BYKdb

Dataset for cluster tadcd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

286 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2A2XVF1      MSKRVDFPRRAFCEFRGIFVRFVFLFLIGMSVAAEPSNEYKLAPNDLLDFRVFQEPELDA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A800JGC6      ------------------------------------------------------------
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A7W1VTI1      ------------------------------------------------------------
A0A7V4IGZ6      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A848A4B3      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
A0A7T8XNA1      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A7W1RNH4      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A832MDW4      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A848ABG7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A7W1U7K0      ------------------------------------------------------------
A0A7W0YDK6      ------------------------------------------------------------
A0A7V9EPY1      ------------------------------------------------------------
A0A838TCM2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A7Y1UNY2      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A858RHU7      ------------------------------------------------------------
A0A7V7VLV5      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A7V7VK26      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A7W1MRT6      ------------------------------------------------------------
A0A7W1YXK2      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A832HNU4      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A848WTQ6      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A849Y642      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A7W8DJ38      ------------------------------------------------------------
A0A7W1ZQ43      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A848WYP9      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A7V3QFN7      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A840V0I7      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A838I246      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A838FVV7      ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7V4LSC4      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A7T9B0I0      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A7V6YXH8      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A7Y4QKN3      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A7X7VJR5      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A832D3W5      ------------------------------------------------------------
A0A7V2G542      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A832MGU4      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A832M6Y9      ------------------------------------------------------------
A0A832HP42      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A7Y2T9S5      ------------------------------------------------------------
A0A851GRQ2      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A840UX61      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
A0A8A7W668      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A800JJX7      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      VVRVSGDGQAIFPLVGGVAIAGASISEAIELIKSRYRDGYLKNPQVTLTVRSYAKKLFTI
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A800JGC6      ------------------------------------------------------------
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A7W1VTI1      ------------------------------------------------------------
A0A7V4IGZ6      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A848A4B3      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
A0A7T8XNA1      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A7W1RNH4      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A832MDW4      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A848ABG7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A7W1U7K0      ------------------------------------------------------------
A0A7W0YDK6      ------------------------------------------------------------
A0A7V9EPY1      ------------------------------------------------------------
A0A838TCM2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A7Y1UNY2      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A858RHU7      ------------------------------------------------------------
A0A7V7VLV5      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      --------------------------------------------------MSEENPNTGS
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A7V7VK26      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A7W1MRT6      ------------------------------------------------------------
A0A7W1YXK2      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A832HNU4      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A848WTQ6      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A849Y642      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A7W8DJ38      ------------------------------------------------------------
A0A7W1ZQ43      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A848WYP9      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A7V3QFN7      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A840V0I7      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A838I246      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A838FVV7      ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7V4LSC4      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A7T9B0I0      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A7V6YXH8      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A7Y4QKN3      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A7X7VJR5      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A832D3W5      ------------------------------------------------------------
A0A7V2G542      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A832MGU4      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A832M6Y9      ------------------------------------------------------------
A0A832HP42      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A7Y2T9S5      ------------------------------------------------------------
A0A851GRQ2      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A840UX61      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
A0A8A7W668      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A800JJX7      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      LGQVQQPGSYDIQSQIRGMSPLSVSRMVVSASSSLTRNAWRAVMKKPRSSSRREMSSPSA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ---------------------------------------------------------MRP
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A800JGC6      ------------------------------------------------------------
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------MKDNHS
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A290QGD9      -------------------------------------------------------MNPPA
A0A1D8AS58      -------------------------------------------------------MENAP
I6AQC1          -------------------------------------------------------MDSQA
W0ITH7          -------------------------------------------------------MDSQA
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      -------------------------------------------------MSMKMMSSPSP
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------MLWWSR
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V5URB2      -----------------------MSSISHLPVQSWSPTAFIGFSQPSCTSGPVSLLLDNK
A0A2V2DJ66      -----MENSDSKTPAQDGASQNAPSSQGAKSVRKKRNSGYGYG--YNYSAYGNYGGYGGY
R7L5A9          -----MESSNN--------NNSQPDSAPTKVIKKKIVASYGSGGYGGYGGYGDYGGYGAY
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A7W1VTI1      ------------------------------------------------------------
A0A7V4IGZ6      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A848A4B3      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      --------MPLNGTAGVSPGLALLWPWSPCACNGHSAAFSSGLIIPVNGNIGTVRLYRTD
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
A0A7T8XNA1      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A1Q6UHJ9      ---------------------MENTESKDNSGQKTVKRVIKKRIISDAAGAYGYGPGYGG
A0A2V2BXR0      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A7W1RNH4      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A832MDW4      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A848ABG7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A7W1U7K0      ------------------------------------------------------------
A0A7W0YDK6      ------------------------------------------------------------
A0A7V9EPY1      ------------------------------------------------------------
A0A838TCM2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A7Y1UNY2      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A858RHU7      ------------------------------------------------------------
A0A7V7VLV5      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      --------------------------------------------------MDPSQSAQTQ
A0A2A2PYE8      --------------------------------------------------MSSESGEKQS
A0A2T6CN73      -------------------------------------------------MAAEQEKHAPG
A0A2G4G428      TNSSSSSGSASGTNNTSRGSQRRGYGGGGYGGNYGGGYGGGYGGNYGGGYGGGYGGGYGG
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A7V7VK26      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
D5ENH7          ----------------------------------------MKNDYVRGGADPNSGGYGGY
A0A0R2XQ77      ----------------------------------------MKNDYVRGAPDPNSGGYSGY
A0A2E9IN28      ----------------------------------------MKNDYVRGGADPNTGGYGGY
A0A6N4WTJ5      ----------------------------------------MKNDYVRGAPDLNSGGYGGG
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A7W1MRT6      -----------------------------------------------------------M
A0A7W1YXK2      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A832HNU4      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ----------------------------MRNTTESMVQDPQEEASKRKPNYHNYHSYHNH
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A848WTQ6      ------------------------------------------------------------
A0A6N6ZHN8      ---------------------------------------------------------MSK
A0A6G6K641      ------------------------------------------------------------
A0A849Y642      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A7W8DJ38      ------------------------------------------------------------
A0A7W1ZQ43      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A848WYP9      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A7V3QFN7      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      -----------------------------------------------------------M
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A840V0I7      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A838I246      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A838FVV7      ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7V4LSC4      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A7T9B0I0      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A7V6YXH8      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A7Y4QKN3      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A7X7VJR5      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A832D3W5      ------------------------------------------------------------
A0A7V2G542      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A832MGU4      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A832M6Y9      ------------------------------------------------------------
A0A832HP42      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A7Y2T9S5      ------------------------------------------------------------
A0A851GRQ2      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A840UX61      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
A0A8A7W668      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A800JJX7      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      -----------------------------------------------------MGVFLFL
                                                                            

A0A2A2XVF1      SPYFKMLDPSRPPAEKRFGSVLPTIHSSLDEVGTALDLRR--------------------
A0A2V5UHJ2      MEQVNQPSPYFIRRTLRPENQTIDLHEFSVVEDQVLPLRD--------------------
A0A2V5PST3      PYNMRTYFPENDTQRPALPDSSESDYAYYGSEEERVQLLD--------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ----MENILRPPRPPTAGDAPAQPVSIGSPPPAKGFGIADLKH-----------------
A0A800JGC6      --------------MDYEKLNSIAESEISDSSGIARGLKD--------------------
A0A7Y2T8X5      ----------------MTDFPDDLDNFDNETERSPKQGLS--------------------
A0A1J4XH17      NKNEPEDQKSYGGYYNGYGSYSYGYGSGAYEENNQRNIKD--------------------
A0A7C5LI63      ----------------------MFNQTPAEARPEAVDIKE--------------------
A0A7C5P291      --------------------MAMTGPNPSESRAESVDIKE--------------------
A0A290QGD9      SPAPHGGPDQAPESPYGYGAYQQPP-----DGPQQRGFQD--------------------
A0A1D8AS58      KADKVQGPGEA-YPAYYGGGQGGYGVLGQGESQMHRSMQD--------------------
I6AQC1          KQPK---ASDG-RAEYGYGGYNEYPGYGN-EASGQRTLSD--------------------
W0ITH7          KQPN---PSDG-RAEYGYGGYNEYPGYGN-EASGQRTLSD--------------------
A0A139SU05      ----MAEPAGSSPTPPVPLGAAPSSSAADAPVEQRRSLRD--------------------
A0A139SPN4      -----------------------------MPAGQSRSLRD--------------------
A0A1V6E7N1      -------------MADVSAKSTHHSPGKDEEVVERRTLRD--------------------
A0A2D9MYT1      -----------------MXQXPFNESREEGLFEESINLRH--------------------
A0A258ANJ7      KASFNTMQPTSLSLPQSPMEMTQRLEADSESSSSFMNPAQ--------------------
A0A1Z8ZMT6      -------MAKLRSTPEPVDSYYDEAQAEIKKSPGLFDLAY--------------------
A0A2E8MCT7      -------MAKLRSAPGPVDSYYQETKADIKKSPGVFDLAY--------------------
A0A139TLN4      -----------------MKSSSPKPDSLETEGGASVSLFPSPRA----------------
A0A1G3ZFT0      --------------------MNTLTHGKANQENIEIDFVA--------------------
A0A5B5WI95      ---------------MVNRPSP--SPPVMEEEESNLSLDL--------------------
A0A2N8I9W1      ---------------MANNTAP--TPPVTENTEETTSLDT--------------------
A0A4Q5IH27      ---------------MANNTAP--TPPVTENTEETTSLDT--------------------
A0A2N8IBZ6      ---------------MANNTAP--TPPVTENTEETTSLDT--------------------
A0A7G6DX28      ---------------MANNTAP--TPPVTENTEETTSLDT--------------------
R6J100          ---------------MANNTAP--TPPVTENTEETTSLDT--------------------
A0A139TV24      ---------------MPQPTVPPVSSPAPETPDSSLSLDI--------------------
A0A2N8HT11      ---------------MPDTPAPPAAPPA-EEPESSLSLDV--------------------
R7DS70          ---------------MPDTPAPPAAPPA-EEPESSLSLDV--------------------
A0A2N8HNL6      ---------------MPDTPAPPAAPPA-EEPESSLSLDV--------------------
A0A290Q2Z2      RVWWWRPEKTSLLTGGEGNSLAARSMAHTHVSKEGASLAD--------------------
A0A2A2RGK2      -------------MSTDKVIQPRPPESAPP--IESIDWRE--------------------
A0A2A2XXF7      -------------MNKETDLKKPPSASPPPPSQEGIDWRE--------------------
A0A146GCJ0      -------------------MPKDDGENLTSKPAVNLSFRDDTHGDLFDSER---------
A0A2T6D6H8      -------------------MVNKGAENKDRKSAAQVTLLRELSGEVIDFER---------
A0A6B3L938      --------MKKEIDPFSDDAVAEGSDAGSNVPVSNRSAAG--------------------
A0A2A2R5D6      --------------------------MAAPASEVSLHFLD--------------------
A0A2V5URB2      EGPMKEISPHRARATMLLEDADLVSEPRLIESDEAPSLRD--------------------
A0A2V2DJ66      YGGYGAYGGYGG-----YGYGTNPAASGEGAEAPNRTLRD--------------------
R7L5A9          GGGYGGYGGYGGSYGGYYGGYNSKNPAGEGG-VPNRTFRD--------------------
A0A5B5WU87      -----------------MNDLSPKKESLDAVGAASVSLFPSPKA----------------
R7DZW0          -----------------MKDLSPKKETLDVGGAAPASLLPSPRA----------------
A0A2N8HID1      -----------------MKDLSPKKESLDAGGAAPVSLLPSPRA----------------
A0A2N8HS06      -----------------MKDLSPKKESLDAGGAAPASLLPSPRA----------------
A0A6N2TNT9      -----------------MKDLSPKKESLDAGGAAPASLLPSPRA----------------
A0A4P5QM05      ---------------------------MTESNEAKLHFLD--------------------
A0A4Q3C001      ---------------------------MIDSSEVKLHFLD--------------------
B4DB23          ---------------------------MNDSNEVKLHFLD--------------------
A0A5R8KA81      -----------------MRKSPASSRKIQYDSTTAFTYSD--------------------
A0A2E6T482      ----------------------MDKIPTTDQSSDKLHILD--------------------
A0A3C0DQZ7      ----------------------MDKIPTTDQSSDKLHILD--------------------
A0A1Z9CBK5      ----------------------MERNTGSDQSSDKLHILD--------------------
A0A2D6ZI96      ----------------------MERNTGSDQSSDKLHILD--------------------
A0A358KGZ3      ----------------------MEPTSRKENSSDKLHILD--------------------
A0A2E9ZQX4      ----------------------MEPTSRKENSSDKLHILD--------------------
A0A3D5JZU0      ----------------------MEPTSGKENSSDKLHILD--------------------
A0A2E6HCR0      ----------------------MDNNSGSEQSSDKLHILD--------------------
A0A1Z8WN04      ----------------------MDNTSGSEQSSEKLHILD--------------------
A0A2D7L1N4      ----------------------MDNTSGSEQSSEKLHILD--------------------
A0A2E2R937      ----------------------MDNTSGSEQSSEKLHILD--------------------
A0A520QQY4      ----------------------MDNTSGSEQSSEKLHILD--------------------
A0A2D5MR66      ----------------------MDKTSGLEQSSDKLHILD--------------------
A0A2E0PDQ1      ----------------------MDKTSGSEQSSDKLHILD--------------------
A0A2E2ZZP9      ----------------------MDKTSGSEQSSDKLHILD--------------------
A0A4P5YMI6      ----------------------MEAEAISSQPETKLHFLD--------------------
A0A7C4LRK7      -----------------MDAAKNNSANTPAAADTSLHFLD--------------------
A0A3C1VJ32      ---------------------MDQVT-TSAAPEARLHFLD--------------------
A0A7W1VTI1      ---------------------MDSNPNVSEAPEVKLHFLD--------------------
A0A7V4IGZ6      ---------------------MDPLK-TAATPENKLHFLD--------------------
A0A2N9NTX7      ---------------------MDPIP-VPPPQESKLHFLD--------------------
B9XK55          ---------------------MDPLK-TSAPPEAKLHFLD--------------------
A0A2A2RGF2      -----------------MDAAPKPTDSAPATPENRLHFLD--------------------
A0A2G4I5Y6      -----------------MDAAPHQAEPAPATPENRLHFLD--------------------
