ4      -------------------------
A0A2D6W6F4      -------------------------
A0A2D8Z5A8      -------------------------
                                         

© 1998-2021Legal notice