A0A6N6PS97      ------------------MEAAKFVPQDTATQESKLHFLD--------------------
A0A3M1I883      ----------------------MQSTSSSARPQTEFHFLD--------------------
A0A1V6JZ45      ----------------------MDATKPNPISDSQLHFLD--------------------
A0A848A4B3      ----------------------MDATKPNPISDSQLHFLD--------------------
A0A7C7Z746      -----------------MELSNSSNNQQINRPASKLHFLD--------------------
A0A520RRW5      -------------------MQTKPSQQPQQQSDSKLHFLD--------------------
A0A356NPK0      -------------------MQTKPSQQPQQQSDSKLHFLD--------------------
A0A2D7B5P5      -------------------MQTKPSQQPQQQSXSKLHFLD--------------------
A0A3D3XGB5      -------------------MQTKPSQQPQQQSDSKLHFLD--------------------
A0A2V6F8A1      ---------------------MEAPKTNSNPVETKLHFLD--------------------
A0A2V5TNH4      ---------------------MEAAKTNSNPVETKLHFLD--------------------
A0A2V5X5Q6      ---------------------METAKTNSNPVETKLHFLD--------------------
A0A3R5R2M8      ------------------MNAAPNTTSPMEEEESSFSLDT--------------------
A0A411SUQ6      SPGVQYFHTTFHPLSSMTNNTAPTPPVTENTEETALSLDT--------------------
A0A2N8HZF2      ----------------MTNNTAPTPPVTENTEETALSLDT--------------------
A0A354E720      ----------------MTKNTAPTPPGTENTEETALSLDT--------------------
A0A7T8XNA1      ----------------MTNNTAPTPPVTENTEETALSLDT--------------------
B2UPB6          ----------------MTNNTAPTPPVTENTEETALSLDT--------------------
A0A1Q6UHJ9      GYGGGYGGGYGGGGYGYGYGYGGGQGEGGSPERPNRTFRD--------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A3C1HEJ2      ----------------MATPSNYLPGDEGPEASSAVDLPS--------------------
A0A522ULD9      -------------------------MADKEAPEVGLHFLD--------------------
A0A7W1RNH4      ----------MSLPVRHYTQPLAILEPRRPAKSDELRLDD--------------------
A0A2D8V0G3      ------------------MEFQQSSQATETSVAENLNLRH--------------------
A0A348S017      ------------------MESNNQHSMENQSVAENLNLRH--------------------
A0A3C1UUV7      ------------------MESNNQHSMENQSVAENLNLRH--------------------
A0A350I3V2      ------------------MESNNQHSMENQSVAENLNLRH--------------------
A0A520RGV5      ------------------MESNNQHSMENQSVAENLNLRH--------------------
A0A3D3XF90      ------------------MESNNQHSMENQSVAENLNLRH--------------------
A0A2D7B522      ------------------MESNNQHSMENQSVAENLNLRH--------------------
A0A356NIC2      ------------------MESNNQHSMENQSVAENLNLRH--------------------
A0A832MDW4      -------------MPYFPQAATNDLIESSASPAANINLRH--------------------
A0A1V6JU76      -------------MSYSYYTSQAAPPEASESSSSNLNLRH--------------------
A0A848ABG7      -------------MSYSYYTSQAAPPEASESSSSNLNLRH--------------------
A0A2A2XXW5      ----------------MEEQFQSQQGNSMSGADPSINLRQ--------------------
A0A6N6Q6V0      -----------------MDNSQPNPIRSAGGTD-SRQLRH--------------------
A0A2V6JLK8      ----------------MGGSPPKGPTGMAHNEEVKLHFLD--------------------
A0A2W5Z1A5      ---------------------------MAETDEGKLHFLD--------------------
A0A2V6EA09      ---------------------------MAHNDEVKLHFLD--------------------
A0A2V6GQI7      ---------------------------MAHNDEVKLHFLD--------------------
A0A7W1U7K0      ---------------------------MAQTEEVKLHFLD--------------------
A0A7W0YDK6      ---------------------------MPETEEVRLHFLD--------------------
A0A7V9EPY1      ---------------------------MAHQEDVSLHFLD--------------------
A0A838TCM2      ---------------------------MAHNEDVSLHFLD--------------------
A0A2N8HDG3      ----------------MPDTSAPPAVPPAEESESSLSLDV--------------------
A0A3E1ET42      --------------------------MREQLNESKMHALD--------------------
A0A2A2YDW8      ------------------------MQPQSSNSEAALHAVD--------------------
A0A352XLN9      ------------------------MQPQSSNSEAALHAVD--------------------
A0A3D0YP62      -----------------------MQPQNSQQNEASLHAID--------------------
A0A3D3DV47      -----------------------MQPQNSQQNEASLHAID--------------------
A0A7Y1UNY2      ---------------------MSDFHGQNTPSEASLHAFD--------------------
A0A2E5XJ49      --------------------MQNDLDRQSAASEASLHAVD--------------------
A0A2E6SBY8      --------------------MQNDPDRQPAASEASLHAVD--------------------
A0A2E5QMS4      --------------------MQNDPDRQTAASEASLHAVD--------------------
A0A2E7YXQ3      --------------------MQNDPDRQTAASEASLHAVD--------------------
A0A2E3H787      --------------------MRNGPDRQTSASEAALHAVD--------------------
A0A2E7AGN1      --------------------MRNGPESQTNASEAALHAVD--------------------
A0A2E7AKY7      --------------------MRNGPESQTNASEAALHAVD--------------------
A0A3D4CU34      --------------------MRNGPESQTNASEAALHAVD--------------------
A0A2E8M146      --------------------MPNGPERQTNASEAALHAVD--------------------
A0A355S8S2      --------------------MPNGPERQTNASEAALHAVD--------------------
A0A2D6DVN8      --------------------MRNGPERQTNASEAALHAVD--------------------
A0A3C1W2R2      --------------------MRNGPERQTNASEAALHAVD--------------------
A0A2E3NAY6      --------------------MRNGPERQTNASEAALHAVD--------------------
A0A2E3II01      --------------------MRNGPERQTNASEAALHAVD--------------------
A0A368B8C5      --------------------MRNGPERQTNASEAALHAVD--------------------
A0A3R7RBB5      --------------------MRNGPERQTNASEAALHAVD--------------------
A0A2A2QX62      ------------------------MNPTTNTSEASLHAID--------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A858RHU7      ----------------------------MNQSEANLHAID--------------------
A0A7V7VLV5      ----------------------MSTTSTPKQSETALHAFD--------------------
A0A3N5WCF1      -----------------------MNTSAPQQNEAALHAVD--------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3D1TI55      --------------------------MDEKQQDSSLHFLD--------------------
A0A3R8IT45      PNDGRYGYGY-QEYPGY----------GNENAAGHRTLGD--------------------
A0A2A2PYE8      QNSSGYGYNYGGNYAGYSAVGYGYGEGGGGGSHSQRTFQD--------------------
A0A2T6CN73      ESGGGYSYGTGGNYAGYSAAGYGYGD-AGESSTIQRTFQD--------------------
A0A2G4G428      GNYGGGYGGGYGRQRGGYGGGYGGGYGEGSSKDTEVSIST--------------------
A0A6N6PCD8      -------------------MATRPSTKATQPPASEAKLIDLHA-----------------
A0A139TUL1      ----------------------MSIPVIQPEDNDIFSFRF--------------------
A0A2N8HCB0      ----------------------MPVSVIQPEDNDIFSFRF--------------------
A0A2N8HP04      ----------------------MPVSVIQPEDNDIFSFRF--------------------
A0A2N8HRJ0      ----------------------MPVSVIQPEDNDIFSFRF--------------------
A0A6N2U9Y7      ----------------------MPVSVIQPEDNDIFSFRF--------------------
A0A6N6PAZ1      ---MPPLHRSNRQFLDRDDASDDSPEPDSAHADGQDKTKR--------------------
A0A7V7VK26      ---MPPLHRLNRQIPDRDDTSDDSLEAESALGAGQNKMRR--------------------
A0A6I1K459      -----------------MEPFEQPRAGDVSPEAGTLFNRN--------------------
D5ENH7          G-------YGYGGGSYGYGGYGSGGGGAGYEQGPQRSAKD--------------------
A0A0R2XQ77      G--------GYGSNSYSDGGYGAGGY--GAGGAPQRSFKD--------------------
A0A2E9IN28      G-----YGYGYGGGYGYGGYGAGGGYGEGGGGAPQRSFKD--------------------
A0A6N4WTJ5      GYGGGSYGYGYGSGYGDGGSYGGGGY---GSGAPQRSFKD--------------------
A0A366HAG0      -------------------------MATPNNLELQRHALD--------------------
A0A2U8DZK4      -------------------------MAYSDPVKESAPLPA--------------------
A0A2T6DFL8      -------------------------MANVHAAPVGASVAG--------------------
A0A1D8AWD4      -------------------------MPTLPSTKDSATLGD--------------------
A0A4Q1C9S2      -------------------------MAFSPVSKDSATLGD--------------------
A0A178IH18      -------------------------MARPDSSSETAALPE--------------------
A0A2T6DT99      -------------------------MASTHASREGASLAD--------------------
A0A1G3ZT33      -------------------------MASIITSRDGGSLTD--------------------
A0A3E1E2T2      -------------------------MAQPSASKDSATLAD--------------------
B1ZMW1          -------------------------MVPTSASKDSASLAD--------------------
A0A3M1I8A3      ---------MAYQAYPQTAPADPVSLPPAGGAMGSMTLRH--------------------
A0A4V0XS84      -------------------MNSKGNLTQSKSLADKIDFNE--------------------
A0A351WE84      ------METSEATRASLVILGCGVKFMADSQQDTALHFLD--------------------
A0A7W1MRT6      SELLPFDSSQANRLTEPARPRIVATPDAHAAAGEMGDLKE--------------------
A0A7W1YXK2      ----------------------MSRSLTPAREEPLIDFRH--------------------
A0A2D5WGA5      ----------------------MDKLPKTDQSSDKLHILD--------------------
A0A2E7SSH2      ----------------------MERKPGTEHSSDKLHILD--------------------
A0A832HNU4      ----------------------------MSTTATAIRHLPSAAGAGWRT-----------
A0A1V5QDZ6      -------------------------MEQQPSDSSGLHFLD--------------------
A0A4Y8P964      -----------MSEEIQRIPDQNFPSGQIQDPNSNLTAIP-----------SDPYYSFST
A0A3D4HF88      GYHGYHGYGGHGGAGYGGYGYGYGDDYSTQHRQPPRTFRD--------------------
A0A1V6J089      --------------------------MAEESQTTALHFLD--------------------
A0A3C1BZR1      --------------------------MAEESQTTALHFLD--------------------
A0A848WTQ6      --------------------------MSLPSSEVRLHALD--------------------
A0A6N6ZHN8      EGKGYGYGYGGGGYYGGYYYGDGYGGYAEAAVSPSRTLKD--------------------
A0A6G6K641      --------------MRSKNSDIEDDEDDVKGSGEGLSWRV--------------------
A0A849Y642      ---------------------------MNPPAEPSLHFLD--------------------
A0A7C4KLL2      ----------------------MVAPSQPHQSTQPIHYMPAPDITAPESPSELRT-----
A0A1H6KPB7      ----------------------MSSPAINQKSEASLHAGD--------------------
A0A2E9ISN4      -----------MQIPNSTISESKPPTPADNDRETTTAFSNPWA-----------------
B9XAX1          ---------------MKLRLSNEREIAEMTEVDRPLDVQE--------------------
A0A5R8KKM9      -------------------------MNPSPPQEHRQHALD--------------------
A0A7W8DJ38      -------MQPASLNLTRPAYEMPPRMEAEAEPQSALNPAQ--------------------
A0A7W1ZQ43      ----------------MSKNGSNHSAPDRQPMPASAEIIDVTKPFDFRG-----------
A0A139TS01      -----------------------MNAPDQQNGDPIVRNID--------------------
A0A3E1EJT7      -------MNPPSPYARSSYAPVNPDFTDGEEPEDNDYLRR--------------------
A0A848WYP9      ----------------MNHFSPGHQAPAESGQEPLFPGFPTLDIGA--------------
A0A7C3I5X9      ----------MDYDLDRMGTAQGLPGEAEGAGGSKVNLRH--------------------
A0A349GXM8      -------------------MATPRPGGGVSTEENKIDFRI--------------------
A0A7V3QFN7      ----------------------MDTTKTSPATESRLHFLD--------------------
A0A4P5YP61      ------------------MIQNRSESEFDQEAGSSVDLRQ--------------------
A0A6B2LYM4      SNNQYQSGGSQGGYYGGYYYGEGYSGYADSGNAPSRSLTD--------------------
A0A6D1VXB3      -----------------------MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSFST
I0JYY7          -----------------------MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSFST
A0A4Y8P842      ---------MSEELQKKPEDVLAVGSKEALPTEVLLSPYESSDLDWIKQK----------
B3DZK9          ---------MSEELQKKPKDNLTVGNKDVFQTEVLLSPYESSDLEWLKEK----------
A0A4R7S1J2      ----------------------MSLSSLPPQGPTRLNLPKTFSQDLESEADFD-------
A0A2A2XV69      ------------------------MMNSSDSNEIQLHFLD--------------------
A0A651H7X9      -----------------------MSQQPPHQEPESTRPTPHRYAYSDSGIDSSPYGEGGP
A0A5E6MPC4      ------------------------------MEEIQPRPRESLGPLASGALPLEVSEEGSG
A0A840V0I7      -----------------------MPRRSIRSHEDSLEFEDEDVFERHSVAQQERLRRLII
A0A146G2Q9      -----------------------MSLESPDSGEIKLHFLD--------------------
A0A2T6D3Y2      -----------------------MSFESPDSGEIKLHFLD--------------------
A0A6N6PKP9      ----MERRIGPDPTLVLICIPMPRSTEKQPNSSLATDLRG--------------------
A0A6N6Z250      -----------------------MSAAGADPHSEPLSLGE--------------------
A0A4V1SB02      -----------------------------------MNPLH--------------------
A0A6N6QEJ2      -----------------MEAIKTQASAASGISDSKLHFLD--------------------
A0A3C1VB86      --------------MPNPDPLDLPPSLETSAPGSISDLHG--------------------
A0A6N6P5E3      -------------------MQSNIQTTESGTGEIKLHLLD--------------------
A0A838I246      ---------------------------MAHTEEAKLHFLD--------------------
A0A6J4HTK1      ---------------------------MAQTDEVKLHFLD--------------------
A0A838FVV7      ---------------------------MAQTEEAKLHFLD--------------------
A0A7C3HWX0      ---------------------MDTSKTSSAPQDSPLHFLD--------------------
A0A7V4LSC4      ---------------------METNK-AAATTESSLHFLD--------------------
A0A2D5VY59      ----------------------MQSKPVPQQSDSKLHFLD--------------------
A0A2D8UZZ4      ----------------------MQSKPVPQQSDSKLHFLD--------------------
A0A353DV86      ----------------------MQSKPVPQQSDSKLHFLD--------------------
A0A2E5EPT8      ---------------------MEYQSNGPTSSDNRLHFLD--------------------
A0A5B5WZ91      -----------------------MNAPDLQNGDPIVRNID--------------------
A0A2N8HD92      -----------------------MNSQDQQNSDRIVRNID--------------------
A0A2N8HIT2      -----------------------MNAQDQQNSDRIVRNID--------------------
A0A354EBD3      -----------------------------------VRNID--------------------
A0A355VEB2      -----------------------MSAQDQQNSDRIVRNID--------------------
R6K1U5          -----------------------MSAQDQQNSDRIVRNID--------------------
A0A2N8IWC2      -----------------------MSAQDQQNSDRIVRNID--------------------
A0A2N8I441      -----------------------MSAQDQQNSDRIVRNID--------------------
A0A2N8I3A6      -----------------------MNAQDQQNSDRIVRNID--------------------
A0A410SCC4      -----------------------MNAQDQQNSDRIVRNID--------------------
A0A3R5VEW0      -----------------------MSVQDQQNSDRIVRNID--------------------
A0A7T9B0I0      -----------------------MSAQDQQNSDRIVRNID--------------------
B2UKW3          -----------------------MSAQDQQNSDRIVRNID--------------------
A0A411SSG2      -----------------------MSAQDQQNSDRIVRNID--------------------
A0A6M1RXR2      ---------------------MEPNKVATPPPETKLHFLD--------------------
A0A7C3DXS4      ---------------------MDATKVATPPPETKLHFLD--------------------
A0A7V6YXH8      ---------------------MDSSKVP-APQEIKLHFLD--------------------
A0A2V2SDV4      ---------------------MDPIKAA-APQDSKLHFLD--------------------
A0A6N6PHJ5      ---------------------MEPLKQQ-AQQESRLHFLD--------------------
A0A7Y4QKN3      ---------------------MDPLKTQ-TQQETRLHFLD--------------------
A0A2V5PK75      ---------------------MDPLKVP-ASQETKLHFLD--------------------
A0A1V6DME1      ---------------------MDPLKTT-PPPETKLHFLD--------------------
A0A3D3DIJ3      ---------------------MDPLKVA-PPQEAKLHFLD--------------------
A0A7X7VJR5      ---------------------MDPLKVA-PPQEAKLHFLD--------------------
A0A6I1K583      -----------------MDAASNYATPAAGTPENRLHFLD--------------------
A0A350EWA4      -----------------------MDSFKQDQPTASLHFLD--------------------
A0A832D3W5      -----------------------------------MHFLD--------------------
A0A7V2G542      --------------------------MNVETSEIKLHFLD--------------------
A0A7C4KPD7      --------------------MDSTKSFGTPQAETKLHFLD--------------------
A0A832MGU4      ---------------MDAEKTTFGAQTAGQASDSQLHFLD--------------------
A0A1M6RLZ4      ----------------------MQQNNSLNPSEASLHAVD--------------------
A0A832M6Y9      ---------------------------MAEQTEVSLHFSD--------------------
A0A832HP42      -----------------MENAKTTVPTQTAAPESQLHFLD--------------------
A0A354T7G8      --------------------------MNETGSEFQKHAMD--------------------
A0A512MBZ2      --------------------------MSEAGKDIQAQAID--------------------
A0A2E8MEZ0      ------------------------MQGTNFRNADDAPSVD--------------------
A0A7Y2T9S5      -----------------------MQTENTNQNEASLHAID--------------------
A0A851GRQ2      -----------------------MQNPDPNQSEANLHAID--------------------
A0A6B3LBV6      ---------------MANPPYFNPNRFQQNSQESGPQVGD--------------------
A0A840UX61      -----------------------MSSPNSQSAEAGLHAVD--------------------
A0A4Q2YKS3      -----------------------MQSPSTQQSEAALHAVD--------------------
A0A6N6P3T8      -----------------------MPTPPPQQSETALHAFD--------------------
A0A8A7W668      ------------------------MNPSQQQNEASLHAVD--------------------
A0A2E3EC33      ---------------------------MAKQSETKLHALD--------------------
A0A2E4GN01      ---------------------------MAKQSETKLHALD--------------------
A0A800JJX7      ---------------------------MAKQSETKLHALD--------------------
A0A1Z8XU55      ---------------------------MAKQSETKLHALD--------------------
A0A2E1RQR9      ---------------------------MAKQSETKLHALD--------------------
A0A2E3ISQ4      ---------------------------MAKQSETKLHALD--------------------
A0A2D6W6F4      ---------------------------MAKQSETKLHALD--------------------
A0A2D8Z5A8      VEKTSECSYFADSKFILNSPQIKYIXTMAKQSETKLHALD--------------------
                                                                            

A0A2A2XVF1      ------IYHLLLQRWWVITLLVGVSMMAATGYV-MRQP--KIYESRAVLQVQQSEQQVVN
A0A2V5UHJ2      ------YWLIIKRHRWLILSCALALFIGATLYT-FTRT--PLYTADATLLIERKAPQILK
A0A2V5PST3      ------YWKNLVKRRRIIIQIFIIFLLVGAYFT-FTAT--PVYKATATLKIEPINPMVTG
A0A2V5PXM3      ----------------------MVAAIGTTTYL-LRAP--KIYASKLVLQVEQEEQKILN
A0A1V5QB01      ------YFHIVVKRIWLVALCFVLSLTVMVAIL-VRQV--PVYRCRVTLLMSKGVPMPYS
A0A800JGC6      ------YIFWVRNKLWLVMLITVVGIVLGIFVH-MKSP--PIYQANASIEVERVERGDSL
A0A7Y2T8X5      ------RLRMAFVRWWLILIFAILGYVIALYTL-SIAE--PSHKARAVLELITKQRSLVG
A0A1J4XH17      ------YLLILRERVWLLVFVFAIIFLGSIIYL-IKAT--PIYEAEAMLQILRDDTTVLG
A0A7C5LI63      ------YLAVLLKRKWLILVCFLLSMAGATVFL-FTRQ--PIYRANARLLVTTAG-SLPT
A0A7C5P291      ------YLAIILKRKWLVLICFLLSMAASTAFL-FTRQ--SIWRANCKLLVTSAGAALPS
A0A290QGD9      ------YVLILRERIWYILAVFLVIFSCVLVYT-LTQT--KIYQSRSLIQILRRDPAVLK
A0A1D8AS58      ------YLLILRERVWYIVLVFALVFSAAVIFT-FTRV--PRYTSVASVQVFRNDPVVMQ
I6AQC1          ------YLLILRERIWYIVVVFLVIFSSALVYT-FSQT--KIFSSSATVQIMRRPAMTLP
W0ITH7          ------YLLILRERIWYIVVVFLVIFSSALVYT-FSQT--KIFSASATVQIMRRTAVTLP
A0A139SU05      ------YYVILRERFWIALPLALLVSLVIGYYQ-ARQT--PMYASTAIIQFERPETVVTT
A0A139SPN4      ------YYVILRERFWIALPLALLVALGIGYYQ-ARQT--PMYASTAIIQFERPETIVTT
A0A1V6E7N1      ------YLIILRERLWIALPIALLVAVGIGYYQ-SRAT--PLYQSRATLRFEKPDRIVAT
A0A2D9MYT1      ------YWHIVLERRWLVAATFLVVIILTAFYL-FSAT--PIFSATTRLQIDRETENALR
A0A258ANJ7      ------LVDGMRRHSWIPITLSLFGLILGYAYF-KRQK--PVYEAVSVAQFGSEQSSLLG
A0A1Z8ZMT6      ------LLPRLIARWHWILIGSLLGVVLGVITI-RMSV--PEYRSTATVRVKSQNSGSMG
A0A2E8MCT7      ------LLPRLIARWHWILIGILLGVVLGVINI-RMSV--PEYRSTATVRVKSQNSGSMG
A0A139TLN4      ------LLARIIRNWYWCLLSLCICLPLAYLYA-ARLP--FVYGKATTVLIKNDYPKESV
A0A1G3ZFT0      ------LFHQLLEHKWLIAVIIAISLMGGKYYA-SKQI--PVYNPDVLIQVESNRGVSGL
A0A5B5WI95      ------ALAILRRYWFIIMLAAVAGGMLAFYLA-GRQN--YVYQKTASIIMRDAKSGTDA
A0A2N8I9W1      ------VLLVLRRYWFIIILAALAGGTAAYYLA-GRQN--YIYQKTASVLMRDAKTSSDA
A0A4Q5IH27      ------VLLVLRRYWFIIILAALAGGTAAYYLA-GRQN--YIYQKTASVLMRDAKTSSDA
A0A2N8IBZ6      ------VLLVLRRYWFIIILAALAGGTAAYYLA-GRQN--YIYQKTASVLMRDAKTSSDA
A0A7G6DX28      ------VLLVLRRYWFIIILAALAGGTAAYYLA-GRQN--YIYQKTASVLMRDAKTSSDA
R6J100          ------VLLVLRRYWFIIILAALAGGTAAYYLA-GRQN--YIYQKTASVLMRDAKTSSDA
A0A139TV24      ------VAIILRRRWYWILFCALLGGTAAYYMA-ATQN--YVFEKTASVMMREASKD--S
A0A2N8HT11      ------ITSILLRRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDS-S
R7DS70          ------ITSILLRRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDS-S
A0A2N8HNL6      ------ITSILLRRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDS-S
A0A290Q2Z2      ------FFHLLRLRKALIFLILSLVVITTVVVT-AFLP--KWYLSTLNVRVEKPEGEVKL
A0A2A2RGK2      ------YFHAVIDRLWIVILCVILGGIYAGFTL-SKIE--TTYRARAVLFIEQDQARILD
A0A2A2XXF7      ------YFHAVVDRLWIVILCVVVGGIYAGVTL-SKVE--TTYRARAVLFIEQDKSRILD
A0A146GCJ0      ------WFNLLRSKAWLIAAVAVVVVIGAAAYA-FRLP--KIYESRALLQVEQLAQKVVD
A0A2T6D6H8      ------LLNLLRARAWLVIVVAVIFFAAAFAYA-LRSP--KIYESRALIQVEQASQNVVD
A0A6B3L938      ------LIQVALEKWWMIVIFAALGYVAALYYL-SIKE--PTTKARAVVEVTTKELQLVG
A0A2A2R5D6      ------YWRVIRNRAAIIVTVLLLTLMTGYVVTVYVMQ--KMYDAKAQLRVYKEKSDVEF
A0A2V5URB2      ------YWQIVRKHKWKILACFLAAVVITAIIV-FSMT--PIYTATATLLIERKAPQVVK
A0A2V2DJ66      ------YFMILRERLWYIIVTFIVIFSGIALYT-LRIT--PLYTSASSVLIFREAAAPID
R7L5A9          ------YMMILRERFWYIIVTFFIIFAGVLLYT-FRIT--PIYTSAASVQILRDSDSPID
A0A5B5WU87      ------ILGRIVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILIKDDYPKESV
R7DZW0          ------IMGRIVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILIKDDYPRESV
A0A2N8HID1      ------IMGRIVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILIKDDYPRESV
A0A2N8HS06      ------IMGRIVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILIKDDYPRESV
A0A6N2TNT9      ------IMGRIVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILIKDDYPRESV
A0A4P5QM05      ------YWRVVKLRLGLILLTFFLVMVSAEVYV-YFLP--RQFYSHVTVEIKPDVFDRLN
A0A4Q3C001      ------YWRVIRVRAGLITLVFLLVMITAGVTT-YFMP--RQYLAKVSMVVKPDSTKGVS
B4DB23          ------YWRIIRLRMGLILLTFFLVMVTAGVTT-YFLP--KKYYSKVTMEVKQDKSDLVQ
A0A5R8KA81      ------IFHVLRDKAWLIVLCLLVAAFIVAAML-VRSV--PLYQSRVVVQVEQSETKVLD
A0A2E6T482      ------YWRILRVRFVTILLVFLLTAVTTTVVT-FLLP--RTYMSLSRISVEKDSSDIAP
A0A3C0DQZ7      ------YWRILRVRFVTILLVFLLTAVTTTVVT-FLLP--RTYMSLSRISVEKDSSDIAP
A0A1Z9CBK5      ------YWRIIRVRIATILLVFLLTAITTTVVT-VMLP--STYMSLSRIAVEKDTSDIAP
A0A2D6ZI96      ------YWRIIRVRIATILLVFLLTAITTTVVT-VMLP--STYMSLSRIAVEKDTSDIAP
A0A358KGZ3      ------YWRIIRVRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAVEKDTSDIAP
A0A2E9ZQX4      ------YWRIIRVRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAVEKDTSDIAP
A0A3D5JZU0      ------YWRIIRVRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAVEKDTSDIAP
A0A2E6HCR0      ------YWRIIRVRIATILLVFLLTAITTTVVT-FLIP--PTYMSISRIAVEKDTSDIAP
A0A1Z8WN04      ------YWRIIRVRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAVEKDTSDIAP
A0A2D7L1N4      ------YWRIIRVRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAVEKDTSDIAP
A0A2E2R937      ------YWRIIRVRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAVEKDTSDIAP
A0A520QQY4      ------YWRIIRVRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAVEKDTSDIAP
A0A2D5MR66      ------YWRIIRVRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAVEKDTSDIAP
A0A2E0PDQ1      ------YWRIIRVRIAIILVVFLLTAITTTVVT-FLIP--PTYMSLSRIAVEKDTSDIAP
A0A2E2ZZP9      ------YWRIIRVRIAIILVVFLLTAITTTVVT-FLIP--PTYMSLSRIAVEKDTSDIAP
A0A4P5YMI6      ------YWRIIRIRKMVILTVFLLVVITTTAVT-YVLP--KTYMSSVRIDVQKDVSDVQF
A0A7C4LRK7      ------YWRIIRVRKTVILTVFMLVVLTTTLVT-QYLP--QYYSSTARIEVEKDMPDVEG
A0A3C1VJ32      ------YWRVIRIRKAIIITVFLITAIIATAVT-LILP--ESYASTARIKVENEGGIVSG
A0A7W1VTI1      ------YWRIIRIRKMVILAVFFLVVLTTAVVS-YFLP--KSYSAEVSISVEKDVTDVSS
A0A7V4IGZ6      ------YWRIIRIRKTVIISVFLLVLITTAVVT-FVLP--PSYYSSARIRVDRDRSDIGD
A0A2N9NTX7      ------YWRIIRIRKTVILAVFLLVVITATVVT-FILP--PKYKSMARIKIERDQTDIPS
B9XK55          ------YWRIIRIRKTVILAVFLLVVITATIVT-FILP--EQFSSTARIKVEGDTTDVPG
A0A2A2RGF2      ------YWRIIRMRALLIFVVFALVVGTTALLT-HNME--PTFMSTVRMDVQKDVGDISS
A0A2G4I5Y6      ------YWRIIRMRGLLIFVVFALVVGTTAVLT-HSME--PTYMSTVRMDVQKDVGDITS
A0A6N6PS97      ------YWRIIQVRKTVIIAVFLLVVITTTVVT-YILP--KTYMSTAQIEVQKDLSDIPL
A0A3M1I883      ------YWRIIRIRKMVILAVWLLVVLTTLAVT-FVLK--PTYASTVRIEIEKDATDIPT
A0A1V6JZ45      ------YWRIIRIRKTVILAVFLLVVLTTTAVT-FVLK--PTFMSTARIEVEKQPTDFDP
A0A848A4B3      ------YWRIIRIRKTVILAVFLLVVLTTTAVT-FVLK--PTFMSTARIEVEKQPTDFDP
A0A7C7Z746      ------YWRIIRIRKMVIIAVFLLVLLSTTAIT-LILP--KTYSSTVRISVAKDATDIPG
A0A520RRW5      ------YWRIIRIRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAIEKDNSDITP
A0A356NPK0      ------YWRIIRIRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAIEKDNSDITP
A0A2D7B5P5      ------YWRIIRIRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAIEKDNSDITP
A0A3D3XGB5      ------YWRIIRIRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAIEKDNSDITP
A0A2V6F8A1      ------YWRIIRIRKTVILAVFLLVVLTTTAVT-FILP--ESWSSMVRIAVEKDISDISP
A0A2V5TNH4      ------YWRIIRIRKTVILAVFLLVVLTTTAVT-FILP--ESWSSTVRIAVEKDVSDINP
A0A2V5X5Q6      ------YWRIIRIRKTVILAVFLLVVLTTTAVT-FILP--ESWSSTVRIAVEKDVSDINP
A0A3R5R2M8      ------VLVILRRFWFLIILAAIAGGSLAFYLA-GRQN--YVYQKTASVMMRDA------
A0A411SUQ6      ------VLTILRRYWFIIILAALAGGTAAYYLA-GKQN--YIYQKTASVLMRDA------
A0A2N8HZF2      ------VLTILRRYWFIIILAALAGGTAAYYLA-GRQN--YIYQKTASVLMRDA------
A0A354E720      ------VLMILRRYWFIIILAALAGGTAAYYLA-GKQN--YIYQKKASVLMRDS------
A0A7T8XNA1      ------VLTILRRYWFIIILAALAGGTAAYYLA-GKQN--YIYQKTASVLMRDA------
B2UPB6          ------VLTILRRYWFIIILAALAGGTAAYYLA-GKQN--YIYQKTASVLMRDA------
A0A1Q6UHJ9      ------YMMILRERWAYILITALIILAGVILYT-LRVT--PIYMSVSRVQILRDSDVAIE
A0A2V2BXR0      -------MMILRERWAYILITALIILAGVILYT-LRVT--PIYMSVSRVQILRDSDVAIE
A0A3C1HEJ2      -------ARTLIEKAWVVVLCLLAAGFITYGYL-KRAP--VIYASTVTLKVEEQSQKILS
A0A522ULD9      ------YWRVVRSRKEIVLAVALLVIITVTAWT-MTLP--RMYETEVKVSLKEDQADVEV
A0A7W1RNH4      ------MWRMLQRNVVLIAACVIACATAAWIYV-HYAR--PVYEANALFDINGQRSVEFA
A0A2D8V0G3      ------YWHILLERRWLVITTFISVVILSVLYL-YRAV--PIYQAKTVLQINKESTSIMD
A0A348S017      ------YWHIVLERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQINKESTSMMD
A0A3C1UUV7      ------YWHIVLERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQINKESTSMMD
A0A350I3V2      ------YWHIVLERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQINKESTSMMD
A0A520RGV5      ------YWHIVLERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQINKESTSMMD
A0A3D3XF90      ------YWHIVLERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQINKESTSMMD
A0A2D7B522      ------YWHIVLERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQINKESTSMMD
A0A356NIC2      ------YWHIVLERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQINKESTSMMD
A0A832MDW4      ------YWHVILERRWLVIATFVSVFVLCLVYL-YKAP--KIYQATTRIQIDRESSTFNL
A0A1V6JU76      ------YWNIVLQRRWLVIATFVSVFVLCLVYL-FKAP--RIYSATARLQIDRESAASLN
A0A848ABG7      ------YWNIVLQRRWLVIATFVSVFVLCLVYL-FKAP--RIYSATARLQIDRESAASLN
A0A2A2XXW5      ------YWHVILERRWLIVATWSVCIIAGVLYA-FQAT--PMFRAIARLQIDPENQGVLN
A0A6N6Q6V0      ------YWQVMLERRWLIIVIFLGFVSAGFVYA-FRST--PIYESVARLEIDPEGTGVLS
A0A2V6JLK8      ------YWRVIRIRWVLVLLAFLLVLITAAIFT-YFQP--REYKADVFVEVKSTAENPRI
A0A2W5Z1A5      ------YWRVVRVRWVLILLAFSLVLITAAVVT-YFQP--REYQSSAFIEVRSTAQNPHI
A0A2V6EA09      ------YWRVVRVRWGLISLAFFLVLITAAIVT-YFQP--REYKASAFIEVKSTAENPRI
A0A2V6GQI7      ------YWRVVRVRWGLISLAFFLVLITAAIVT-YFQP--REYKASAFIEVKSTAENPRI
A0A7W1U7K0      ------YWRVIRVRWVLILLAFLLVVITAAVVT-YFQP--REYQSSVFIEVKSTAETPRI
A0A7W0YDK6      ------YWRVIRVRWGLILLAFLLVVMTTAVVT-YFQP--REYQSSVFIEVKSTAENPRI
A0A7V9EPY1      ------YWRVIRVRWGLILLAFLLVVITTAVVT-YFQP--REYQSSVFIEVKSMAENPRI
A0A838TCM2      ------YWRVIRVRWGLILLAFLLVVITTAVVT-YFQP--REYQSSVFIEVKSMAENPRI
A0A2N8HDG3      ------ITGILLRRWYWILLFALIGGGAAYYLT-GRQN--YIFEKTASVIMRESSKESTS
A0A3E1ET42      ------YWQVIRNRWGVILLTFFLIALASLVII-ALLD--KKYQSTTRFRVLLS-SAIDP
A0A2A2YDW8      ------YWQVIKNRYGVILITLLLVFMTAAVIT-YVMP--RKFESRAVVQVNPSNRFGTA
A0A352XLN9      ------YWQVIKNRYGVILITLLLVFMTAAVIT-YVMP--RKFESRAVVQVNPSNRFGTA
A0A3D0YP62      ------YWQVLKNRYGVILLTFLLVFLTAAVIT-YVMP--KKYESAALVEVKP-ISDIDP
A0A3D3DV47      ------YWQVLKNRYGVILLTFLLVFLTAAVIT-YVMP--KKYESAALVEVKP-ISDIDP
A0A7Y1UNY2      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYQSIAVVQVNPSVQEVDP
A0A2E5XJ49      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVIP--KQYESTALVQVNHSFVELDP
A0A2E6SBY8      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVIP--KQYESTALVQVNHSYIELDP
A0A2E5QMS4      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFVELDP
A0A2E7YXQ3      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFVELDP
A0A2E3H787      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFVELDP
A0A2E7AGN1      ------YWQVLKNRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQVNYSYIELDP
A0A2E7AKY7      ------YWQVLKNRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQVNYSYIELDP
A0A3D4CU34      ------YWQVLKNRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQVNYSYIELDP
A0A2E8M146      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFIELDP
A0A355S8S2      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFIELDP
A0A2D6DVN8      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFIELDP
A0A3C1W2R2      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFIELDP
A0A2E3NAY6      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFVELDP
A0A2E3II01      ------YWQVLKNRYGVILLTFVLIFMTAAVIT-YVLP--KKYESTALLQVNHSFIELDP
A0A368B8C5      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFIELDP
A0A3R7RBB5      ------YWQVLKNRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQVNHSFIELDP
A0A2A2QX62      ------YWQVAKNRYGVILLTFLLVFMTALVIT-YVMP--KKYESTAVVQVRPKGAGAVM
A0A4Q3BWH6      ----------------------LLVFMTALVIT-YVMP--KKYESTATVQVRPMGTGTQV
A0A858RHU7      ------YWQVIKNRYGVILLTFLLVFMTALVIT-YVMP--KKYESKAVVQVRPKGTSANL
A0A7V7VLV5      ------YWQVIKNRYGLILLTLLLVFMTASVIT-YVMP--KKYESYAKIEVKPRGTLITV
A0A3N5WCF1      ------YWQVIKNRYGIILLTLLLVFMTAAVIT-YVMP--KKYESQAVIEVKPRMPGMSP
A0A4Q3C1K5      -----------------ILLTLLLVFMTAAVIT-YVMP--KKFESEATIEVKPRSAGISP
A0A3D1TI55      ------YWRVIRARKEIIITVSVLIILTVFIIT-LIMP--EKYRASVRITIDQY-RPDIE
A0A3R8IT45      ------YLLILRERIWYIVVVFLVIFSSALVYT-FSQT--KIYRAMATAQILRKTATMFS
A0A2A2PYE8      ------YLLILRERIWYIVVVFLVVFSSSLVYT-LSDT--KIYQSSATVQIFRRDPTVM-
A0A2T6CN73      ------YLLIVRERIWYIVVVFLVVFSSALVYT-LSKP--KIYESTATVQIFRRDPTIM-
A0A2G4G428      ------YVNMVRERIWWLVLSVLIFFTLSLVYT-YNMM--PEYKASGRLRVFRLAPNISG
A0A6N6PCD8      ------WFFLLREKWWIIALCLFGMLALAGAYL-LRKV--PVYTAATIVQVTEAADNVIN
A0A139TUL1      ------IFSTARRYWLWILAAALLGGAGAYFIF-ARQG--YLYEKTARIMLRDDKQKNSQ
A0A2N8HCB0      ------IFSTARRYWPWILACALLGGGLAYFIS-ARQG--YLYQKTARIMLRDDKQKNAQ
A0A2N8HP04      ------IFSTARRYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQ
A0A2N8HRJ0      ------IFSTARRYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQ
A0A6N2U9Y7      ------IFSTARRYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQ
A0A6N6PAZ1      ------LMLNLLGRWHWIVLGGVLGLLSASYYL-AKCP--KQYTATATLLIKQQTASVM-
A0A7V7VK26      ------LVIYLIGSWYWIVLGGILGLLCASYYL-AKSP--KEYSATATLLIKQQTASVMA
A0A6I1K459      ------LWHAFMEKAWLVVCIMAAAAAAGIWTS-NRTP--PVYQSRAVMFFDFGEQKVLN
D5ENH7          ------YLLMFRERIWWMIVAFFIIFSGAILYT-FNKT--KVYTAVAQVRLLREDPAAMG
A0A0R2XQ77      ------YFLMFRERVWYLIVAFFIIFSGSILYT-FNKT--KVYTAVATVQLLRDDPSAMA
A0A2E9IN28      ------YFLMFRERIWYLIVAFFIIFSGSILYT-FNKT--KIYTAAAQVQLFRDDASALG
A0A6N4WTJ5      ------YFLMFRERIWYLIVAFFIIFSGSILYT-FNKT--KVYTAVAMVQLLRDDPSAMA
A0A366HAG0      ------YWQIIRNRLGLILASFIFIFAVAAVLT-YIMP--RKFRGRVEMVIERK------
A0A2U8DZK4      ------FLQTLNLRKALILLILALVVITTIAVT-AFLP--KWYRSKASIRVLKI-GTTSA
A0A2T6DFL8      ------FLQILRQRQWLIALILALVVVTTIGVT-AFLP--KGYRATTKVRVERP-DGQVK
A0A1D8AWD4      ------FVGLLRLRKGLIFLVLGLVLLTTLGVT-ALLP--KWYLSTAKISVQKP-ESEVK
A0A4Q1C9S2      ------FVGLLRLRKGLVFLVLALVVLTTLGVT-ALLP--KWYLSTTKISVQKP-ESEVK
A0A178IH18      ------FFQVLRQRKFLILLVMALVVGTAAVVT-ALLP--KWYLSTINIRVEKP-EGKV-
A0A2T6DT99      ------FFQLLRLRKALIFLILSLVVVTTAVVT-ALMP--KWYVSTLNVRVEKP-EGEVK
A0A1G3ZT33      ------FFNILRLRKALIFLILALVLLTTLGVT-ALLP--RWYLSTVAMRVEKP-ESEVK
A0A3E1E2T2      ------FLRLLRLRKSLILLILSLVVITTVAVT-AFLP--RWYLATAKIRVEKP-ESEVK
B1ZMW1          ------FMQLLRQRKALIALILGLVLITTIVVT-AFLP--RWYLATTKIRVEKP-EGEVK
A0A3M1I8A3      ------YWHVLLERRWLVIMVLILSVAASVGYV-VKAP--RIFRATVRLQIDPESETGVN
A0A4V0XS84      ------YWNVLRDQRYLIVATFICVFASCVFYL-YKAP--RIYQATVSLQVDKD------
A0A351WE84      ------YWRVIKSRKEIVMAVTLLIVITGVAVT-FMQP--KKYSSTVRILVRED---SMD
A0A7W1MRT6      ------ILAVMRRRRWLVIAAAALGATVAGYFA-YVAK--PVFLASASVRIADA-RRALS
A0A7W1YXK2      ------IYFSLREKTWLIAACTIAVCLIGAIYL-WLAP--PIYASRATIMVEQQESKVVN
A0A2D5WGA5      ------YWRIIRVRFINIMLVFLLTALTTTLVT-FLLD--KTYMSQSRISIEKD-TSDIA
A0A2E7SSH2      ------YWRIIRVRIATILLVFLLTAITTTAVT-FLIP--ATYMSLSRIAVEKD-TSDIA
A0A832HNU4      ------GLQMIWERKWVLLTAVVVGMTGTWLWL-SKQT--PVYRASARILIEPDTVKILN
A0A1V5QDZ6      ------YWRVIRSRKEVILAVLLLVVVTGTSFT-LTLP--KKYMADARILVRDD-SLDVD
A0A4Y8P964      GQWLKDRLKEIYRYKAIVLISFLLILLFTIIFT-FTQQ--PVYQGVTTVKINFNKSEVLP
A0A3D4HF88      ------YIFILRERIWFFLVIFLIVFLGSVLYT-FNTT--PLFTAGATVQVLRDPVNPLG
A0A1V6J089      ------YWRVIRDRKEVILAVALLTIVSGTAYT-LMMP--KKYTALTQIQVRED-AMDVD
A0A3C1BZR1      ------YWRVIRDRKEVILAVALLTIVTGTAYT-LMMP--KKFTATTQLEVRED-AMDVD
A0A848WTQ6      ------YLQIIRNRFPVILLVFFLVFISAVTIT-HLMP--RKFLGRAAVEIVQN-DDDLR
A0A6N6ZHN8      ------YFLMLRERIWWLIISVIVVFIAMAVFT-FSSP--RQYRAMAAIELLRSPDEVLP
A0A6G6K641      ------YYQALKERLWLIILFAIAGVVYAAYQS-NKAV--PIYASRAVLQFESP-RRIMP
A0A849Y642      ------YWRVVKVHKFVILTVILLVTASATIYT-FNTP--KQYVSVARMSVESD-RPSVS
A0A7C4KLL2      ------IAGILAEKAWLIILCVVVALLVAAYHL-KNSP--RLYQAVATVQVEQEEKKAVK
A0A1H6KPB7      ------YLQILRNRWKEAVLVFVLVFVAAAVAT-YLMP--PSYTSVINFEIKKP-GAIVS
A0A2E9ISN4      ------LVQLIFRHWSWLVCSVVLCTLLGGLYA-YLAT--PIYRATARIEILNDSRVETR
B9XAX1          ------FLQTLIEKWWLIVLVTCAVTLPAFWWV-RNVP--VGYQARAVLQVEQEEQRLVG
A0A5R8KKM9      ------YWQIIRNRLGLIFLCFLLVFAAAAVIT-HVMP--RKYRAVVEIELKRQ-LKDTN
A0A7W8DJ38      ------LVDGMRRHSWIPITLSLFGLILGYA---YFKRQKPVYEAVSVAQFGSEQQSLLG
A0A7W1ZQ43      ------LFHLLLEKWLLILLVSLTAAGGVFYYA-SRTP--LKYQAKAVLQVEQEERKLIG
A0A139TS01      ------YIQVLKNRWKEVFLVFMLVLVISLVVT-LLMP--PSFRATSKFQIKRP-RPVMG
A0A3E1EJT7      ------WWVMVLERKWYALAAFVVIVAGVSAYT-FLST--PIYAGQVTVQVLKHGSQVMR
A0A848WYP9      ------LLRAVIGRIKLIAGVFGGFVALALVYV-LVAP--KWYESTAIVLVSPKKEKVLD
A0A7C3I5X9      ------FWYVLLERRWLVITTYVIVLALTGLYL-YWAP--KVYRATTRLQIDPEAEAAVN
A0A349GXM8      ------YLSVMLFRWQLIALCFLYTMLGAVAYL-YLAP--KTYESNTKIMIYRDPLLTVS
A0A7V3QFN7      ------IWRIIRIRKTVVITVFLLVVLTATAIT-YMLP--PIYAGVVKIRVDKD-IPDIQ
A0A4P5YP61      ------IYHVFLERIWAVLLVLTLTTFLGGLYV-VRSP--KIYSATLTLQVEQE-SKIVD
A0A6B2LYM4      ------YLLILRERIWWLVVSIFVVFLGFALYT-FNAP--KLYRAAASVEILRQKDQVFQ
A0A6D1VXB3      GEWLKERFNEIYRYKAVVVISFLLILLFTILFT-FTQK--PVYRGVATIKINFNKSEVLP
I0JYY7          GEWLKERFNEIYRYKAVVVISFLLILLFTILFT-FTQK--PVYRGVATIKINFNKSEVLP
A0A4Y8P842      ------LWDIYRFRRQALLF-FLVVLFIVLLFT-FTQK--PIYRGESLVKVNSTKAEVVP
B3DZK9          ------LWDIYRFRKQALLF-FLVCLFVVFLFT-FSQK--PIYRGESVVKINSTKSEVVP
A0A4R7S1J2      ------WRGLLITAREKLWLLILLPLIGAAVSYGYLKQAKPVFSSNATLEVEEK-QRVVD
A0A2A2XV69      ------YWRVIRIRLPLIVLVFLLVVITTGVVT-YFLP--KQYESSVTMQVNQN-DTYLQ
A0A651H7X9      QRSIKDYILILRERIWYIIIIFLAVFSAALIYT-LTRP--KVYEAVASVEILRTSPVVLQ
A0A5E6MPC4      WESVRSLLSDVNRYRGAALLFFAAVFLLTVVAT-FSQK--PIYEGIAVVKIGTG-AESSS
A0A840V0I7      DLLGRWYWIALGLVFGILAALYFL----------SKAP--KKYEASSRILVKQSTGAVMN
A0A146G2Q9      ------YWRVIRVRLPLIILVLLLVVITAGVVT-YFMP--KQYASTVTMQIRQN-DKVLQ
A0A2T6D3Y2      ------YWRVIRVRLPLIILVLLLVVITAGVVT-YFMP--KQYASTVTMQIRQN-DKVLQ
A0A6N6PKP9      ------LYFALREKAWLLALVTVLGIAAAAFVV-RRSQ--KIYAATTTIQIEEERQRVVR
A0A6N6Z250      ------VLRILREHWLVVFTVAALAIFAAAAWTQLFME--PWYYAESTIRVEQA-DRESD
A0A4V1SB02      ------YLYLFLRYSWLIILIVAIMMGGTWAWL-SKQS--PVYASRAVLQVDMDEGNLVN
A0A6N6QEJ2      ------YWRILRLRKAIILTVFLLVVGTVAVVT-HFLT--PLYLSTVGMKVEKD-TPDVG
A0A3C1VB86      ------VIRLLLDKSWLIVSCLVLALLAAAVYV-ERAP--RVYAATTTVQVEQADAKVVK
A0A6N6P5E3      ------YWRVVRVRLPLIILVFLLVVITAGIGT-YLTP--RQFLSSVTMQVKED-NNKMQ
A0A838I246      ------YWRVIRVRWVLILLAFFLVLLTAAVVT-YFQP--REFQSSVVIEVKST-AQNVR
A0A6J4HTK1      ------YWRVVRVRWVLILLAFLLVLITAAVVT-YFQP--REFQSSVFIEVRST-AQNVR
A0A838FVV7      ------YWRVIRVRWVLILLAFLLVVLTAAIVT-YFQP--REYQSSVFVEVRST-AQNLR
A0A7C3HWX0      ------YWRIIRIRKTVILAVFLLVVLTTVGVT-MMLK--PTYSSTARIEIGKE-TKAID
A0A7V4LSC4      ------YWRIIRIRKTVILAVFLLVVLTTAGVT-MMLK--KTYLSTARIEIGKE-TKAID
A0A2D5VY59      ------YWRIIRIRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAIEKD-SADIT
A0A2D8UZZ4      ------YWRIIRIRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAIEKD-SADIT
A0A353DV86      ------YWRIIRIRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAIEKD-SADIT
A0A2E5EPT8      ------YWRILRLRKGVIFVNFIFVVLVATFVT-YLLP--KTYKSTVRMDVKKDTASDIE
A0A5B5WZ91      ------YIQVLKNRWKEVFLVFMLVLVISLVVT-LLMP--PSFRATSKFQIKRP-RPVMG
A0A2N8HD92      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PAYQTRCQFQIKLP-KPVME
A0A2N8HIT2      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVME
A0A354EBD3      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A355VEB2      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
R6K1U5          ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A2N8IWC2      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A2N8I441      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A2N8I3A6      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A410SCC4      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A3R5VEW0      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A7T9B0I0      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
B2UKW3          ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A411SSG2      ------YLQVLKNRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQIKLP-KPVMD
A0A6M1RXR2      ------YWRIIRIRKTVILAVFFLVVLTAVIVT-YMMP--QRYASTALIKVERD-ISDIR
A0A7C3DXS4      ------YWRIIRIRKTVILAVFFLVVLTATLVT-YMLP--QRYASTARIKVERD-ITDIR
A0A7V6YXH8      ------YWRIIRIRKTVILAVFLLVVITATVVT-YILP--ESFSAKACIKVEQD-APDIP
A0A2V2SDV4      ------YWRIIRIRKAIILAVFLLVVITTVVVT-FIYP--ESFSGTARIRVERD-QSDIS
A0A6N6PHJ5      ------YWRIIRIRKTVIIAVFMLVVITATLVT-FILP--EQFASTATIKIERD-KSDID
A0A7Y4QKN3      ------YWRIIRIRKTVILAVFLLVVITSTLVT-FILP--ERFSSTARIIVNQD-SSDIP
A0A2V5PK75      ------YWRIIRIRKTVILAVFLLVVITATLVT-FILP--ESYSSKARI----D-SPDIS
A0A1V6DME1      ------YWRIIRIRKTVILAVFLLVVLTATLVT-WILP--VSYSSEARIKVDRD-VSDIP
A0A3D3DIJ3      ------YWRIIRIRKTVILAVFLLVVITATLVT-FILP--ESYSSKARIKIDRD-QTDIS
A0A7X7VJR5      ------YWRIIRIRKTVILAVFLLVVITATLVT-FILP--ESYSSKARIKIDRD-QTDIS
A0A6I1K583      ------YWRIIRMRGLLIFVVFALVVGTTAVLT-HWME--PTFMSTVRMDVQKD-VGDIS
A0A350EWA4      ------YWRIIRIRKTVILAVFLLVVLTTTLVT-FLLP--ESYSSTVTIEVKKD-SSTLD
A0A832D3W5      ------IWRIIRIRKTVVITVFLLVVLTATAIT-YMLP--PIYAGVVKIRVDKD-IPDIQ
A0A7V2G542      ------YWRVIRIRAGIIILAFLLVFITAGLVT-YFTP--RQYTSTVTMEVQPE-LSDVK
A0A7C4KPD7      ------YWRIIRVRKTVILTVFMLVVLTTTLVT-QFLP--PTYESVARIEVEKD-MPDVE
A0A832MGU4      ------YWRIIRVRKAVILTVFMLVVLTATLVT-MFLP--EVYQSTARIEVSKD-VPDVE
A0A1M6RLZ4      ------YWQIVKNRYGIILLTFILVVVTAAVIT-YVMP--KKYESVAQIEIKPL-GIKTD
A0A832M6Y9      ------YWRVVKNRWPIILTIFVLVVTTAYFYS-KSLD--KIYAASAVIEVDRE-NKQLD
A0A832HP42      ------YWRIIRIRKTIILAVFLLVLLTTTAVT-FVLP--ESYMSTAKIAIEKE-ATDIE
A0A354T7G8      ------TWQVVKNRIGLITLCFILIFAAAAILT-YIMP--RKYRGHVEMTIERI-TQDIN
A0A512MBZ2      ------SWQIIRNRFGLICLSFLLVFATAAIIT-YIMP--RKYRGRVEMKIERL-QNKVQ
A0A2E8MEZ0      ------YWQVVKNRYGVILLTFLLVFMTAAVIT-SVMP--RKYESSSVVQVHPS-VLLMT
A0A7Y2T9S5      ------YWQVLKNRYGVILLTFLLVFLTAAVIT-YVMP--KKYESMALVEVKPI-VDVDP
A0A851GRQ2      ------YWQVLKNRYGVILLTFLLVFLTAAVIT-YVMP--KKYESMALVEVKPI-VEVDP
A0A6B3LBV6      ------YWQVIRNRYEVILLSLLLVLITAGFIT-VMME--EKYESTVVVQLT-------D
A0A840UX61      ------YWQVIRNRYGIILLAFLLVFMTALVIT-YVMP--KKYESTATLQVRSS-APSLE
A0A4Q2YKS3      ------YWQVIKNRYGVILLTLLLVFMTAAVIT-YVMP--KKFESSAVIEVKPR-GQILS
A0A6N6P3T8      ------YWQVIKNRYGLILLTLLLVFMTASVIT-YVMP--KKYESYAKIEVKPR-GTLIT
A0A8A7W668      ------YWQVIKNRYGVILLTLLLVFMTASVIT-YVMP--KKYESYATIEVKPR-ERMID
A0A2E3EC33      ------YWQVIRNRYTVILLTFFLVIMTAAVIA-YLRP--PEYLGRVQIQVQRE-ARDLE
A0A2E4GN01      ------YWQVVRNRYSVXLLTFFLVXMTAMVIA-YLRP--PEYLGRVQIQVQRE-ARDLE
A0A800JJX7      ------YWQIVRNRYAVILLTFFLVFMTAMVIA-YLRP--PEYLGRVQIQVQRE-ARDLE
A0A1Z8XU55      ------YWQVARNRYSVILXTFALVFMTALVIA-YLRP--SEYLGRVXIQVQRV-ARDIE
A0A2E1RQR9      ------YWQVARNRYSVILXTFALVFMTALVIA-YLRP--SEYLGRVXIQVQRV-ARDIE
A0A2E3ISQ4      ------YWQVARNRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQVQRE-ARDIE
A0A2D6W6F4      ------YWQVARNRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQVQRE-ARDIE
A0A2D8Z5A8      ------YWQVARNRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQVQRE-ARDIE
                                                                            

A0A2A2XVF1      I-----------DGVSQENPSSPDFINTVVQSITSRNLMLRV-----IDA--------NK
A0A2V5UHJ2      L-------QDARADSVDYNDYNNEFYKTQYEILKSRALAERV-----VRD--------EG
A0A2V5PST3      V-----TGVGESGARTAEGGGPYDYYQTQYKLLASSALAARV-----IAD--------LR
A0A2V5PXM3      I-----------QRVQQEDPQSLEFLKTVEQTFESRSLFERV-----LDT--------NN
A0A1V5QB01      L-------------RQVESQPMGDYLATQQLIIQSGQLISRA-----RAR--------LN
A0A800JGC6      E------QKQGSNFRTEAYLGGDAIINTVTQKLLIPEILIAM-----VED--------TK
A0A7Y2T8X5      A------------ELESDRLAMDSLMVTIANKLVGPSQLTKVVNSAKIQAIEKAVPPTFS
A0A1J4XH17      V-----------RSVESNEVRTSEDLNTQIKVLESSTLAKAV-----ADR--------LQ
A0A7C5LI63      A--------------EVVVEQARTFFATQLNIMQSQTMLRRV-----QQR--------MK
A0A7C5P291      A--------------ELSREDERSFYSTQVEIMSSPTMLRRV-----QQR--------LK
A0A290QGD9      V-----------QSVTDNDVRSLEDLNTIVQILESGTIIQKV-----SDRLTGEKLAQFM
A0A1D8AS58      V-----------QSVVNNEIRSAEDLNTQVKVLESLAIVQRV-----ADRLTGADLELFM
I6AQC1          T-----------PELLPTNVISTEDMNTMVKIFESPTIIQKV-----SERITGDELRRFM
W0ITH7          T-----------QNPIDNNVLSTEDMNTMVKIFESPTIIQKV-----SERITGDELRRFM
A0A139SU05      Q------------TVMDATIRNELDLNTYIHQLTSNRVRTRV-----LES--------LT
A0A139SPN4      Q------------GVVDASIRNEIDLNTYIHQLTSNRVRTRV-----LES--------LT
A0A1V6E7N1      E------------GVTRPEVQSEFDINTYLEILKSDKLRQRV-----VNS--------LS
A0A2D9MYT1      M-----------ESFVMEGAREQDYLQTQYKNLQSRSLMEMA-----LEETLQNAMILDG
A0A258ANJ7      L-----------NSMSTPGLGDEKSVNTLIQAAKSREVIGRV-----ISE--------LN
A0A1Z8ZMT6      N-SSDSDDIDLQSLEAAEDIRSDFDRTELFLAVASDPTVRNL-----ANLIPPEAPSIME
A0A2E8MCT7      N-SSESEDIDLQGLEAVEDIRSDFDRTELFLAVASDPTVRNL-----ANLIPPDPPSIMG
A0A139TLN4      A-------TTVLATSNGIVNTASTNLDNEIFLLSSYSLMEEV-----VRK--------LK
A0A1G3ZFT0      T-------IGLPGMGGGSGPSLGSPAAIQIALIKSRYILTPV-----IQS--------LH
A0A5B5WI95      S--------SDRIMSELGIDSGAANLANESFILKSTAVMKKV-----VED--------LK
A0A2N8I9W1      S--------SERIMAELGIDSGAANLANESFILKSTALMKKV-----VED--------LN
A0A4Q5IH27      S--------SERIMAELGIDSGAANLANESFILKSTALMKKV-----VED--------LN
A0A2N8IBZ6      S--------SERIMAELGIDSGAANLANESFILKSTALMKKV-----VED--------LN
A0A7G6DX28      S--------SERIMAELGIDSGAANLANESFILKSTALMKKV-----VED--------LN
R6J100          S--------SERIMAELGIDSGAANLANESFILKSTALMKKV-----VED--------LN
A0A139TV24      S--------TDRIMVELGVDSGAANLANESFILRSSTVMRHT-----VED--------LK
A0A2N8HT11      S--------SDRIKVELGMDSGAANLANESFILRSSTVMRNT-----VED--------LT
R7DS70          S--------SDRIKVELGMDSGAANLANESFILRSSTVMRNT-----VED--------LT
A0A2N8HNL6      S--------SDRIKVELGMDSGAANLANESFILRSSTVMRNT-----VED--------LT
A0A290Q2Z2      F------------QAQSSGYYDPYFLQDQFKIMQSAKVLYPV-----IEN--------LG
A0A2A2RGK2      P---------RFSQVRDEQIRSIDMINTVVDLIRSYPFSQRV-----SAR--------LK
A0A2A2XXF7      A---------KMEQVRDEQIRSIDMINTVVDLLRSYSFAQRV-----SAR--------LK
A0A146GCJ0      I-----------ADVSQENPQSTDFLKTVVEALKSRKLLARV-----VKA--------EG
A0A2T6D6H8      I-----------DDIARENPQTTDFVNTVVQALTSRKLMLRV-----VKA--------TG
A0A6B3L938      Q----------GDAERDSMIFRDEIIGTIASKITGQGQFVKVIQRPEVQALEKVIPPPLS
A0A2A2R5D6      M-----------GNSRTDAPFDLVFFTSEISTIQSKKILNPV-----IEK--------LG
A0A2V5URB2      I---------QQVLSESIEADERSYYESQYEMLKSRSLAAEV-----IKG--------QG
A0A2V2DJ66      G-------PGSSDRTRNDKVLSVEDFNTQVKILESNEVIRAV-----RSR--------LK
R7L5A9          G-------PGSTERSRNNVIMSMEDFNTQVKLFESAEIVKAV-----KSR--------MK
A0A5B5WU87      A-------ATVLATSNGIVNTVATNLDNEMFLLSSHSLLETV-----VRK--------LK
R7DZW0          A-------ATVLASTNGIVNTGATNLDNEIFLLSSHSLLKTV-----VRN--------LK
A0A2N8HID1      A-------ATVLASTNGIVNTGATNLDNEIFLLSSHSLLKTV-----VRN--------LK
A0A2N8HS06      A-------ATVLASTNGIVNTGATNLDNEIFLLSSHSLLKTV-----VRN--------LK
A0A6N2TNT9      A-------ATVLASTNGIVNTGATNLDNEIFLLSSHSLLKTV-----VRN--------LK
A0A4P5QM05      E----------VGTQTSSGRIDPQFVATQIQVLKKAEILNPV-----IEK--------LN
A0A4Q3C001      I----------FESSA-QRSYDPAFVATEFHTLRKSDILYPV-----IDQ--------LE
B4DB23          T----------FGPGQFRQTYDPQFVATQFQILQKTEILYPV-----IER--------LD
A0A5R8KA81      S----------VQEVNPQDLRMNDLLATIMENLKNRDLLLRV-----VRR--------AE
A0A2E6T482      L---------LGMQAGPT-AFDPYFIQTEFEKIQSQKVLDKV-----VEK--------CD
A0A3C0DQZ7      L---------LGMQAGPT-AFDPYFIQTEFEKIQSQKVLDKV-----VEK--------CD
A0A1Z9CBK5      L---------MGVQATQS-SFDPXFISTEFEKIQSQVVLDAV-----VES--------CE
A0A2D6ZI96      L---------MGVQATQS-SFDPXFISTEFEKIQSQVVLDAV-----VES--------CE
A0A358KGZ3      L---------LGMQATQS-SFDPYFISTEFEKIQSQKVLDEV-----VKS--------CE
A0A2E9ZQX4      L---------LGMQATQS-SFDPYFISTEFEKIQSQKVLDEV-----VRS--------CE
A0A3D5JZU0      L---------LGMQATQS-SFDPYFISTEFEKIQSQKVLDEV-----VKS--------CE
A0A2E6HCR0      L---------MGVQTAQS-SFDPYFISTEFEKIQSQIVLDAV-----VRS--------CE
A0A1Z8WN04      L---------MGAQSSQS-SFDPYFISTEFEKIQSQIVLDAV-----VET--------CE
A0A2D7L1N4      L---------MGAQSSQS-SFDPYFISTEFEKIQSQIVLDAV-----VET--------CE
A0A2E2R937      L---------MGAQSSQS-SFDPYFISTEFEKIQSQIVLDAV-----VET--------CE
A0A520QQY4      L---------MGAQSSQS-SFDPYFISTEFEKIQSQIVLDAV-----VET--------CE
A0A2D5MR66      L---------MGVQASQS-SFDPYFISTEFEKIQSQIVLDAV-----VAT--------CE
A0A2E0PDQ1      L---------MGVQAAQS-SFDPYFISTEFEKIQSQIVLDAV-----VSS--------CE
A0A2E2ZZP9      L---------MGVQAAQS-SFDPYFISTEFEKIQSQIVLDAV-----VSS--------CE
A0A4P5YMI6      S---------GMSESKA---YDPFFVLTQFEKLQSTAVIYPV-----ITD--------LG
A0A7C4LRK7      W---------YQGRQTPS-FHDPYWLTTQFEIIQSGAILHRV-----IKK--------LR
A0A3C1VJ32      M---------GNSPAATSFGYDPYFIQTTFEIMQSQLVLSNV-----IAT--------MN
A0A7W1VTI1      P---------LAHAANVS-GYDPFWIQTQVKKIESASILHDV-----IRR--------YD
A0A7V4IGZ6      F---------TQQ-TMSG-MYDPYFIQTEFESIRSEVVLTRV-----VDA--------LN
A0A2N9NTX7      L---------TQQQGSFS-PYDPYFMQTEFELMKSEVVLDKV-----IKN--------LN
B9XK55          I---------TQTPNYSG-HYDPYFIQTEFEVIQSEVILDRV-----IEG--------LN
A0A2A2RGF2      L---------MPQQQQGG--FDPYFVMTQFEILQSKEVLYKV-----IDD--------LK
A0A2G4I5Y6      L---------MPQQQQGG--FDPYFVMTQFEILQSKEVLYKV-----IDE--------LK
A0A6N6PS97      L---------LQGQQQSS--YDPYFIRTEFEKIRGQRVLYPV-----IEE--------LS
A0A3M1I883      I---------GGQQRDPS--FDPYFMATEFEKIQSMSVLMPV-----IHS------PTNA
A0A1V6JZ45      F---------LRPQVQNQ--FDPYFIQTEFEKIQSKPILYKV-----IES--------LD
A0A848A4B3      F---------LRPQVQNQ--FDPYFIQTEFEKIQSKPILYKV-----IES--------LD
A0A7C7Z746      M---------VAQQRSDN--HDPYWIQTQFERIKSRQVLHRV-----VSN------QVVN
A0A520RRW5      L---------MGLQAAQQ--HDPYWVLTEYEKIQSKKVIHPV-----INA--------LG
A0A356NPK0      L---------MGLQAAQQ--HDPYWVLTEYEKIQSKKVIHPV-----INA--------LG
A0A2D7B5P5      L---------MGLQAAQQ--HDPYWVLTEYEKIQSKKVIHPV-----INX--------LG
A0A3D3XGB5      L---------MGLQAAQQ--HDPYWVLTEYEKIQSKKVIHPV-----INA--------LG
A0A2V6F8A1      L---------GITQNSTQ--YDPFFLQTEFEKIRSQKVLYKV-----IDN--------LK
A0A2V5TNH4      I---------GFAQNNSA--YDPFFIQTEFEKIRSRKVLYKV-----IEN--------LK
A0A2V5X5Q6      I---------GFTQNNSA--YDPFFIRTEFEKIRSRKVLYKV-----IEN--------LR
A0A3R5R2M8      --KSGTDASSERIMSELGIDSGAANLANESFVLKSTAIMQKV-----VED--------LK
A0A411SUQ6      --KTGSDASSERIMAELNIDPNAANLANESLVLKSTALMNKV-----VED--------LN
A0A2N8HZF2      --KTSSDASSERIMAELGIDSGAANLANESFILKSTALMKKV-----VED--------LN
A0A354E720      --KTGSDASSERIMAELNIDPNAANLANESLVLKSTALMNKV-----VED--------LN
A0A7T8XNA1      --KTGSDASSERIMAELNIDPNAANLANESLVLKSTALMNKV-----VED--------LN
B2UPB6          --KTGSDASSERIMAELNIDPNAANLANESLVLKSTALMNKV-----VED--------LS
A0A1Q6UHJ9      G-------PGSTDRSRNNTVLTIEDFNTQVKILESNEIIKAV-----KSR--------MK
A0A2V2BXR0      G-------PGSTDRSRNNTVLTIEDFNTQVKILESNEIIKAV-----KSR--------MK
A0A3C1HEJ2      G----------LQEGVRDDGERPEDLKTIIETLKSRAVIERV-----IET--------NH
A0A522ULD9      F-----------GPGGAAFSYNPYFLRTQFEIIQSRQILYKV-----VDN--------LN
A0A7W1RNH4      P----------------TSGPEHDQVSTEMEVLTSRTMAEQV-----IEN--------LG
A0A2D8V0G3      V-----------GSQVVFNSNDQEYLQTQYKNLLSRSLIESV-----ITD--------LE
A0A348S017      G-----------ATPIVFNSNDQEYLQTQYKNLLSRSLIESV-----VRD--------LG
A0A3C1UUV7      G-----------ATPIVFNSNDQEYLQTQYKNLLSRSLIESV-----VRD--------LG
A0A350I3V2      G-----------ATPIVFNSNDQEYLQTQYKNLLSRSLIESV-----VRD--------LG
A0A520RGV5      G-----------ATPIVFNSNDQEYLQTQYKNLLSRSLIESV-----VRD--------LG
A0A3D3XF90      G-----------ATPIVFNSNDQEYLQTQYKNLLSRSLIESV-----VRD--------LG
A0A2D7B522      G-----------ATPIVFNSNDQEYLQTQYKNLLSRSLIESV-----VRD--------LG
A0A356NIC2      G-----------ATPIVFNSNDQEYLQTQYKNLLSRSLIESV-----VRD--------LG
A0A832MDW4      Q-----------DLV-VSGGADTDYLQTQYKNLMSRSLIEAV-----IKK--------QK
A0A1V6JU76      L-----------NEV-VMSMTDQDYLQTQYRNLLSRSLLEIV-----IKR--------EK
A0A848ABG7      L-----------NEV-VMSMTDQDYLQTQYRNLLSRSLLEIV-----IKR--------EK
A0A2A2XXW5      L-----------NSM-ALGNSDQNYLTTQYRNLESRSLILAV-----MNK--------LK
A0A6N6Q6V0      L-----------RDMVTIGSKDQEYLQTQYRNLQSRSLIDKV-----IQK--------LR
A0A2V6JLK8      F----------GQGDPNQPIHDPQLAPTVYQVIQRTGILYPV-----IEQ--------LK
A0A2W5Z1A5      F----------SQIDPSQPVHDPTLAPTVFQVIQRTGILYPV-----IDE--------LK
A0A2V6EA09      F----------GN-DLHQPVHDPELAPTVFQVIQRTGILYPV-----IDD--------LK
A0A2V6GQI7      F----------GN-DLHQPVHDPELAPTVFQVIQRTGILYPV-----IDD--------LK
A0A7W1U7K0      F----------GN-DLNLPYHDPQLAPTVFQVIQRTGILYPV-----IDD--------LK
A0A7W0YDK6      F----------GN-DGILPYHDPQLAPTVYQIIQRTGILYPV-----IEE--------LK
A0A7V9EPY1      F----------GN-EGIVNYHDPQLAPTVYQVLQRTGILYPV-----IDE--------LK
A0A838TCM2      F----------GT-DGLQPYHDPQLAPIVYQVLQRTGILYPV-----IDE--------LK
A0A2N8HDG3      D----------RIKVDLGMDSGAANLANESFILRSSTVMRST-----VED--------LA
A0A3E1ET42      F---------QTNEISNRSAYSGNWLETEFKTVTAHETLSLV-----IKK--------LN
A0A2A2YDW8      F----------GDDNNSQIQMTPQFFATQFEIIRSQMTLRRV-----VDK--------LR
A0A352XLN9      F----------GDDNNSQIQMTPQFFATQFEIIRSQMTLRRV-----VDK--------LR
A0A3D0YP62      V----GMRGGGIGTPMT-----RQFMNTQFEIIVAPETLGRA-----IDK--------IQ
A0A3D3DV47      V----GMRGGGIGTPMT-----RQFMNTQFEIIVAPETLGRA-----IDK--------IQ
A0A7Y1UNY2      F-------GGSMGQAVTGAYMTRQFFATEFKVIVAEQTLKRV-----VDR--------LD
A0A2E5XJ49      L-------NGVAGAPMTGASPSHAYIYNQFKIIESEKTLARV-----VER--------LD
A0A2E6SBY8      L-------NGAAGPPMTGASPSHSYIQNQFKIIESEKTLARV-----VER--------LD
A0A2E5QMS4      L-------NGAAGHPMTGASPSHAYIQNQFKIIESEKTMLRV-----VER--------LD
A0A2E7YXQ3      L-------NGAAGHPMTGASPSHAYIQNQFKIIESEKTMLRV-----VER--------LD
A0A2E3H787      L-------NGAAGRPMTGASPSQAYIQNQFKVIESEKTLLRV-----VER--------LD
A0A2E7AGN1      L-------NGSVGQPMTGASPSHAYIQNQFKIIESEKTLSRV-----VET--------LD
A0A2E7AKY7      L-------NGSVGQPMTGASPSHAYIQNQFKIIESEKTLSRV-----VET--------LD
A0A3D4CU34      L-------NGSVGQPMTGASPSHAYIQNQFKIIESEKTLSRV-----VET--------LD
A0A2E8M146      L-------NGSVGQPMTGASPSHAYIQNQFKIIESETVLNRV-----VES--------LD
A0A355S8S2      L-------NGSVGQPMTGASPSHAYIQNQFKIIESETVLNRV-----VES--------LD
A0A2D6DVN8      L-------NGSVGQPMTGASPSHAYIQNQFKIIESEKTLLRV-----VEQ--------LD
A0A3C1W2R2      L-------NGSVGQPMTGASPSHAYIQNQFKIIESEKTLLRV-----VEQ--------LD
A0A2E3NAY6      L-------NGSVGQPMTGASPSHAYIQNQFKIIESERTMSRV-----VER--------LD
A0A2E3II01      L-------NGSVGQPMTGASPSHAYIQNQFKIIESERTMSRV-----VER--------LD
A0A368B8C5      L-------NGSVGQPMTGASPSHAYIQNQFKIIESERTMGRV-----VER--------LD
A0A3R7RBB5      L-------NGSVGQPMTGASPSHAYIQNQFKIXESERTMGRV-----VER--------LD
A0A2A2QX62      M-------PGTEPRG--QYEMTSTFFPTEFEVIKAQKTLDSA-----IEN--------LD
A0A4Q3BWH6      I-------PGVTDNR--SMENGATFLPTEFAVIKAQKTLDAA-----IEN--------LD
A0A858RHU7      I-------PGTGDNNRAAMEMGQTFFPTEFEVIRAQKTLDKA-----IED--------LD
A0A7V7VLV5      F--------KGMEDTSGFGRSTGNFFNTEFEKIKSRNSLMKV-----IDN--------LD
A0A3N5WCF1      L-------GAAMTETSGGGRMSPQFFGTEFEKIKSRNSLAKV-----VDN--------LQ
A0A4Q3C1K5      L-------GPGFSDNQ--NLMTPQFFGTEFEKIKSYNSLSKV-----VAK--------LE
A0A3D1TI55      L-----------VDRGRQSQYDPYFYLTQFELIRSRPVLTGV-----IRD--------MN
A0A3R8IT45      Q----------SREMLDSTMFSTEDINTMVKVFESSIIIQKV-----SER--------IT
A0A2A2PYE8      Q----------VQQVVDTDIRSAEDLNTQIKVIESVTMIQRV-----AER--------IT
A0A2T6CN73      P----------GQQVVDTDIRSTEDLNTQVKVIESEAIIESV-----ASR--------IT
A0A2G4G428      SNTAAESNFSIT---------SADDFYTAVESMRSSTIIEAV-----SRQ--------LT
A0A6N6PCD8      I-----------PGVAQDNFKSDIALKSVEGAMNSNSLLLRV-----AKL--------ND
A0A139TUL1      V--------SEIILSDLGVRAGEANLANESYVVQSSEVMGRV-----VKG--------LE
A0A2N8HCB0      V--------SEIILSDLGFKPGEANLANESYVVKSSEVMGRV-----VKG--------LG
A0A2N8HP04      V--------SEIILSDLGFKPGEANLANESYVVKSSEVMGRV-----VKG--------LG
A0A2N8HRJ0      V--------SEIILSDLGFKPGEANLANESYVVKSSEVMSRV-----VKG--------LG
A0A6N2U9Y7      V--------SEIILSDLGFKPGEANLANESYVVKSSEVMSRV-----VKG--------LG
A0A6N6PAZ1      A----------RDQIEEIDMRSAEAMNTVAERIRRMDLLERVASRHDVRELPGLMPIETD
A0A7V7VK26      A----------RDQVEEIDMRSAEAINTVAERIHRMDLLERVASRQDVRELPGLMPIEVD
A0A6I1K459      IEDVDKREKGGV-----------DLLNTIANNIRSSGIIKRV-----VTA--------HN
D5ENH7          ----------DQVDLAQDSIRTAEDLNTQISLLNSSKIIQQV-----ERR--------MS
A0A0R2XQ77      -----------SAEMEMNQIRSSEDLNTQISVLNSGAIVQGV-----ERR--------LQ
A0A2E9IN28      ----------KGAEMEQNQIRGAEDLNTQISVMESATIIKGV-----EQR--------LQ
A0A6N4WTJ5      V--------MGAGELEPNQIRSAEDLNTQISVLNSGKIIQGV-----ERR--------LQ
A0A366HAG0      --LDDARVVGNANLQDDNLASTDSFLKTQFEIITKRRTLDRV-----VDK--------LD
A0A2U8DZK4      V-----------FQAQSNDYYDPYFVQDQLRTIKSPKIINPV-----IER--------LK
A0A2T6DFL8      L-----------FQAQTSPSYDPVFLQDQFKIMQSEKILYPV-----IER--------LD
A0A1D8AWD4      L-----------FQAQSNTYYDPYFIQDQFRIIQAEKILYPV-----IES--------LG
A0A4Q1C9S2      L-----------FQAQNNSYYDPYFIQDQFKIIQSEKIIYPV-----IDA--------LG
A0A178IH18      V-----------FENQANNYYDPYFLQDQFKVIQSPKILNPV-----IEN--------LG
A0A2T6DT99      L-----------FQNQQSAYYDPYFLQDQFKIMQSAKILYPV-----IER--------LQ
A0A1G3ZT33      L-----------FQAQSSSYYDPYFLQDQFKTIQSDIILKPV-----IEI--------LN
A0A3E1E2T2      L-----------FQAQSSSSYDPYFLQDQFKILQSEKILYPV-----IKN--------LK
B1ZMW1          L-----------FQAQSSSYYDPYFLQDQFKIMQSEKILYPV-----IEN--------LG
A0A3M1I8A3      L----------RDGFGGVSRMDPEYLQTQYKNLLSRSLLERV-----VKA--------ER
A0A4V0XS84      ----SDNALSGIKGVVVQNRQDPDYLQTVAKNLKSRTLMKAL-----IAD--------LK
A0A351WE84      VDVFERQMIQGY---------NPFFLRTQERILKSTPLLYAV-----IDN--------LN
A0A7W1MRT6      G------GIGDAPRDVLGSGNGVDPVLSQVQVLKSREVAANA-----VRR------QPLG
A0A7W1YXK2      IQDVSQDDLKAL-----------EVMKTVEQSLTTDALTLRV-----AKI--------NQ
A0A2D5WGA5      PLLGMQTGPTAF---------DPYFIQTEFEKIQSQKVLDKV-----VEK--------CE
A0A2E7SSH2      PLMGMQATQSSF---------DPYFISTEFEKIQSQVVLDEV-----VKK--------CD
A0A832HNU4      I--------QEFVNSDIRDWDIVGTINTQVRILQSRPLAEQV-----VKA--------LQ
A0A1V5QDZ6      V-----------FERQIPQAYNPFFLRTQYEVIQSRKVLYQV-----VEN--------LD
A0A4Y8P964      YKSVGEDQAGLF--------DYENYFKTQVEILKSRSLAQRV-----VER--------LD
A0A3D4HF88      A---------GAEDITKEEIRTSEDLNTQIKILESLAIVNSV-----ADR--------IK
A0A1V6J089      PFYQRDINRMGY---------NPFFLMTQEKILKSKPVLTTV-----IRN--------LN
A0A3C1BZR1      PFYERQASRMGY---------NPFFLMTQEKIMKSRPVLTAV-----IRN--------LN
A0A848WTQ6      L----------FRNSTNPDFMVLNFVQTQFETIKTNETLYRV-----VDK--------FD
A0A6N6ZHN8      F-----------KDVVDLDMRSSEDYNTQVKVLQSSEIINRV-----ADR--------IK
A0A6G6K641      LDTVQQDDLSNE-----------QSLNTLIETLNSRTMLQRV-----AIR--------LK
A0A849Y642      VYGRDLSGMDMI------------TFGTQFEIIQSKEVLYPV-----VDQ--------LK
A0A7C4KLL2      V-----------DPIVREDLRSSETLNTIVQKFKSRALLERV-----VET--------NR
A0A1H6KPB7      LSRGAERVLQNN--------ASENYIPTQFEILVSDMNLMAV-----SKK--------LN
A0A2E9ISN4      A--------------TTQYDRQERSLSRQMLLLNSNRLHQQV-------R--------AN
B9XAX1          IEEVSRQDLRTG-----------EMLNTIVQNVKNTKVLGRV-----VRN--------IG
A0A5R8KKM9      VFGQLNQNNNLA---------GDGFLKTQLEIIQKPKTLERV-----VEK--------LK
A0A7W8DJ38      M----------NGVNSPTSLADEKSVNTLIQAAKSREVMGRV-----VSE--------LN
A0A7W1ZQ43      T-----------DSVSRHDLRSPEAINTIVQNVKNSSVLRRV-----IET--------NE
A0A139TS01      I-GTGEDVVASS-------NITDNYIPMQYSVLTSSEVLKVV-----SKK--------LN
A0A3E1EJT7      V-----------ADVVDSNITSEPDFNTQIKVLESLTILQNV-----ANR--------LT
A0A848WYP9      INSVNQPDFESL-----------DALKSLSKTITNGTSIVKV-----IDR--------LN
A0A7C3I5X9      LGGVTVQSIQAN----------QDYLQTQYRNLLSRSLLNVV-----IRK--------ER
A0A349GXM8      N-----------------EGAQWTSLHTHTYMLNNEKLHERV-----MNK----------
A0A7V3QFN7      P-IADQTTIPLG-------TFDPYFIQTEYEVIQSQVVLERV-----IKD--------LK
A0A4P5YP61      L-----------TKFKPDEQTTTEILKTFEQTIVSRPVLERVAATNQLTK----NGEFLT
A0A6B2LYM4      I-----------QDIVRQEVANAEDFNTQIKILESLNIVQAV-----DERLKGNLRNRFL
A0A6D1VXB3      YKTVGEDQAGLF--------DFENFFKTQVEILKSRSLAQRV-----VER--------LD
I0JYY7          YKTVGEDQAGLF--------DFENFFKTQVEILKSRSLAQRV-----VER--------LD
A0A4Y8P842      YKQVSNDEPGLF--------DWETFFKTQCEIIKSRSLAQRV-----VER--------LD
B3DZK9          YKQVSNDEPGLF--------DWETFFKTQCEIIKSRSLAQRV-----VER--------LE
A0A4R7S1J2      V-----------KEVTDKDWANTEAMNTLAATMRSSTFLERL-----IDR--------EK
A0A2A2XV69      V-FDDRGGGRGF---------DPRFITTQFEIIQRKEILYPV-----IEA--------LG
A0A651H7X9      VQDVLDPTIRTT-----------EDFNTQVRRMESISLIQRV-----ASRLTGEEMRRFM
A0A5E6MPC4      IVPYRQIGQDQIGQESANAFEYDTFFRTEIEILKSRAMAERVVDRLNLEEHPDW----VG
A0A840V0I7      S-KDQVEEIDLR---------TDEALNTVAQRIKRPELLKRIAADDSIRQLPGLIPPPVH
A0A146G2Q9      V-----------FGQGGVQGLDPRFLATQFEIIQRKEILYPV-----IDA--------LG
A0A2T6D3Y2      V-----------FGQGGVQGLDPRFLATQFEIIQRKEILYPV-----IDA--------LG
A0A6N6PKP9      ADPRGMDELSTE-----------KELKTIVENLESPALMLRL-----ARH--------PE
A0A6N6Z250      V-----------LRPMGMQTIDRTFINNQFETIQSRTVLLPV-----IER--------LQ
A0A4V1SB02      IEGLDSTPIKGT-----------DQLNTVVQSLTSNKVLLAV-----ANH--------TN
A0A6N6QEJ2      P-FLQGPSQTGF---------DPYFFNTEFEVLKSRRILDKV-----SER--------LH
A0A3C1VB86      V-----------EQVVSEDMRSQETLNTVAQKLSNLALLTQV-----LEE--------NH
A0A6N6P5E3      I-----------FGMDSGQHYDPRFSTTQFQIIQRKEILYPV-----IDA--------LK
A0A838I246      IFGNMDPNMPVH---------DPQLAPTVFQIIQRTGILYPV-----IED--------LN
A0A6J4HTK1      LFGGGDPNAPVH---------DPQLAPTVYQIIQRTGILYPV-----IED--------LK
A0A838FVV7      IFGPGDPNQPIY---------EPQLAPTVFQIIQRTGILYPV-----IDD--------LK
A0A7C3HWX0      P-LGRTQVQQPY---------DPYFITTEFEKIQSSAVLYPV-----IER--------LR
A0A7V4LSC4      P-LGRTQVQQPY---------DPYFITTEFEKIQSSAVLYPV-----IEK--------LD
A0A2D5VY59      P-LIGMQMSQQH---------DPYWVLTEFEKIQSKVVLHPV-----IDA--------LE
A0A2D8UZZ4      P-LIGMQMSQQH---------DPYWVLTEFEKIQSKVVLHPV-----IDA--------LE
A0A353DV86      P-LIGMQMSQQH---------DPYWVLTEFEKIQSKVVLHPV-----IDA--------LE
A0A2E5EPT8      L-LGGTPQGPDF---------DPFFILTQFERLQSAEVLYPV-----IEK--------MN
A0A5B5WZ91      I-GTGEDVVASS-------NMTDNYIPMQYSVLTSSEVLKVV-----SKK--------LN
A0A2N8HD92      I-GQGGDVVATS-------NVTANYIPMQYSVLTSTEVLKIV-----SKK--------LN
A0A2N8HIT2      I-GQGGDVVASS-------NVTANYIPMQYSVLTSTEVLKVV-----SRK--------LN
A0A354EBD3      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A355VEB2      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
R6K1U5          I-GRGGDVIATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A2N8IWC2      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A2N8I441      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A2N8I3A6      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A410SCC4      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A3R5VEW0      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A7T9B0I0      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
B2UKW3          I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A411SSG2      I-GRGGDVVATS-------NVTANYIPMQYSVLTSAEVLKVV-----SRK--------LN
A0A6M1RXR2      G-FVDPLYNPGY---------DPYFIETEFQVINSEVVLTNV-----VNE--------LD
A0A7C3DXS4      G-LTDPLYSPGY---------DPYFIETEFEVINSELILTNV-----IHD--------LN
A0A7V6YXH8      F-VDYQGFRRPF---------DPHFILTEFEVLQSEVILGEV-----VEK--------LN
A0A2V2SDV4      GVLQGQAFPSSY---------DPYYINTEFELIQSEVILQPV-----ITK--------LD
A0A6N6PHJ5      E-MAGNSRISSF---------DPYFIQTEFEVIQSETILSNV-----VDV--------LG
A0A7Y4QKN3      G-MTEMARPRYY---------DPYFIQTEFEVISSELVLSNV-----ISA--------NN
A0A2V5PK75      G-IAKRMPTAGY---------DPYFIQTEFETIQSERVLGKV-----IDK--------LE
A0A1V6DME1      G-MTQTPLLPGY---------DPYFIQTEFEVIQSERILSNV-----VHQ--------LN
A0A3D3DIJ3      G-LADRSTLAGY---------DPFFIQTEFELIQSELILGKV-----VAD--------LD
A0A7X7VJR5      G-LADRSTLAGY---------DPFFIQTEFELIQSELILGKV-----IAD--------LD
A0A6I1K583      S-LMPQQQQGGF---------DPYFVMTQFEILQSKEVLYKV-----IDD--------LK
A0A350EWA4      R-IGGPTAVQGF---------DPYFLQTEFEKIQSKTVLYQV-----ITN--------LN
A0A832D3W5      P-IADQTTIPLG-------TFDPYFIQTEYEVIQSQVVLERV-----IKD--------LK
A0A7V2G542      I-FDRQ---------MEGSFGDPRFAMTQFQIMQRSEILYPV-----IEE--------LK
A0A7C4KPD7      G-FRERPVLSNF---------DPYWMQTQFEIIKSSTVLDAV-----INK--------LK
A0A832MGU4      P-LMGHSYVQNF---------DPYWMETQFQLIKSSAVLNRV-----ITK--------LG
A0A1M6RLZ4      T-VLGQD--------TSGRLMTRQFFATQFQLIESEENLKRA-----AIR--------CQ
A0A832M6Y9      V-FR-----------QSMEQFEPVFFQTEFERIQSKMVLNRV-----ITS----MGLRQK
A0A832HP42      P-LGRS---------QSSLQYDPYFVNTEFEKIQSKSVLYPV-----ITN--------LN
A0A354T7G8      V-FDRNR--------GDSLAFTQEYIKTQFETITKPSTLYPV-----IQS--------LD
A0A512MBZ2      V-FNRDTSDMLA---GSD-----VFVKTEFESINKPETLYPV-----IEK--------LD
A0A2E8MEZ0      P-FLGGSQM------TPGSTMTARYMENEFETITAPETLAEA-----AEN--------ID
A0A7Y2T9S5      T-LSRAGG-------GMGPQMTRQFMNTQFEIIIASETLGLA-----INR--------IQ
A0A851GRQ2      T-MTRAAG-------GTAVPMTRQFMNTQFEIIVAEETLELA-----IDK--------VQ
A0A6B3LBV6      I-SQMGGDLTNTLTEGQKMFASRNFIANQFERMTSQQVLQRV-----VRD--------ED
A0A840UX61      V-L--PGIVSRT---ASAVTQ--SFLQTEFEVITAQKTLDIV-----IDE--------LD
A0A4Q2YKS3      P-FGERGSEASG---MDRMTP--RFFETEFEKIKSSKSLEKV-----VNN--------LD
A0A6N6P3T8      V-FKGMEDTSGF---GRSTV---NFFNTEFEKIKSRNSLMKV-----IDN--------LD
A0A8A7W668      P-L--GGALRTS---GPTMTP--QFFGTEFEKIKSRNALTRV-----IDK--------LD
A0A2E3EC33      V-FRETGSVGNL---GTESLPYMTFMQTQFEIIQSRETLKEV-----INNGKDSLGQPLD
A0A2E4GN01      V-FRETGTVGNL---GSESLPYMTXMQTQFEIIQSRETFKEV-----INNGKDSLGRPLX
A0A800JJX7      V-FRETGTVGNL---GSDSLPYMTFMMTQFEIIQSRETLKEV-----LHNGKNSLGQPLD
A0A1Z8XU55      V-FRETGSVGNL---GSEQLPYMTFMQTQFEIIQSRETLKQV-----ISKGKDSAGNPLD
A0A2E1RQR9      V-FRETGSVGNL---GSEQLPYMTFMQTQFEIIQSRETLKQV-----ISKGKDSAGNPLD
A0A2E3ISQ4      V-FRETGSVGNL---GSEQLPYMTFMQTQFEIIQSRETLKEV-----IKNGENSAGNLLD
A0A2D6W6F4      V-FRETGSVGNL---GSDQLPYMTFMQTQFEIIQSRETLKEV-----IKNGVDSAGNLLD
A0A2D8Z5A8      V-FRETGSVGNL---GSDQLPYMTFMQTQFEIIQSRETLKEV-----IKNGVDSAGNLLD
                                                                            

A0A2A2XVF1      LR------------------------TN--------------------------------
A0A2V5UHJ2      LE--------------SHPLFGGGKTNDAAKEGLVAGFWKELK-----------------
A0A2V5PST3      LDSNKIFTGASITSDNPIKRVRSWILGTLNSLISPVAKFFRES-----------------
A0A2V5PXM3      LA------------------------TD--------------------------------
A0A1V5QB01      KP----------------------------------------------------------
A0A800JGC6      LH------------------------ER--------------------------------
A0A7Y2T8X5      LK---------------------------------PKYWRNEK-----------------
A0A1J4XH17      KE------------------------NLTDVFLAPYSVSNKSK-----------------
A0A7C5LI63      KT------------------------PD--------------------------------
A0A7C5P291      KT------------------------DD--------------------------------
A0A290QGD9      AP------------------------------------YLKGG-----------------
A0A1D8AS58      AP------------------------------------FKSPG-----------------
I6AQC1          QP------------------------------------YEKGR-----------------
W0ITH7          QP------------------------------------YEKGR-----------------
A0A139SU05      PE----------------------------------------------------------
A0A139SPN4      PE----------------------------------------------------------
A0A1V6E7N1      PQ----------------------------------------------------------
A0A2D9MYT1      LKAGRRNPKQLIGETGLSETNVIERLHQ--------------------------------
A0A258ANJ7      LT----------------------------------------------------------
A0A1Z8ZMT6      VF------------------------TA--------------------------------
A0A2E8MCT7      IF------------------------TA--------------------------------
A0A139TLN4      LD---------------------------------VTYWKKSGFRKEEIYDRSPIAVHFS
A0A1G3ZFT0      LN------------------------TN-LSPSHPQSRWSRIL----------SRSQPEA
A0A5B5WI95      LN---------------------------------TSYWYSQDFRKIELYNSSPILAVFE
A0A2N8I9W1      LN---------------------------------TSYWQKKDFREIDLYKTSPLLVHFE
A0A4Q5IH27      LN---------------------------------TSYWQKKDFREIDLYKTSPLLVHFE
A0A2N8IBZ6      LN---------------------------------TSYWQKKDFREIDLYKTSPLLVHFE
A0A7G6DX28      LN---------------------------------TSYWQKKDFREIDLYKTSPLLVHFE
R6J100          LN---------------------------------TSYWQKKDFREIDLYKTSPLLVHFE
A0A139TV24      LN---------------------------------VSYWKKRDLRQIDLYRESPVEVIFE
A0A2N8HT11      LN---------------------------------VSYWKQQDLRQIDLYKDSPITVTFD
R7DS70          LN---------------------------------VSYWKQQDLRQIDLYKDSPITVTFD
A0A2N8HNL6      LN---------------------------------VSYWKQQDLRQIDLYKDSPITVTFD
A0A290Q2Z2      LN------------------------DK----------IGRSI-----------------
A0A2A2RGK2      LD------------------------QD--------------------------------
A0A2A2XXF7      LD------------------------QD--------------------------------
A0A146GCJ0      LD------------------------KD--------------------------------
A0A2T6D6H8      LD------------------------HN--------------------------------
A0A6B3L938      LK------------------------PK---------YWRDES-----------------
A0A2A2R5D6      LQ------------------------KE----------WGTRL-----------------
A0A2V5URB2      LD------------------RNPQFTGQARHKNFAAELWSRAT-----------------
A0A2V2DJ66      ED------------------------DLRKLMAPYKDMFTFGP-----------------
R7L5A9          ED------------------------ELKRFIAPYHNMFTFGI-----------------
A0A5B5WU87      LD---------------------------------VTYWKKDKFRKVEVYEDSPIAVQFT
R7DZW0          LD---------------------------------VTYWKKNGFRKVEIYQDSPIAVQFT
A0A2N8HID1      LD---------------------------------VTYWKKNGFRKVEIYQDSPIAAQFT
A0A2N8HS06      LD---------------------------------VTYWKKNGFRKVEIYQDSPIAVQFT
A0A6N2TNT9      LD---------------------------------VTYWKKNGFRKVEIYQDSPIAVQFT
A0A4P5QM05      LV------------------------KE----------LSPPG-----------------
A0A4Q3C001      LV------------------------KY----------YSGDG-----------------
B4DB23          LI------------------------KE----------FSPPG-----------------
A0A5R8KA81      LG------------------------KD--------------------------------
A0A2E6T482      LT------------------------NK----------WDPN------------------
A0A3C0DQZ7      LT------------------------NK----------WDPN------------------
A0A1Z9CBK5      LQ------------------------EK----------WKEH------------------
A0A2D6ZI96      LQ------------------------EK----------WKEH------------------
A0A358KGZ3      LR------------------------EK----------WKKH------------------
A0A2E9ZQX4      LR------------------------EK----------WKKH------------------
A0A3D5JZU0      LR------------------------EK----------WKKH------------------
A0A2E6HCR0      LR------------------------DE----------WKDD------------------
A0A1Z8WN04      LR------------------------EE----------WKDD------------------
A0A2D7L1N4      LR------------------------EE----------WKDD------------------
A0A2E2R937      LR------------------------EE----------WKDD------------------
A0A520QQY4      LR------------------------EE----------WKDD------------------
A0A2D5MR66      LR------------------------EE----------WKDD------------------
A0A2E0PDQ1      LR------------------------EE----------WKDD------------------
A0A2E2ZZP9      LR------------------------EE----------WKDD------------------
A0A4P5YMI6      LR------------------------EK----------WAQR------------------
A0A7C4LRK7      LN------------------------ER----------FAER------------------
A0A3C1VJ32      LN------------------------VE----------WGKK------------------
A0A7W1VTI1      LT------------------------KR----------WA-E------------------
A0A7V4IGZ6      LN------------------------TV----------WA-R------------------
A0A2N9NTX7      LN------------------------EE----------WG-K------------------
B9XK55          LN------------------------EA----------WK-Q------------------
A0A2A2RGF2      LV------------------------PR----------WDQK------------------
A0A2G4I5Y6      LV------------------------QR----------WDQK------------------
A0A6N6PS97      LS------------------------ET----------LSKR------------------
A0A3M1I883      AG------------------------EKLPPDRQFIPAWSKRL-----------------
A0A1V6JZ45      LR------------------------KT----------WGQR------------------
A0A848A4B3      LR------------------------KT----------WGQR------------------
A0A7C7Z746      LP------------------------NR----------WSEK------------------
A0A520RRW5      LN------------------------HK----------WMER------------------
A0A356NPK0      LN------------------------HK----------WMER------------------
A0A2D7B5P5      LN------------------------HK----------WMER------------------
A0A3D3XGB5      LN------------------------HK----------WMER------------------
A0A2V6F8A1      LN------------------------ER----------WGER------------------
A0A2V5TNH4      LN------------------------ER----------WGGR------------------
A0A2V5X5Q6      LN------------------------ER----------WGER------------------
A0A3R5R2M8      LN------------------------TS---------YWQAQDFREIDLYRNSPILAVFE
A0A411SUQ6      LN------------------------TS---------YWQKKDFRELDLYHATPLLVHFE
A0A2N8HZF2      LN------------------------TS---------YWQKKDFREIDLYKTSPLLVHFE
A0A354E720      LN------------------------TS---------YWQKKDFRELDLYHASPLLVNFE
A0A7T8XNA1      LN------------------------TS---------YWQKKDFRELDLYHATPLLVHFE
B2UPB6          LN------------------------TS---------YWQKKDFRELDLYHATPLLVHFE
A0A1Q6UHJ9      ED------------------------EI-------VRFMAPFN-----------------
A0A2V2BXR0      ED------------------------EI-------VRFMAPFN-----------------
A0A3C1HEJ2      LA------------------------TD-------PRVVEPEI-----------------
A0A522ULD9      LT------------------------KE----------WGKKF-----------------
A0A7W1RNH4      LQLMLREPRSLSRNDVMRAVAVSSEADS-------GTYWLVRE-----------------
A0A2D8V0G3      LK------------------------QD-------EVF----------------------
A0A348S017      LD------------------------EE-------GRY----------------------
A0A3C1UUV7      LD------------------------EE-------GRY----------------------
A0A350I3V2      LD------------------------EE-------GRY----------------------
A0A520RGV5      LD------------------------EE-------GRY----------------------
A0A3D3XF90      LD------------------------EE-------GRY----------------------
A0A2D7B522      LD------------------------EE-------GRY----------------------
A0A356NIC2      LD------------------------EE-------GRY----------------------
A0A832MDW4      LN-------------------------E-------DPRYAKEL-----------------
A0A1V6JU76      IN-------------------------E-------DSRYRDSP-----------------
A0A848ABG7      IN-------------------------E-------DSRYRDSP-----------------
A0A2A2XXW5      LE------------------------TD-------DERYTKSV-----------------
A0A6N6Q6V0      LD-------------------------E-------DGRYKKAL-----------------
A0A2V6JLK8      LQ------------------------DK----------WARDG-----------------
A0A2W5Z1A5      LQ------------------------EK----------WANHS-----------------
A0A2V6EA09      LQ------------------------DK----------WGKDL-----------------
A0A2V6GQI7      LQ------------------------DK----------WGKDL-----------------
A0A7W1U7K0      LQ------------------------DK----------WGQNG-----------------
A0A7W0YDK6      LQ------------------------DK----------WGRDG-----------------
A0A7V9EPY1      LQ------------------------DK----------WTRNG-----------------
A0A838TCM2      LQ------------------------DK----------WARTG-----------------
A0A2N8HDG3      LN------------------------IS---------YWKQQDLRQIDLYRDSPITVTFD
A0A3E1ET42      LD------------------------QT----------WGL-T-----------------
A0A2A2YDW8      LT------------------------NR----------WNV-T-----------------
A0A352XLN9      LT------------------------NR----------WNV-T-----------------
A0A3D0YP62      LE------------------------TS----------WGQ-D-----------------
A0A3D3DV47      LE------------------------TS----------WGQ-D-----------------
A0A7Y1UNY2      LT------------------------SR----------WNQ-N-----------------
A0A2E5XJ49      LT------------------------TR----------WSGYD-----------------
A0A2E6SBY8      LX------------------------TR----------WSGYD-----------------
A0A2E5QMS4      LT------------------------TR----------WRGYD-----------------
A0A2E7YXQ3      LT------------------------TR----------WRGYD-----------------
A0A2E3H787      LT------------------------TR----------WRGFD-----------------
A0A2E7AGN1      LT------------------------TR----------WSGFD-----------------
A0A2E7AKY7      LT------------------------TR----------WSGFD-----------------
A0A3D4CU34      LT------------------------TR----------WSGFD-----------------
A0A2E8M146      LT------------------------TR----------WNGFD-----------------
A0A355S8S2      LT------------------------TR----------WNGFD-----------------
A0A2D6DVN8      LP------------------------TR----------WNGFD-----------------
A0A3C1W2R2      LP------------------------TR----------WNGFD-----------------
A0A2E3NAY6      LT------------------------TX----------WNNFD-----------------
A0A2E3II01      LP------------------------TR----------WNGFD-----------------
A0A368B8C5      LT------------------------TR----------WNNFD-----------------
A0A3R7RBB5      LT------------------------TR----------WNNFD-----------------
A0A2A2QX62      LV------------------------NR----------WNS-D-----------------
A0A4Q3BWH6      LV------------------------NR----------WNT-D-----------------
A0A858RHU7      LV------------------------NK----------WNS-E-----------------
A0A7V7VLV5      LT------------------------NN----------WSL-D-----------------
A0A3N5WCF1      LV------------------------NR----------WNV-D-----------------
A0A4Q3C1K5      LM------------------------SK----------WGV-D-----------------
A0A3D1TI55      LQ------------------------EV----------WGRQF-----------------
A0A3R8IT45      GE------------------------EL-------KKFMEPYE-----------------
A0A2A2PYE8      GD------------------------DL-------RAFLAPYE-----------------
A0A2T6CN73      GQ------------------------EL-------REFLAPYD-----------------
A0A2G4G428      TA------------------------EK-------KEVLAPYQ-----------------
A0A6N6PCD8      LE------------------------TE-------DPAFRPAP-----------------
A0A139TUL1      LG------------------------VS---------YWEKRNIRKVELYHTTPLKVEFG
A0A2N8HCB0      LD------------------------VS---------YWEKRNIRKVDLYHTTPLKVEFS
A0A2N8HP04      LD------------------------VS---------YWEKRNIREVDLYHTTPLKAEFS
A0A2N8HRJ0      LD------------------------VS---------YWEKRNIREVDLYHTTPLKAEFS
A0A6N2U9Y7      LD------------------------VS---------YWEKRNIREVDLYHTTPLKAEFS
A0A6N6PAZ1      WL------------------------PD----------WLSHK-----------------
A0A7V7VK26      WL------------------------PN----------WLSNK-----------------
A0A6I1K459      LT------------------------RH-------PYFTGGTN-----------------
D5ENH7          EE------------------------QR-------KKFMQPYE-----------------
A0A0R2XQ77      DD------------------------ER-------ERFMAPYA-----------------
A0A2E9IN28      DE------------------------MR-------ERFMAPYT-----------------
A0A6N4WTJ5      DD------------------------ER-------ERFMAPYT-----------------
A0A366HAG0      LL------------------------EK----------WNLKS-----------------
A0A2U8DZK4      LN------------------------EK----------LAAVL-----------------
A0A2T6DFL8      LN------------------------RK----------IAALK-----------------
A0A1D8AWD4      LN------------------------EI----------LGKQL-----------------
A0A4Q1C9S2      LN------------------------AI----------LGKQL-----------------
A0A178IH18      LN------------------------RR----------IAALL-----------------
A0A2T6DT99      LN------------------------EK----------LAASQ-----------------
A0A1G3ZT33      LN------------------------AV----------LGKML-----------------
A0A3E1E2T2      LS------------------------TV----------LAPAL-----------------
B1ZMW1          LN------------------------TR----------LAPLL-----------------
A0A3M1I8A3      LE------------------------QD-------PRY----------------------
A0A4V0XS84      LD------------------------ED----------IRYSR-----------------
A0A351WE84      LQ------------------------AV----------WGQQY-----------------
A0A7W1MRT6      LT------------------------VY-------PDGFPASD-----------------
A0A7W1YXK2      LA------------------------AD-------PNFLPQRA-----------------
A0A2D5WGA5      LE------------------------DK----------WKPAN-----------------
A0A2E7SSH2      LK------------------------KR----------WKELY-----------------
A0A832HNU4      LD------------------------KN-------PEFLPGAG-----------------
A0A1V5QDZ6      LQ------------------------KV----------WGEEV-----------------
A0A4Y8P964      LD------------------------EH-------PDWLGLKK-----------------
A0A3D4HF88      GA------------------------ER-------KMLMEPYK-----------------
A0A1V6J089      LQ------------------------KV----------WGAQL-----------------
A0A3C1BZR1      LQ------------------------KV----------WGMEF-----------------
A0A848WTQ6      LV------------------------NR----------WGAAT-----------------
A0A6N6ZHN8      GP------------------------TK-------QRLIQPYE-----------------
A0A6G6K641      LD------------------------RD-------FVFLPRPA-----------------
A0A849Y642      LQ------------------------QR----------WGGKK-----------------
A0A7C4KLL2      LA------------------------QN-------PAFVPQDG-----------------
A0A1H6KPB7      LA------------------------QQ----------WQTDD-----------------
A0A2E9ISN4      LA------------------------EE----------WKKKL-----------------
B9XAX1          LA------------------------TN-------SFFLPGNT-----------------
A0A5R8KKM9      LL------------------------EL----------WSLPA-----------------
A0A7W8DJ38      LT------------------------KI-------PAFAGGHP-----------------
A0A7W1ZQ43      LA------------------------SN----------PGFIL-----------------
A0A139TS01      LA------------------------AE----------WGMTD-----------------
A0A3E1EJT7      PD------------------------EL-------RLLLEPYK-----------------
A0A848WYP9      LR------------------------ND-------PNFLKPVE-----------------
A0A7C3I5X9      LT------------------------ED----------PRYQK-----------------
A0A349GXM8      LA------------------------EA----------WADRL-----------------
A0A7V3QFN7      LD------------------------EV----------WGKKY-----------------
A0A4P5YP61      IY------------------------ER------------KKG-----------------
A0A6B2LYM4      AP------------------------YE----------KGLDA-----------------
A0A6D1VXB3      LD------------------------EH-------PDWLGLKK-----------------
I0JYY7          LD------------------------EH-------PDWLGLKK-----------------
A0A4Y8P842      LD------------------------EH-------PDWIGLKP-----------------
B3DZK9          LD------------------------EH-------LDWLGLKP-----------------
A0A4R7S1J2      LQ------------------------TR----------PDLFG-----------------
A0A2A2XV69      LE------------------------QT----------WKKLY-----------------
A0A651H7X9      AP------------------------YE----------TGDAS-----------------
A0A5E6MPC4      LK------------------------PG----------WRKAA-----------------
A0A840V0I7      WL------------------------PT----------WAENW-----------------
A0A146G2Q9      LD------------------------RK----------WGMPS-----------------
A0A2T6D3Y2      LD------------------------RK----------WGMPS-----------------
A0A6N6PKP9      LA------------------------EI----------PAFRA-----------------
A0A6N6Z250      LE------------------------RR----------LSAAL-----------------
A0A4V1SB02      YG------------------------KE----------IAQSQ-----------------
A0A6N6QEJ2      LA------------------------KV----------YAGRA-----------------
A0A3C1VB86      LL------------------------PP----------EGTVV-----------------
A0A6N6P5E3      LM------------------------QK----------WDLNS-----------------
A0A838I246      LQ------------------------EK----------WSANG-----------------
A0A6J4HTK1      LQ------------------------DK----------WAKDG-----------------
A0A838FVV7      LQ------------------------DR----------WTKNG-----------------
A0A7C3HWX0      LD------------------------TN----------WARYY-----------------
A0A7V4LSC4      LL------------------------RK----------WSKFY-----------------
A0A2D5VY59      LR------------------------NR----------WMKRY-----------------
A0A2D8UZZ4      LR------------------------NR----------WMKRY-----------------
A0A353DV86      LR------------------------NR----------WMKRY-----------------
A0A2E5EPT8      LG------------------------RV----------WGARY-----------------
A0A5B5WZ91      LA------------------------AE----------WGMTD-----------------
A0A2N8HD92      LA------------------------AE----------WGMTD-----------------
A0A2N8HIT2      LA------------------------AE----------WGMTD-----------------
A0A354EBD3      LA------------------------AE----------WGMTD-----------------
A0A355VEB2      LA------------------------AE----------WGMTD-----------------
R6K1U5          LA------------------------AE----------WGMTD-----------------
A0A2N8IWC2      LA------------------------AE----------WGMTD-----------------
A0A2N8I441      LA------------------------AE----------WGMTD-----------------
A0A2N8I3A6      LA------------------------AE----------WGMTD-----------------
A0A410SCC4      LA------------------------AE----------WGMTD-----------------
A0A3R5VEW0      LA------------------------AE----------WGMTD-----------------
A0A7T9B0I0      LA------------------------AE----------WGMTD-----------------
B2UKW3          LA------------------------AE----------WGMTD-----------------
A0A411SSG2      LA------------------------AE----------WGMTD-----------------
A0A6M1RXR2      LM------------------------RR----------WGEKY-----------------
A0A7C3DXS4      LM------------------------VK----------WGAKY-----------------
A0A7V6YXH8      LC------------------------EE----------WGKKY-----------------
A0A2V2SDV4      LN------------------------KV----------WGAKY-----------------
A0A6N6PHJ5      LN------------------------DK----------WGKKY-----------------
A0A7Y4QKN3      LN------------------------TA----------WADKY-----------------
A0A2V5PK75      LN------------------------DD----------WGKKY-----------------
A0A1V6DME1      LS------------------------VE----------WGKKY-----------------
A0A3D3DIJ3      LN------------------------TE----------WGRKY-----------------
A0A7X7VJR5      LN------------------------TE----------WGRKY-----------------
A0A6I1K583      LV------------------------QR----------WDQKY-----------------
A0A350EWA4      LA------------------------DF----------YRDAR-----------------
A0A832D3W5      LD------------------------EV----------WGKKY-----------------
A0A7V2G542      LQ------------------------EK----------WSGTG-----------------
A0A7C4KPD7      LN------------------------ER----------FAERD-----------------
A0A832MGU4      LQ------------------------ER----------FARQD-----------------
A0A1M6RLZ4      LP------------------------ER----------WNLPM-----------------
A0A832M6Y9      FS------------------------QR----------LGLPA-----------------
A0A832HP42      LT------------------------KV----------YADPD-----------------
A0A354T7G8      LA------------------------KR----------WELPS-----------------
A0A512MBZ2      LQ------------------------KK----------WSLPS-----------------
A0A2E8MEZ0      LP------------------------RR----------WGLDM-----------------
A0A7Y2T9S5      LE------------------------TR----------WGKDR-----------------
A0A851GRQ2      LE------------------------TR----------WGENR-----------------
A0A6B3LBV6      LV------------------------QK----------WALTD-----------------
A0A840UX61      LT------------------------NH----------WNLDR-----------------
A0A4Q2YKS3      LV------------------------KR----------WGKDR-----------------
A0A6N6P3T8      LA------------------------NN----------WSLDR-----------------
A0A8A7W668      LV------------------------NK----------WGIDR-----------------
A0A2E3EC33      LX------------------------AK----------WGLTS-----------------
A0A2E4GN01      LM------------------------EE----------WGVSS-----------------
A0A800JJX7      LL------------------------AK----------WGLTS-----------------
A0A1Z8XU55      LK------------------------KA----------WGVNS-----------------
A0A2E1RQR9      LK------------------------KA----------WGVNS-----------------
A0A2E3ISQ4      LK------------------------KS----------WGVPT-----------------
A0A2D6W6F4      LK------------------------KS----------WGVPS-----------------
A0A2D8Z5A8      LK------------------------KS----------WGVPS-----------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      -----------------------------------------------------NWAKGFM
A0A2V5PST3      --------------------------------------------RQESAESDTPDAAARG
A0A2V5PXM3      -----------------------------------------------------------P
A0A1V5QB01      ------------------------------------------------------------
A0A800JGC6      -----------------------------------------------------EDIIKLS
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139SU05      -----------------------------------------------------------E
A0A139SPN4      -----------------------------------------------------------E
A0A1V6E7N1      -----------------------------------------------------------E
A0A2D9MYT1      ------------------------ISKAGFFGLTGYAGGDAPALSREENRPLATGLFAFP
A0A258ANJ7      ------------------------------------------------------------
A0A1Z8ZMT6      -----------------------------------------------------------K
A0A2E8MCT7      -----------------------------------------------------------K
A0A139TLN4      ERGNPAEAGFRVIPVSDTEFRLESGVNDSRPERETGVFGREIEFCSHTFTVEKTPRFDSR
A0A1G3ZFT0      EMTLFTFPPEDNRPYYLVSEKGNKISLFDSNHQRILEGKIGERLANQDKSIQLQINQISA
A0A5B5WI95      EIGKQRSCSFSITPRGEQNFILAYTTSQKKTTTLEGTYGQSIALPFATVSIHPTSLMNEE
A0A2N8I9W1      RIDKQRACTLHITPLDEKRFMLSHYNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDA
A0A4Q5IH27      RIDKQRACTLHITPLDEKRFMLSHYNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDT
A0A2N8IBZ6      RIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDA
A0A7G6DX28      RIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDA
R6J100          RIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDA
A0A139TV24      NIPSDRSCSFDITLKGDSALSLTYQGSDGKPVQLEEELKKPVHLPFATITVYPTSHMPET
A0A2N8HT11      DIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATVTVYPTSNMPET
R7DS70          DIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATVTVYPTSNMPET
A0A2N8HNL6      DIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATVTVYPTSNMPET
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A146GCJ0      -----------------------------------------------------------P
A0A2T6D6H8      -----------------------------------------------------------P
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V5URB2      -------------------------------------------------------AWLNS
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5B5WU87      PEGGAADARFCVVPLSGKEFRLEKDEKDRGGQETGTFGKEVRFDSLTFIVEKTPRFSEAA
R7DZW0          QEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEKTSKFDESS
A0A2N8HID1      QEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEKTPKFDESS
A0A2N8HS06      QEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEKTPKFDESS
A0A6N2TNT9      QEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEKTPKFDESS
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A7W1VTI1      ------------------------------------------------------------
A0A7V4IGZ6      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A848A4B3      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A3R5R2M8      EIGSNRSCRISVTPVGEQSFILAYSNSREEPAFLKGEYGQPISLPFATVSIHPTSVMNAD
A0A411SUQ6      QIDKQRACTLHITPLDEKRFTLGHPNDQGELILLEGFYGKPLTLPFATISVHPTSLMTDA
A0A2N8HZF2      RIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDA
A0A354E720      QIDKQRACTLHITPLDEKRFTLGHPNNQGELILLEGFYGKPLTLPFATVSVHPTSLMTDA
A0A7T8XNA1      QIDKQRACTLHITPLDEKRFTLGHPNDQGELILLEGFYGKPLTLPFATISVHPTSLMTDA
B2UPB6          QIDKQRACTLNITPLDEKRFMLGHPNDQGELILLEGFYGKPLTLPFATISVHPTSLMTDA
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A7W1RNH4      -------------------------PDRRFALQRSKKGSPALAYYAPGDTVKTVDFSFVL
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A832MDW4      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A848ABG7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A7W1U7K0      ------------------------------------------------------------
A0A7W0YDK6      ------------------------------------------------------------
A0A7V9EPY1      ------------------------------------------------------------
A0A838TCM2      ------------------------------------------------------------
A0A2N8HDG3      GIAENRFCNVDITLQEGNTLVLTYHDINGNPVQEKGTFHSPIHLPFATVTVYPTSNMTET
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A7Y1UNY2      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A858RHU7      ------------------------------------------------------------
A0A7V7VLV5      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      EEVDFQPCSLAVTPLNGREFSLSYREKGGRETALAGKFGIPLELPFATVTVRTTSHFSSG
A0A2N8HCB0      EEAAFQPCSLAVTPLNGREFSLSCREKEGGENVLHGKFGVPLKLPSATVKVCPTSYFSSG
A0A2N8HP04      EEVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSG
A0A2N8HRJ0      EQVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSG
A0A6N2U9Y7      EQVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSG
A0A6N6PAZ1      -------L---------------------------------------------------G
A0A7V7VK26      -------L---------------------------------------------------G
A0A6I1K459      -------TLTE-------------------------------------------------
D5ENH7          -------GAFSF------------------------------------------------
A0A0R2XQ77      -------DVLSF------------------------------------------------
A0A2E9IN28      -------DALSL------------------------------------------------
A0A6N4WTJ5      -------DALSL------------------------------------------------
A0A366HAG0      -------K----------------------------------------------------
A0A2U8DZK4      -------EIPGPL-----------------------------------------------
A0A2T6DFL8      -------DSPAAF-----------------------------------------------
A0A1D8AWD4      -------NDGVAL-----------------------------------------------
A0A4Q1C9S2      -------NNGAPL-----------------------------------------------
A0A178IH18      -------GASAPY-----------------------------------------------
A0A2T6DT99      -------GSSVPL-----------------------------------------------
A0A1G3ZT33      -------NNGEPL-----------------------------------------------
A0A3E1E2T2      -------DSPEPL-----------------------------------------------
B1ZMW1          -------GATGPL-----------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      -------A----------------------------------------------------
A0A351WE84      -------NDDKSPITK--------------------------------------------
A0A7W1MRT6      -------MRDVRAADSSTSGSAYAVEFDAQGYTLRSNLHEIRARYGEPVSTGGVSFAIVS
A0A7W1YXK2      -------GE--------------------------------------------------T
A0A2D5WGA5      -------GD--------------------------------------------------P
A0A2E7SSH2      -------KW--------------------------------------------------D
A0A832HNU4      -------TN---------------------------------------------------
A0A1V5QDZ6      -------ND--------------------------------------------------D
A0A4Y8P964      -------PS--------------------------------------------------I
A0A3D4HF88      -------G----------------------------------------------------
A0A1V6J089      -------NE--------------------------------------------------D
A0A3C1BZR1      -------NE--------------------------------------------------D
A0A848WTQ6      -------R----------------------------------------------------
A0A6N6ZHN8      -------DE--------------------------------------------------L
A0A6G6K641      -------GR--------------------------------------------------D
A0A849Y642      -------GG--------------------------------------------------G
A0A7C4KLL2      -------SV--------------------------------------------------T
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          -------NV--------------------------------------------------L
A0A5R8KKM9      -------NG--------------------------------------------------R
A0A7W8DJ38      -------AS--------------------------------------------------S
A0A7W1ZQ43      -------QK--------------------------------------------------D
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      -------SH--------------------------------------------------A
A0A848WYP9      -------GG--------------------------------------------------Y
A0A7C3I5X9      -------H----------------------------------------------------
A0A349GXM8      -------GG---------------------------------------------------
A0A7V3QFN7      -------GR--------------------------------------------------G
A0A4P5YP61      -------LF--------------------------------------------------D
A0A6B2LYM4      -------TL--------------------------------------------------R
A0A6D1VXB3      -------ES--------------------------------------------------F
I0JYY7          -------ES--------------------------------------------------F
A0A4Y8P842      -------KK--------------------------------------------------T
B3DZK9          -------KK--------------------------------------------------N
A0A4R7S1J2      -------GK--------------------------------------------------L
A0A2A2XV69      -------GI--------------------------------------------------A
A0A651H7X9      -------DP---------------------------------------------------
A0A5E6MPC4      -------KR--------------------------------------------------A
A0A840V0I7      -------VG--------------------------------------------------G
A0A146G2Q9      -------R----------------------------------------------------
A0A2T6D3Y2      -------R----------------------------------------------------
A0A6N6PKP9      -------QI--------------------------------------------------A
A0A6N6Z250      -------GL--------------------------------------------------N
A0A4V1SB02      -------KS--------------------------------------------------N
A0A6N6QEJ2      -------KV--------------------------------------------------P
A0A3C1VB86      -------TN--------------------------------------------------G
A0A6N6P5E3      -------K----------------------------------------------------
A0A838I246      -------YR--------------------------------------------------P
A0A6J4HTK1      -------HR--------------------------------------------------P
A0A838FVV7      -------IR--------------------------------------------------P
A0A7C3HWX0      -------NP--------------------------------------------------E
A0A7V4LSC4      -------NP--------------------------------------------------E
A0A2D5VY59      -------NL--------------------------------------------------K
A0A2D8UZZ4      -------NL--------------------------------------------------K
A0A353DV86      -------NL--------------------------------------------------K
A0A2E5EPT8      -------GI--------------------------------------------------G
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A7T9B0I0      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
A0A6M1RXR2      -------A---------------------------------------------------G
A0A7C3DXS4      -------A---------------------------------------------------G
A0A7V6YXH8      -------N---------------------------------------------------N
A0A2V2SDV4      -------GP--------------------------------------------------N
A0A6N6PHJ5      -------N---------------------------------------------------D
A0A7Y4QKN3      -------N---------------------------------------------------G
A0A2V5PK75      -------H---------------------------------------------------G
A0A1V6DME1      -------A---------------------------------------------------G
A0A3D3DIJ3      -------A---------------------------------------------------S
A0A7X7VJR5      -------A---------------------------------------------------S
A0A6I1K583      -------R---------------------------------------------------L
A0A350EWA4      -------K---------------------------------------------------L
A0A832D3W5      -------G---------------------------------------------------R
A0A7V2G542      -------Q---------------------------------------------------P
A0A7C4KPD7      -------G---------------------------------------------------L
A0A832MGU4      -------K---------------------------------------------------M
A0A1M6RLZ4      ------------------------------------------------------------
A0A832M6Y9      -------D---------------------------------------------------Q
A0A832HP42      -------H---------------------------------------------------Y
A0A354T7G8      -------R----------------------------------------------------
A0A512MBZ2      -------R----------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A7Y2T9S5      ------------------------------------------------------------
A0A851GRQ2      ------------------------------------------------------------
A0A6B3LBV6      -------E----------------------------------------------------
A0A840UX61      ------------------------------------------------------------
A0A4Q2YKS3      -------D----------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
A0A8A7W668      ------------------------------------------------------------
A0A2E3EC33      -------E----------------------------------------------------
A0A2E4GN01      -------E----------------------------------------------------
A0A800JJX7      -------D----------------------------------------------------
A0A1Z8XU55      -------D----------------------------------------------------
A0A2E1RQR9      -------D----------------------------------------------------
A0A2E3ISQ4      -------N----------------------------------------------------
A0A2D6W6F4      -------D----------------------------------------------------
A0A2D8Z5A8      -------D----------------------------------------------------
                                                                            

A0A2A2XVF1      -----PAFVAPGAKPTEIQLADKLRG-KVRAVLRRGTR-LIDIIVEDKDPV------MAR
A0A2V5UHJ2      PATPTPSTPDPIPLSTRLAGSYLL---MLEVRPVVSTS-LVVIKFTTPDPA------LSA
A0A2V5PST3      GNLVDRQETDKNKPVVSRGLVGHYMS-FLQVNSIEKTR-LVEIAFVTPNPA------LSQ
A0A2V5PXM3      RFLKIDDGAPRPTREKL---VTRLSK-MVDAKLRKGTR-LIDVKVEHTSPE------MAA
A0A1V5QB01      --------------AEE---VSRTIT-RISVAPVGKTA-FLAITVESLDPV------LGS
A0A800JGC6      FLKNLKTTDESVVLEPRQLVNMMLGESWIRAVPRKKSY-IVDIIVDHTSAE------VAH
A0A7Y2T8X5      -----ELVYKSAADVETSEVVKMITG-NLKVVPRNGTT-LIDIIVTHKDSV------TAM
A0A1J4XH17      --------------EAI---AEILFH-NRKIVPERSSL-MIMLAYNHPDPE------IAA
A0A7C5LI63      --------------------EIRENLVNLKVSAVSGSD-IILISVDSPSRE------FAR
A0A7C5P291      --------------------EVRENLTNLKISPIRGTQ-IILISVDSPSRD------FAR
A0A290QGD9      -------------SGDPLTPAEVLFK-NRRVIPRRMSL-IIEVQYRHPDRV------LAS
A0A1D8AS58      -------------AEVPITAAEVVYL-NRKIVPVRLSL-VLQVQFSHPDKL------MAA
I6AQC1          -------------FGDPLTPLEVLGE-NRSIVPFRMSL-LVAIEYRHPDRL------IAA
W0ITH7          -------------FGDPLTPLEVLGQ-NRSIIPFRMSL-LVAIEYRHPDRL------IAA
A0A139SU05      VAIIQRPYLKSQAPGEPLPPLAAMLG-LLSIDPVRNSF-ILRLTVGHQDPE------AAA
A0A139SPN4      IAIIQRPYLKSQPPGEPLPPLAAMLG-LLSIDPVRNSF-ILRLTVGHQDPE------AAA
A0A1V6E7N1      VKILQRPFLTKLSPGATPPSAGAALG-SMVPSPVRNSF-LISVSVNHQDPE------AAA
A0A2D9MYT1      PKPKDGEEPEDLTYEEQ---LKRLSD-AVSVSPIRLSR-LVDVSVESPNRN------EAA
A0A258ANJ7      -QLPSFSGGHPADSKEARDNAIFMVSSMIRISLRKDTR-LIDFNVTGADPE------QVA
A0A1Z8ZMT6      KAEEKKVFAEAPAPEQL---AGIISG-WTSSEVRRGTR-LIDISVNHTDPD------VAQ
A0A2E8MCT7      EPVKKKVFADAPEPEQL---SGMISG-WTSSEVRRGLR-LIDISVNHTDPD------VAQ
A0A139TLN4      SLDAPVIVRKTFIKNAA---IALIGG--LTVNKASGKTNLINISVRCNNPV------KAE
A0A1G3ZFT0      RAGTKFTLMQYPINDRM---VRSMAR-RITIDDPEKLG-LLTLAYQDTNPH------LAA
A0A5B5WI95      WDGKPIIINHLTVLETA---HGLLKNFSVTRPDVKESS-LLEMTLTANNPQ------KAA
A0A2N8I9W1      WNEKTVIVRHKPVLETA---NNLLHGLTVTRPDAKESS-LLEMSLTASNPQ------KAE
A0A4Q5IH27      WNEKTVIVRHKPVLETA---NNLLHGLTVTRPDAKESS-LLEMSLTASNPQ------KAE
A0A2N8IBZ6      WNEKTVIVRHKPVLETA---NNLLHGLTVTRPDAKESS-LLEMSLTASNPQ------KAE
A0A7G6DX28      WNEKTVIVRHKPVLETA---NNLLHGLTVTRPDAKESS-LLEMSLTASNPQ------KAE
R6J100          WNEKTVIVRHKPVLETA---NNLLHGLTVTRPDAKESS-LLEMSLTASNPQ------KAE
A0A139TV24      IPGTTITVRRVPINAAA---DQLLANFTVKRPDAKESS-LLQMTLTSSNPD------KAT
A0A2N8HT11      VSGTTITVRRIPVNAAA---DQLLANFTVTRPDAKESS-ILQMTLTSTNPD------KAA
R7DS70          VSGTTITVRRIPVNAAA---DQLLANFTVTRPDAKESS-ILQMTLTSTNPD------KAA
A0A2N8HNL6      VSGTTITVRRIPVNAAA---DQLLANFTVTRPDAKESS-ILQMTLTSTNPD------KAA
A0A290Q2Z2      ------GAYAPLATDET---YNYLLKKMLRVESPRGSS-MIEVGVYSQDAA------LAA
A0A2A2RGK2      -PRFLSAVGISAKDATNDRTAGALSG-MVGVIYRPQTR-LIDVSITSRDPN------LSV
A0A2A2XXF7      -PRFLAAAGISARDASPDRVAAALSS-MSASVYRLNTR-LIDLMITSADPN------LSV
A0A146GCJ0      DFAPPRKDGSPYSEIEL---VDKLAQ-KIDVQLIRGTR-LVQIVVEDKNPE------KAQ
A0A2T6D6H8      EFAPPRSNGGKYTDIEL---ADRLAS-KVSAKLRRGTR-LIELTVEDKNPE------LAQ
A0A6B3L938      -----SREFQSAAETSETDFLELLYS-GISVSNQRGTT-LINIEMTHPDPE------TAK
A0A2A2R5D6      ------FGGSNLPMDKA---FVLLNN-RVDVNVQRNSD-ILEIRVKSDLPK------EAS
A0A2V5URB2      LSSQPVTANAPDVYGINSQLIDAYQG-MVEIEPLKRSR-LVRISISSADPV------LAA
A0A2V2DJ66      -------------RKTE---EEILQM-NRRVIPERMSL-MIRVTYTHPNAE------MAA
R7L5A9          -------------RKSE---EELLMD-NRSIIPQRMSL-IVTVIFEHPDNN------MAA
A0A5B5WU87      LNVPVIVRKTSVRNAAV-----GLRS-GLTVKKANGKNNLVNVSIRCNNPV------KAE
R7DZW0          LNVPVIVRRTSVKNAAM-----GLGS-GLTVRKASGKNDLINISMRCNNPV------KAE
A0A2N8HID1      LNVPVIVRRTSVKNAAM-----GLGS-GLTVRKASGKNDLINISMRCNNPV------KAE
A0A2N8HS06      LNVPVIVRRTSVKNAAM-----GLGS-GLTVRKASGKNDLINISMRCNNPV------KAE
A0A6N2TNT9      LNVPVIVRRTSVKNAAM-----GLGS-GLTVRKASGKNDLINISMRCNNPV------KAE
A0A4P5QM05      ---------QTMPLQWV---TEILSR-SMVVQEQRNTT-LVDIGVYHTKPE------LAA
A0A4Q3C001      ---------PPLPKQTV---LRLLNA-DLVLQEVRNTS-FIEIGVYNTDPQ------TAA
B4DB23          ---------QRLPLQQV---YIQLRN-SMKLNEVRNTG-LIEVGAKDTDAQ------RAA
A0A5R8KA81      -MTFPEVRDYIMTEPEL---VDALES-EIDITIRKGTR-LIEVSVEDQVPE------RAQ
A0A2E6T482      ------EKG--LDLIKA---REILKK-TIDVRQYRNTS-IIELRAYDRDKE------LAT
A0A3C0DQZ7      ------EKG--LDLIKA---REILKK-TIDVRQYRNTS-IIELRAYDRDKE------LAT
A0A1Z9CBK5      ------YGGEELDEVRA---RKHLEK-VIDVSQYRNTS-IIELRAYDRDRG------LAQ
A0A2D6ZI96      ------YGGEELDEVRA---RKHLEK-VIDVSQYRNTS-IIELRAYDRDRG------LAQ
A0A358KGZ3      ------YGGKQLTDVEA---RKHLEK-VIDVSQYRNTS-IIELRAYDRDKN------LAQ
A0A2E9ZQX4      ------YGGKQLTDVEA---RKHLEK-VIDVSQYRNTS-IIELRAYDRDKN------LAQ
A0A3D5JZU0      ------YGGKQLTDVEA---RKHLEK-VIDVSQYRNTS-IIELRAYDRDKN------LAQ
A0A2E6HCR0      ------NGGEPLTELVA---RKRLEK-VIDVSQYRNTS-IIELRAYDGDED------LAR
A0A1Z8WN04      ------NGGESLSELRA---RKLLEK-VIDVSQYRNTS-IIELRAYDGDEN------LAR
A0A2D7L1N4      ------NGGESLSELRA---RKLLEK-VIDVSQYRNTS-IIELRAYDGDEN------LAR
A0A2E2R937      ------NGGESLSELRA---RKLLEK-VIDVSQYRNTS-IIELRAYDGDEN------LAR
A0A520QQY4      ------NGGESLSELRA---RKLLEK-VIDVSQYRNTS-IIELRAYDGDEN------LAR
A0A2D5MR66      ------NGGEALTELRA---RKRLEK-IIDVSQYRNTS-IIELRAYDGDEN------LAR
A0A2E0PDQ1      ------NGGELLTELRA---RKRLEK-VIDVSQYRNTS-IIELRAYDGDEN------LAR
A0A2E2ZZP9      ------NGGELLTELRA---RKRLEK-VIDVSQYRNTS-IIELRAYDGDEN------LAR
A0A4P5YMI6      -----YGSPVPLLDTEA---YGVLTK-RLDLRQVRNTS-LIEIRVFSEIPA------EAR
A0A7C4LRK7      -----DKLPVPYRLDET---MILLKR-DVDITTYRNTS-IIEIKVFSPKPE------EAA
A0A3C1VJ32      -----YNNGETLKTTET---MEILKQ-RMGLVPVRNTK-LISITVYSDDKK------EAA
A0A7W1VTI1      -----LNDGQPLTSEQA---LLFLKN-KMKVRPDRNTS-IIEISFRSRDPK------EAA
A0A7V4IGZ6      -----KFNTDRLKTPDT---LDILRR-RLDLRPVRNTM-FIEIGVFSEKPE------EAA
A0A2N9NTX7      -----LEGGAPLKKQQT---IDKLKR-MMDPRQVRNTS-LVEIWVTSFNKE------EAA
B9XK55          -----YNNGQKLKTSQS---RAQLKR-MMELHPDRNTS-LIEIKIYSNDKK------EAA
A0A2A2RGF2      -----YRLGQ--SKVKA---YEVLTK-LIDPRQVRNTS-IIEINVYSKDKA------EAA
A0A2G4I5Y6      -----YRLGQ--SKLKA---YQVLTK-LIDPRQVRNTS-IIEINVYSKDKE------EAA
A0A6N6PS97      -----YRLTSKLSQEDT---FQIIKK-TIDLQETRNTS-LIEIRAYSEDPN------EAS
A0A3M1I883      ----GLRDGELLNEQEA---YQYLLR-NMEVKQSRNTK-LVEITVYSPIPE------EAA
A0A1V6JZ45      -----LKN--AVSEPEA---YLLLRR-NLDVRQSRNTS-LIEIRAYSENRD------EAS
A0A848A4B3      -----LKN--AVSEPEA---YLLLRR-NLDVRQSRNTS-LIEIRAYSENRD------EAS
A0A7C7Z746      -----YNAGRTLTTEQT---YQILKS-KIDTSPTRNTS-LIEIKVYSDKPE------EAA
A0A520RRW5      -----FKTDTPLTTNET---FQVLKN-SIDVDQYRNTS-LIEIKAYSKDKE------EAA
A0A356NPK0      -----FKTDTPLTTNET---FQVLKN-SIDVDQYRNTS-LIEIKAYSKDKE------EAA
A0A2D7B5P5      -----FKTDTPLTTNET---FQVLKN-SIDVDQYRNTS-LIEIKAYSKDKE------EAA
A0A3D3XGB5      -----FKTDTPLTTNET---FQVLKN-SIDVDQYRNTS-LIEIKAYSKDKE------EAA
A0A2V6F8A1      -----YNNGVALSKAET---FDVLKG-KIDVRQTRNTS-LIEIRVYSDAKDK--PAQEAA
A0A2V5TNH4      -----YNNNIPLKTPET---FDILQG-KIDVRQTRNTS-LIEIRVYSDAKEKEKPAQEAA
A0A2V5X5Q6      -----YNNNIPLKTPET---FDILHG-KIDVRETRNTS-LIEIRVYSDAKEKDNPAQEAA
A0A3R5R2M8      WNGQTVIIRHVPSQDTA---RALLANFSVARPDAKDSS-LLEMTLTASNPQ------KAE
A0A411SUQ6      WNGKTVIVRHSPVLETA---NALLRGLTITRPDSKESS-LLEMTLTSSNPQ------KAE
A0A2N8HZF2      WNGKTVIVRHSPVLETA---NALLRGLTITRPDSKESS-LLEMTLTSSNPQ------KAE
A0A354E720      WNGKTVIVRHSPVLETA---NALLHGLTITRPDSKESS-LLEMTLTSSNPQ------KAE
A0A7T8XNA1      WNGKAVIVRHSPVLETA---NALLRGLTITRPDSKESS-LLEMTLTSSNPQ------KAE
B2UPB6          WNGKTVIVRHSPVLETA---NALLRGLTITRPDSKESS-LLEMTLTSSNPQ------KAE
A0A1Q6UHJ9      ------DMFTLGPRKTE---EELLAE-NRTIAPERMSL-IIRIAFEHPDPD------MAA
A0A2V2BXR0      ------DMLTLGPRKTE---EELLAE-NRTIAPERMSL-IIRIAFEHPDPD------MAA
A0A3C1HEJ2      --------QGILSRAKL---VARVSD-LIAPRLRPATR-LIDVTVQHSDPQ------LTE
A0A522ULD9      -----NEDKSPINRSLA---FSILSG-ALRVQPYRDTS-LISIIVRMEDAA------EAA
A0A7W1RNH4      SQHAAGYPAISFHVQRFPEAVGDLGD-ALRVARPSAQANLVRLSYSGSDAP------LLA
A0A2D8V0G3      --------------KGAENIVNAVRD-CITISPIRLSR-LVEVSVEHPSPL------QAA
A0A348S017      --------------AQSQNVINAVRN-DISISPVRLSR-LVEISVQHPSPR------VAA
A0A3C1UUV7      --------------AQSQNVINAVRN-DITISPVRLSR-LVEISVQHPSPR------VAA
A0A350I3V2      --------------AQSQNVINAVRN-DITISPVRLSR-LVEISVQHPSPR------VAA
A0A520RGV5      --------------AQSLDVINAVRN-DITISPVRLSR-LVEISVQHPSPR------VAA
A0A3D3XF90      --------------AQSLDVINAVRN-DITISPVRLSR-LVEISVQHPSPR------VAA
A0A2D7B522      --------------AQSLDVINAVRN-DITISPVRLSR-LVEISVQHPSPR------VAA
A0A356NIC2      --------------AQSLDVINAVRN-DITISPVRLSR-LVEISVQHPSPR------VAA
A0A832MDW4      --------------DVA----QAVAD-DITVAPIRMSR-LVDVRVEHTNPK------KAA
A0A1V6JU76      --------------DVA----RALAE-DIRINPIRLSR-LVDVVVEHPNAS------KAA
A0A848ABG7      --------------DVA----RALAE-DIRINPIRLSR-LVDVVVEHPNAS------KAA
A0A2A2XXW5      --------------DKV----TAVTK-DIKIVPIRLSR-LVEVQVTHPKGE------QAQ
A0A6N6Q6V0      --------------DKI----SAVNE-DIRIDPIRLTR-LVEVKARHPVQS------RAR
A0A2V6JLK8      --------RPP-SREIA---YQMLRN-RLDVDEVRNTD-LLQISVYDGSPQ------LAA
A0A2W5Z1A5      --------AGPLSREQT---YAILRG-KLEVDEVRNTN-LLQISVFDSNPQ------LAA
A0A2V6EA09      --------GRP-SREQT---YKLLLS-RLDVEEVRNTD-LLQISVFDANPQ------EAA
A0A2V6GQI7      --------GRP-SREQT---YKLLLR-RLDVEEVRNTD-LLQISVFDANPQ------EAA
A0A7W1U7K0      --------NKL-TREVA---YQILKG-KLDVDEVRNTD-LLQISVFDTDRQ------EAA
A0A7W0YDK6      --------GRP-TLEQA---YQILRG-KLDLDEVRNTD-LLQISVFDPNPR------LAA
A0A7V9EPY1      --------YRP-PREQA---YQILRS-KLDLDEVRNTD-LLQISVFDPDPQ------QAA
A0A838TCM2      --------FRP-TREQA---YQVLRG-KLDLDEVRNTD-LLQISVYDSDPQ------EAA
A0A2N8HDG3      VPGTTITVRRTPVNAAA---DQLLANFTVMRPDAKESS-ILQMTLTSTNPV------KAA
A0A3E1ET42      -------------FDEA---LTKLER-MIETETERGTE-IMTVIVSSVRRD------EAA
A0A2A2YDW8      -------------EEDA---LMTLTG-IVQAQNIRGTD-LIEITVLHPGAE------DAR
A0A352XLN9      -------------EEDA---LMTLTG-IVQAQNIRGTD-LIEITVLHPGAE------DAR
A0A3D0YP62      -------------RKTV---IDVLRQ-IVRTTQRRGTD-LIEISVRHRKKE------EAQ
A0A3D3DV47      -------------RKTV---IDVLRQ-IVRTTQRRGTD-LIEISVRHRKKE------EAQ
A0A7Y1UNY2      -------------PDSI---VGTLKG-IVSTEQVRGTD-LIEIRVRHPSAQ------DAR
A0A2E5XJ49      -------------RDMA---LLKVKK-ILKTEQIRNTD-HIEIRIRHQKPE------DAQ
A0A2E6SBY8      -------------RDMA---LLRVKK-ILKTEQIRNTD-HIEIRIRHQKPE------DAQ
A0A2E5QMS4      -------------RDMA---LVKLKQ-ILKTEQIRNTD-HIEIRIRHQNSE------DAR
A0A2E7YXQ3      -------------RDMA---LVKLKQ-ILKTEQIRNTD-HIEIRIRHQNSE------DAR
A0A2E3H787      -------------RDMA---LLKLKS-ILKTEQIRNTD-HIEIRIRHQKQE------DAR
A0A2E7AGN1      -------------EDMA---LIKLKS-ILKTEQIRNTD-HIEIRIRHQNRE------DAQ
A0A2E7AKY7      -------------EDMA---LMKLKS-ILKTEQIRNTD-HIEIRIRHQNRE------DAQ
A0A3D4CU34      -------------EDMA---LIKLKS-ILKTEQIRNTD-HIEIRIRHQNRE------DAQ
A0A2E8M146      -------------QNMA---LLKLKS-ILKTEQIRNTD-HIEVRIRHQNRD------DAR
A0A355S8S2      -------------QNMA---LLKLKS-ILKTEQIRNTD-HIEVRIRHQNRD------DAR
A0A2D6DVN8      -------------RNMA---VLKLKS-ILKTEQIRNTD-HIEIRIRHQNRD------DAR
A0A3C1W2R2      -------------RNMA---VLKLKS-ILKTEQIRNTD-HIEIRIRHQNRD------DAR
A0A2E3NAY6      -------------RNMA---LLKLKS-ILKTEQVRNTD-HIEIRIRHQNRD------DAR
A0A2E3II01      -------------RNMA---LLKLKS-ILKTEQIRNTD-HIEIRIRHQNRD------DAR
A0A368B8C5      -------------RNMA---LLKLKS-ILKTEQVRNTD-HIEIRIRHQNRD------DAR
A0A3R7RBB5      -------------RNMA---LLKLKS-ILKTEQVRNTD-HIEIRIRHQNRD------DAR
A0A2A2QX62      -------------RESV---RGTLRG-IVSAQNIRGTS-LIEIRVRYNDPK------DAQ
A0A4Q3BWH6      -------------LESV---RGILKG-IVEAQDIRGTS-LIEIRVRYNDPK------DAQ
A0A858RHU7      -------------PEAV---RRTLRS-IVDAENIRGTA-LIEIRVRYSDPK------DAQ
A0A7V7VLV5      -------------RETV---FGILMG-IVKTDNIRGTD-LITISVRHSDKD------EAR
A0A3N5WCF1      -------------KEAA---LGILKG-IVGTQNIRGTD-LISIRVRHTNKV------DAR
A0A4Q3C1K5      -------------KDTA---IKILKG-IVQTQNLRGTD-LIQIRVRHTSKE------DAR
A0A3D1TI55      -----NDNQEEMDLEST---ISRLRS-MVETVQVRGTT-IIEVQVTSRDSA------EAA
A0A3R8IT45      ----------KGRFGDPLTPLEVLGQ-NRKIVPLRLSL-IVGVEYTHPDRL------IAT
A0A2A2PYE8      ----------RAGTDITYVA-EILAK-NRKIIPQRLTL-VVTVAYQHPDRF------VAA
A0A2T6CN73      ----------TGAPEKPSVA-RLLKL-NRRVIPQRLTL-MVWIAYKHPNRF------VAA
A0A2G4G428      ---------SGNIFSGPLSEQEVFSR-QRSIMPQRQTL-VVNVEFTHPNRE------LAR
A0A6N6PCD8      ----------GDPPRTDAELAEIMQR-QLQAKLKRGSR-LIEISFDSVNPE------RAA
A0A139TUL1      SIGRPIFVERLSVKEAC---AQMLGRLSVTRPDSKESS-LLELTLRLSHPQ------KAE
A0A2N8HCB0      SMGRTIFVERVSVKEAA---AGMLGRLSVTRPDSKESS-LLELTLRLSHPQ------KAE
A0A2N8HP04      SMGRTIFVERVSVKEAT---DGMLGRLSVTRPDSKESS-LLELTLRLSHPQ------KAE
A0A2N8HRJ0      SMGRTIFVERVSVKEAT---DGMLGQLSVTRPDSKESS-LLELTLRLSHPQ------KAE
A0A6N2U9Y7      SMGRTIFVERVSVKEAT---DGMLGQLSVTRPDSKESS-LLELTLRLSHPQ------KAE
A0A6N6PAZ1      KKSADTDHQPPPPPAAL---GG-MASQWLTVSIRRNTR-LLDITITHPVPE------VAK
A0A7V7VK26      KKSADAAQQPPPPPAAI---GGRIASKWLAVTIRRNTR-LLDISITHPVPE------VAK
A0A6I1K459      --------------SQV---MAAVGG-MLDARLRRFTR-LIDVTAESGDPA------LAQ
D5ENH7          --------------SGPLTASEILGK-YRKIMPQRMSL-MVSVTYTHPDSQ------MAA
A0A0R2XQ77      --------------TGPLSPAALLAQ-NRRIMPQRGTL-MIGVGYNHPDPV------IAA
A0A2E9IN28      --------------SGPLTPLEILGR-NRSIMPKRMSL-MIHIAYSHPDPI------VAA
A0A6N4WTJ5      --------------SGPLSPVEILGK-YRKVMPQRMSL-MIGVAYTHPDPV------IAA
A0A366HAG0      --------------QAA---AGKLIG-NLDAQSSIKSD-FITLDYYDEDPD------LAA
A0A2U8DZK4      --------------PVDFTYDYLIKKRIVSVESPKTSS-IVEITIDTRDPA------LSA
A0A2T6DFL8      --------------PSAVTYAILTRK-MLRVESQRASS-VIEINVDAEDPQ------LAA
A0A1D8AWD4      --------------PSAITYRYLISK-MLRVEAPRASS-IIEIDVYARDQR------LAA
A0A4Q1C9S2      --------------PSAITYKYMLDK-MVRPDAPRASS-IIEINVFARDNR------LAA
A0A178IH18      --------------PTDVTYEYLTKK-MLRVEMPRNTS-LLEVNVFSRDAA------LAA
A0A2T6DT99      --------------PTDVTYLLLVNK-MIRIETPRGSS-LIEIEVSAQDPA------LAA
A0A1G3ZT33      --------------PTSITAQYLLRK-MLRVESQRSSS-IIEIDVYAQEPA------LAA
A0A3E1E2T2      --------------PDAITYHYLLQK-MLRVESQRSSS-LIEISVYSEDPT------LGA
B1ZMW1          --------------PSAMTYRYLLNK-MLAVESQRSSS-LIEINVYAQEPP------LAA
A0A3M1I8A3      --------------SKEMDIVAALAK-DITVTPIRMTR-LVEVSVEHTDPR------KAK
A0A4V0XS84      --------------KDL---IKVLSE-DLTVAPIRATR-LIEIKANHTDPQ------KAA
A0A351WE84      --------------EDA---LATLSS-SIKIEQDRDTS-LINISVTQEDRE------LAA
A0A7W1MRT6      RPPHRSGTIGVLNSASA---VGMLLS-GVDARPRKSTD-VVDVTYRANDPF------VAQ
A0A7W1YXK2      YSD-----------DQL---IRALND-RTNVRVRRGTR-LIDITVESRAPA------LAK
A0A2D5WGA5      LSD-----------VNA---RKILEK-SIDIRQYRNTS-IIELRAYDRDPN------LAQ
A0A2E7SSH2      LND-----------QQA---RKQLEK-VIDVSQYRNTS-IIELRAYDGDKQ------LAQ
A0A832HNU4      --------------ADF---ASVVQA-GVTAHPQRDAPRIVDVSFEHVNPR------VAA
A0A1V5QDZ6      GSPLPL--------ERA---HAMLSR-SLKVEQFRDTS-LISIQVYREDPT------EAA
A0A4Y8P964      TKHSKNSSEEEETSSIINSYTKRILD-NLRIEPVKNTR-LVKIKFDSVNAE------AAA
A0A3D4HF88      --------------DEEVTINEVLYE-NRDVVPLRASL-LIAVTYTHPDAR------IAA
A0A1V6J089      KSAITP--------ELA---LQILQR-SIRVEQDRDTM-LMNISATSEDPK------QAA
A0A3C1BZR1      KSPVAP--------ELA---LQILSR-SLRVEQDRDTT-LMNISATSEDPK------LAA
A0A848WTQ6      --------------QEA---ANMLRK-NLETSSRRNTN-LIDVSVYSTSPE------EAA
A0A6N6ZHN8      ESTLSGA-------PEV---PSILAR-NRSVVPERSSR-IVNVAFTHPNPQ------VAQ
A0A6G6K641      ANPL----------DVV---VGRLQG-CVSSGVRGRTR-LIDIRAEHTDPE------TAR
A0A849Y642      AELPR---------DIA---YYMLKS-KLQLNVARGTT-VIEIRSWSEDKN------EAA
A0A7C4KLL2      R-------------DEV---IARLGT-LTKAELRRGTR-LIDILAVHTDPK------LAA
A0A1H6KPB7      --------------ATA---ASILRG-MIQVMPVRGKD-LVDVKVVGSDPA------LVK
A0A2E9ISN4      --------------TEP---ERYVEF-LVTSVPGSNGT-MIDCLVDSVAAE------YSK
B9XAX1          SE------------AKL---VNALAG-MIVTKLRPETR-LVDITVTHPNAE------MAQ
A0A5R8KKM9      --------------QFA---IGRLQG-HLEVNSSARSE-IINITYYDEDPQ------LAA
A0A7W8DJ38      KEAK----------DNA---IFMINS-MIRISLRKDTR-LIDFAVTGAEPE------QVA
A0A7W1ZQ43      GPVSE---------AKL---VRALAG-MISVKLRPETR-LIDITVQHRDSE------MTI
A0A139TS01      --------------DLA---ATNLAG-MIKVSPLRATD-LVDVIVSGPDPK------LVQ
A0A3E1EJT7      GEPPSP--------------ASIIYH-NRQIIPQRLSL-MTAIEFRHPNPK------IAA
A0A848WYP9      SD------------AEI---IEIMWN-RVSSELDRGTR-LIGVTVKDKDPK------RAR
A0A7C3I5X9      --------------VDV---ARAVAD-DISVTPLRMTR-LVDVGVEHTSPT------KAA
A0A349GXM8      --------------------RHRMNP-KIAISQVRGINPMVSVAVQSRNKD------YTA
A0A7V3QFN7      PLSM----------DKT---LELLRK-RLSVRPSRQAS-TIEIRVFSEDKN------EAA
A0A4P5YP61      AVAGTAAPEKEISIDGI---AGTLAA-ITESRMRRGTR-LIDVSVEHPNAA------MAA
A0A6B2LYM4      GT------------RSV---GQILYS-NRAISPVRLSL-VVNIIFTHPDKE------VAA
A0A6D1VXB3      RKHSINPSEGIEPTSEINLYAEYLLK-NLQVTPVRNTR-LVQIKFDSVNAQ------AAA
I0JYY7          RKHSINPSEGIEPTSEINLYAEYLLK-NLQVTPVRNTR-LVQIKFDSVNAQ------AAA
A0A4Y8P842      APLPSS--------EKL---AEIVQN-NLHVLPVRGTR-LIRICYDSPNSF------GAM
B3DZK9          GPLPSS--------EKL---SEIVQN-NLHILPVRGTR-LIRICYDSPNSF------GAM
A0A4R7S1J2      PSAEDAL-------PQA---VGILSG-ALKAAPRVGTR-LLDITATHGDPI------VAR
A0A2A2XV69      GK------------EQT---IFRLRK-MIDVREIRNTE-LIQISVLDQDRN------EAS
A0A651H7X9      --------------VTP---IEIIGQ-NRRIMPLRLSL-VISVQYRHRDPV------LAA
A0A5E6MPC4      NLEEEPYI------SPV---AGLLVG-NLRIEPVRNTR-LVKIRCESPSAF------GAA
A0A840V0I7      PDEEGADEVPLP--DKL---WKKISL-WVEVSPKRDTR-LLDVTVTHQSPE------VAQ
A0A146G2Q9      --------------EQA---YFRLVR-MINIQEIRNTE-LIHITVFSTDNK------EAM
A0A2T6D3Y2      --------------EQA---YFRLVR-MINIQEIRNTE-LIHITVYSTDNK------EAM
A0A6N6PKP9      GIDSE---------SRL---QAIVGG-KISVKIRVGTR-LIDITVEDENPA------LAQ
A0A6N6Z250      GTLDRE--------QTY---LYLTRK-MLQVEDRPNTS-VLDIGVWAPDRE------LSA
A0A4V1SB02      GQAGTDID------SVI---VDTLNS-KLKVTLRRNTR-LIDIVAEENSPK------KAQ
A0A6N6QEJ2      EINI----------QQT---YEVLSR-AVEVRQRRNTS-IIEISAYDQDAA------LAA
A0A3C1VB86      SKTVTR--------ENI---ISQFEK-NVKTSLRRNTR-LIDITVRNTDPG------LAA
A0A6N6P5E3      --------------DIA---YLKLRS-MLTVSEVRNTD-LIQISVLDQDRQ------EAA
A0A838I246      SR------------EQA---YQRLRS-KLDVQEVRNTD-LLQISVFSTDPQ------EAS
A0A6J4HTK1      SR------------EQA---YNRLRS-KLDVDEVRNTD-LLQISMYSTDPQ------EAA
A0A838FVV7      SR------------EQA---YQRLRN-KLDVDEVRNTQ-LLQISVFNTDPQ------EAA
A0A7C3HWX0      NEPIRPDEAR----QLT---YQLLRR-NMDVRQTRNSS-LVEIRVFSRSPA------EAA
A0A7V4LSC4      GEALLPTQAL----QLT---YLMLRR-NLDVRQTRNSS-LIEIRVYSREPS------EAA
A0A2D5VY59      QPLTL---------NEA---FNVLKK-SIEVDQYRNTS-LIEITAYSQDKE------EAA
A0A2D8UZZ4      QPLTL---------NEA---FNVLKK-SIEVDQYRNTS-LIEITAYSQDKE------EAA
A0A353DV86      QPLTL---------NEA---FNVLKK-SIEVDQYRNTS-LIEITAYSQDKE------EAA
A0A2E5EPT8      EFTP----------QKT---KLLLEK-RIDPTQVRNTS-IIALTVYSEDKK------EAA
A0A5B5WZ91      --------------ELA---ATNLAG-MIKVSPRRATD-LVDVIVSGPDPK------LVQ
A0A2N8HD92      --------------EKA---ASNLAG-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A2N8HIT2      --------------EMA---ASNLAG-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A354EBD3      --------------EMA---ATNLFG-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A355VEB2      --------------EMA---ATNLFG-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
R6K1U5          --------------EMA---ATNLFG-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A2N8IWC2      --------------EMA---ATNLAD-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A2N8I441      --------------EMA---ATNLAD-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A2N8I3A6      --------------EMA---ATNLAD-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A410SCC4      --------------EMA---ATNLAD-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A3R5VEW0      --------------EMA---ATNLAD-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A7T9B0I0      --------------EMA---ATNLAG-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
B2UKW3          --------------EMA---ATNLAG-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A411SSG2      --------------EMA---ATNLAG-MIKVAPVRATD-LVDVIVSGPDPK------LVQ
A0A6M1RXR2      GEPLKM--------TEA---LMLLRS-RMDLSPRRNTS-IIEIRVISEDPQ------EAA
A0A7C3DXS4      GEPLKM--------QEA---LMLLRS-RMDLRPRRNTS-IIEIRVVSEDAQ------EAA
A0A7V6YXH8      GVPLKR--------HVA---MDVLEK-SMDVRQKRNTS-IIEILVYSDTPE------EAA
A0A2V2SDV4      GAPLQS--------TDT---MKLLQA-RMGLQPVRNTS-LIEIRVTTDKPE------EAA
A0A6N6PHJ5      GQKFKT--------QES---VGILKS-RLNLRPRRNTA-LIDVQVFSENPT------DAS
A0A7Y4QKN3      GQPLKP--------QET---MRLIRG-MLGLRPARNTT-IIDISVRNQNAK------EAA
A0A2V5PK75      GVKLKT--------PDT---IVMLKG-RMDLRPVRNTK-FIEIVVYSENKD------EAA
A0A1V6DME1      GERLKT--------QET---MTLLRN-RMDLNPVRNTS-LITIRVFSQDAE------EAA
A0A3D3DIJ3      GERLRT--------PET---IALLKQ-RIDLRTVRGTS-LIEIVVYSEKPE------EAA
A0A7X7VJR5      GERLRT--------PET---IALLKQ-RIDLRTVRGTS-LIEIVVYSEKPE------EAA
A0A6I1K583      GQSK----------FKA---YQVLIK-LIDPRQVRNTS-IIEINVYSKDKA------EAA
A0A350EWA4      EVNLKP--------EEA---YMLLKG-DLSVSQMRNTE-LIEITVFNENKA------MAR
A0A832D3W5      GPLSM---------DKT---LELLRK-RLSVRPSRQAS-TIEIRVFSEDKN------EAA
A0A7V2G542      LPK-----------QAA---YGRLLS-MLNLRDVRNTN-LIEVSITSTDPQ------EAA
A0A7C4KPD7      QVPYRM--------DET---RLLLRR-MVDLNLYRNTT-IIEIRVESQKPE------EAA
A0A832MGU4      DTPYRM--------DIA---FLKLSR-MLRLNQYRNTS-IIEINVFSHDPQ------EAA
A0A1M6RLZ4      --------------QEV---VSIMTK-SLNTNQERGTD-LVEIAFVHSNRE------DVK
A0A832M6Y9      PLTDD---------QTY---VMLRKQ-YLTVQPYRNTK-LIEIMAYSTDPD------EAA
A0A832HP42      GDKSQGSNAPPYDLQET---YKILRR-NLDVRLSRNTS-LIEIRAYDRKRE------IAA
A0A354T7G8      --------------QAA---LAKLRA-NLETQSMLRSD-FVSIDYYDQDSQ------LAA
A0A512MBZ2      --------------QAA---LGKLQG-NLNAQSMPRSD-FVIIEFYDQDAA------LAA
A0A2E8MEZ0      --------------DSA---IKTLEN-VVETIPIRGTD-FIEITVTHANPE------DAK
A0A7Y2T9S5      --------------SDV---LKILKG-IVKTSQRRGTD-LIEISVRHRKKE------EAQ
A0A851GRQ2      --------------KTV---IALLKG-MIKTSQRRGTD-LIEISVRHRKKD------DAK
A0A6B3LBV6      --------------NQA---IAKLRD-SVETENRRGTD-IVEIRVRDTDAD------LAA
A0A840UX61      --------------EEV---RQSLAG-MIDAENIRGTE-LIKIKVRASNPR------DAR
A0A4Q2YKS3      --------------QIV---AELKYK-IITTQNIRGTD-LISIKVRHVNKE------DAR
A0A6N6P3T8      --------------ETV---FNILTS-IVRTDNIRGTD-LITISVRHSDKD------EAR
A0A8A7W668      --------------ETV---LRILKG-IVNTQNIRGTD-LISITVRHTSKE------DAR
A0A2E3EC33      --------------EDA---FXILKK-KVETQXVRGTD-LIDIEVYDTDAQ------LAA
A0A2E4GN01      --------------DDA---FRXLKK-KVETQDVRGTD-LIDIEVFDTDAQ------LAA
A0A800JJX7      --------------DDA---FRILKK-KVETQDVRGTD-LIDIEVFDTDAQ------LAA
A0A1Z8XU55      --------------EDA---YRILKX-KVETQDVRGTD-LIDIEIYDTDPK------LAA
A0A2E1RQR9      --------------EDA---YRILKK-KVETQDVRGTD-LIDIEIYDTDPK------LAA
A0A2E3ISQ4      --------------EDA---YQILKR-KVETQDVRGTD-LIEIEVYDTDPN------LAA
A0A2D6W6F4      --------------EDA---YRILKR-KVETQDVRGTD-LIDIEVYDTDPN------LAA
A0A2D8Z5A8      --------------EDA---YRILKR-KVETQDVRGTD-LIDIEVYDTDPN------LAA
                                                                            

A0A2A2XVF1      DLAASFVKEFLRENFSQRLSVSRVATDFLQEESQKLKKKLEESEIKLQRYKEQNQAVSLE
A0A2V5UHJ2      RLANAHASSYVRYGIDLRSQTNSEASEFLQEKLTELKERVQQSEAALNSYRKEKGIISVD
A0A2V5PST3      KLADAHIKAFIRMNLEGRFQLTKEARDFLDIKNAELKARLERAEAELNRFRQTHGVVSIE
A0A2V5PXM3      LIANSL-------------------LNFLRNEEKRLKVKLEQSERAMQEYKEQTKSVSLE
A0A1V5QB01      DMANALADEYLDFKAEERLNTSQATVVSLTQQANRVHEELKRAEERALEFARQNSVIAIQ
A0A800JGC6      QIANGILEASKKNVENKINEETNVNVKMANQMVSGAEKEILELGERLSLYNA--------
A0A7Y2T8X5      TIADAIMEQYLATEEERKSGGATEAFKILRAEANAAAQELETARRSIESYKS--------
A0A1J4XH17      KVANMFAEEYINYNMTLNIDGSMKAIFDLKERAKEQQKVVENIETQMAEYREKYGTVSLE
A0A7C5LI63      DFANALAQEYLLFRDEERARSAESALLMLTREVNRLSQEVKAAQDRYLTYAKEHNLPVLQ
A0A7C5P291      DFANALAEEYFRFREEQRAASSESALLMLTREINRLSQELKSANDKLLNYAKEHNMAMLE
A0A290QGD9      DIANMFVDEFIAYNSRVRIDESMKAVDELRARVNDQRKKVEELATRLQTYRETHKMVSLD
A0A1D8AS58      KVANLFIDEYIAYNSRLRIEDSMKAVDDLKERADQQKKRVEEMAIILQNYREKNQQVSLD
I6AQC1          KVANLFLEEFVQFNTRQRVDQTFGILEDLKLRAESQRKTVEDLNRQMQAYREKYNMGSLD
W0ITH7          KVANLFLEEFVQFNTRQRVDETFGILEDLKLRAESQKKKVEDLNRQMQAYREKYNMGSLD
A0A139SU05      ILAQRHVDQFLSYLLENISGVNDTAVDFLRERAEQLRLESEAKAQRQQEYMQRHNLISLD
A0A139SPN4      ILAQRHVDQFLSYLLDNISGVNDTALDFLHERAEQLRLESEAKAQKQQEYMEKNNLISLD
A0A1V6E7N1      LIANRYIDQFMQQIMDSTMGKNEYATDFLRKRSDDLRKESEAAALQVQRFMEVHKLVSLD
A0A2D9MYT1      LIANTVISKFLEQDNNRKRGKLANAVDFLREEATNLSTAVHTNYMALHNFKLEWDIISLE
A0A258ANJ7      ALSNQAVLSLVSELESQKSKTLQGAIQALVAEGQRLQDKLKKSEIAMHDYKRSNQAISLD
A0A1Z8ZMT6      VIANQIIQQFINIREGVNEEGKKSDLQHLLTAAKERESELETARRRAGTYTP--------
A0A2E8MCT7      VIANQIVKQFINIREGVNEEGKKSDLQHLLAAAKERESELETARRRAGSYTP--------
A0A139TLN4      NVLHNLVRFYNEASLDEKKKRGMNTDKFIEERLGVINEEMGENDLAIENLKKESNILTDL
A0A1G3ZFT0      RVVNEIAKVTQHKNTEKKSLEASKILSFLSKQLPLAKQDLTRAELALNRYHTTSGKIDTK
A0A5B5WI95      DVLNQLIAVYNQVSIDEKKLAAQKTKKFIEGRLEELEKSLNKAGKELTDFKTKNDIAGNA
A0A2N8I9W1      DVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDT
A0A4Q5IH27      DVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDT
A0A2N8IBZ6      DVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDT
A0A7G6DX28      DVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDT
R6J100          DVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDT
A0A139TV24      DTLNKLIEIYNEHSREERRAIAVKTKEFIRRQLEQIGEELKRLDSERDDIKFENDIIADT
A0A2N8HT11      DTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDIKIKNDIIADT
R7DS70          DTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDIKIKNDIIADT
A0A2N8HNL6      DTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDIKIKNDIIADT
A0A290Q2Z2      AIANEIARVYSDDRIMFATSEQREGLTQLRKELESQERTVSLQRDMVEQLRKDLGISGVD
A0A2A2RGK2      KLANAYADEYIRYVFEKRSDAAKSATQFLVEEADRLRKKLRVSEEAMQSFRERERAASIE
A0A2A2XXF7      KLANAYCDEYIRYVFERRSDASKSATQFLLEEADRLRKKMRVSEEAMQSFRERERAASIE
A0A146GCJ0      KIAATFVKEFFRENFDQKLALSRVANEFLQDEADKLKVKLEASERKLQAYREDNKAVSLE
A0A2T6D6H8      KIAFSIVREFLRENFDQKLALSRVANEFLQEESEKLKAKLETSERKLQAYREQNKAVSLE
A0A6B3L938      TIANAVMMVYIEGEQARRAGGSSDAFRILKAEADDVALELESAERSFHVYRA--------
A0A2A2R5D6      DIANAIMDVYIEMRRADLQTRESRGFKTLDDEIAKQGEVVQRAKDYVEELRKSLNLNMVG
A0A2V5URB2      SVANAHAIAYVRQGLKLGSQANEEARKFLETKLAELKDRVQKSEEALNHFRRAKGIISLN
A0A2V2DJ66      RIADLFVNEYITYTRMTRVQTLLDSIEELRTKVAQQETKVKELDRRLVEYREKNGAISLD
R7L5A9          RIANLFATEFINYTHQKRVQALMGSIDELRTKVSQQEAKVKELDKKLVEYREKNGAVSLD
A0A5B5WU87      VILHSIVHFYNEASLKEKNTRGTKTNKFIGERLAVISEEMRKNDLAVEKLKKETNILTDL
R7DZW0          DILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDLKKETDVLTDL
A0A2N8HID1      DILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDLKKETDVLTDL
A0A2N8HS06      DILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDLKKETDVLTDL
A0A6N2TNT9      DILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDLKKETDVLTDL
A0A4P5QM05      VIANTIAVTYRDKRIEELRKNTDQTLKEMKDELKTKEDEMARLFQEASRIRQDESISDPD
A0A4Q3C001      NIANTIAVVYQNKRLEEQQGNVDRSLAQFRDEVEKQRKVVEDAAVLAAKIRQEDGIVDPD
B4DB23          NIANAIAVVYQEERQHELDKNVARGLEQLKDEVDRRRKEMEDTSAVAMQIRAREGIVDSD
A0A5R8KA81      KIAGMLIEESIGQNIESRANAGTLANEFLAAESKRLAKALADSELALQNYKDERQAVSLE
A0A2E6T482      KIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRMEEINKKITGLQGNVDRMRTELGISDA-
A0A3C0DQZ7      KIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRMEEINKKITGLQGNVDRMRTELGISDA-
A0A1Z9CBK5      EIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMTTINEEIGAMQANVDXLRVQLGISDA-
A0A2D6ZI96      EIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMTTINEEIGAMQANVDXLRVQLGISDA-
A0A358KGZ3      QIAQALAKEYENYRSSLQEERVKAGIDKLRERMEKTNDEITAMQANVDDLRAKLGISDA-
A0A2E9ZQX4      QIAQALAKEYENYRSSLQEERVKAGIDKLRERMKKTNDEITAMQANVDDLRAKLGISDA-
A0A3D5JZU0      QIAQALAKEYENYRSSLQEERVKAGIDKLRERMEKTNDEITAMQANVDDLRAKLGISDA-
A0A2E6HCR0      EIAQALAEQYKNYRSNLQKRRVEAGINKLKERMEKTDEEISVMQAKVDDLRVKLGISDA-
A0A1Z8WN04      EIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNEISLMQAKVDSLRVTLGISDA-
A0A2D7L1N4      EIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNEISLMQAKVDSLRVTLGISDA-
A0A2E2R937      EIAQALAEEYKKYRSNLQKXRVEAGINXLKERMEKTNNEISLMQAXVDSLRVTLGISDA-
A0A520QQY4      EIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNEISLMQAKVDSLRVTLGISDA-
A0A2D5MR66      EIAQALAEEYKNYRSKLQKGRVEAGIGKLKERMEKTNDEISVMQAKVDALRVKLGISDA-
A0A2E0PDQ1      EIAQALAEEYKKYRSNLQKRRVEAGINKLKERMEKTNEEISLMQAKVDSLRVKLGISDA-
A0A2E2ZZP9      EIAQALAEEYKKYRSNLQKRRVEAGINKLKERMEKTNEEISLMQAKVDSLRVKLGISDA-
A0A4P5YMI6      EIAQKIAEVYRDNRLNAKRSMSAGGIKKLQEKLETHEKNIREKQKVVEAIRKDTGITLIT
A0A7C4LRK7      EIANEIANAYKEYRQETRMEVARSGVKTLQDEYAEKEKEYQKSMDEVKRLREELQVYDID
A0A3C1VJ32      DLANSIAEAYRTYRIQTSQQQATTGLEVYQTQYLEESNRIEMLQANVDNLRRTLDINNGT
A0A7W1VTI1      EIANAVAHAYRESRLGQRRDFKFGGIKILQEQLDGKEEEVRKAKAIVDELRRGNNIVELG
A0A7V4IGZ6      EIANAVAEAYQAHRLEQFRSATERGIKALESKFNEHSDKVSAMAKELEDLKKKYSISEAD
A0A2N9NTX7      KLANEIAEAYQAHRLEERAELTTGGIKSLEERWKEQEASVGKAQSNVDYLRDKLKISDPN
B9XK55          AIANEVAIVYQKYRLDQKLDITGAGIKVFKQQVQEQDDLIAKQEAKVDKLRKDLKVTDL-
A0A2A2RGF2      EIANKIAEIYKENREAQRKLQAEKGLKILRDRLADQDALVRTALTNVNQIHQDKGLNVI-
A0A2G4I5Y6      EIANKIAEIYKENRESQRKLQAEKGIKILRARLLDQDALVRTALTNVNQIHQDKGLNVI-
A0A6N6PS97      AIANKVAEIYQRVRLENRKSSTQRGIDALKLEFTERSKTVEKLQQKVDGLRKDLGVSDV-
A0A3M1I883      DLANLIAASYKNWRQHSRREHMTNAIAVLQQKLEEQNARVERLQKQLDQLRLELNIPDTV
A0A1V6JZ45      AIANEVANVYKESRVEEKQRQTSAGISKLRAKLDEQAEAVAKLQDNVDQLRAELNIPDS-
A0A848A4B3      AIANEVANVYKESRVEEKQRQTSAGISKLRAKLDEQAEAVAKLQDNVDQLRAELNIPDS-
A0A7C7Z746      ELAQLIADEYKDLRKITRTHLIEGALIKLREELTIIENQIDSQQTAVDQLRDELKITDV-
A0A520RRW5      LIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNKVQTKQKDLDKLREDLNISDIY
A0A356NPK0      LIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNKVQTKQKDLDKLREDLNISDIY
A0A2D7B5P5      LIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLXQQNKVQTKQKDLDKLREDLNISDIY
A0A3D3XGB5      LIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNKVQTKQKDLDKLREDLNISDIY
A0A2V6F8A1      EIANQIATVYRDTQLGLKQEMSQKGIEVLRKELSQNDEKIKEAEAKVDELRKEYSISDI-
A0A2V5TNH4      EIANEIANVYRDTRLELKQEMSRKGIQVLREELQQNEEKVKAAEAEVDQLGKEYKVSNG-
A0A2V5X5Q6      KIANEIANVYRDTRLELKQEMSRKGIKVLKQELEQNDEKVKAAEIAVDQLRKEYKISDI-
A0A3R5R2M8      DVLNHLIEVYNQISIDEKKQSALKTRKFIEGRLAELEKSLNKADKELTDFKAKSDIVKDT
A0A411SUQ6      DTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEFKTKSDIVKDA
A0A2N8HZF2      DTLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDT
A0A354E720      DTLNHLIQVYNQISKDERNKASLKTKIFIRDRLQELGASLSDVDKKLTEFKTKSDIVKDT
A0A7T8XNA1      DTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEFKTKSDIVKDA
B2UPB6          DTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEFKTKSDIVKDA
A0A1Q6UHJ9      TIANLFAQEYLNYTHHTRVQKILDSIDELRIKVSQQEAKVKELDKRLVEYREQYKAISLE
A0A2V2BXR0      TIANLFAQEYLNYTHHTRVQKILDSIDELRIKVSQQEAKVKELDKRLVEYREQYKAISLE
A0A3C1HEJ2      QIANSLAREFLQRRFEQQISASESATSFYRQKEQELLETIKTLESLLQEFKKNHPGISEE
A0A522ULD9      LVANEIAKVYREHRLSEKRSQMMRGMEALEGEIEKQQDKVNKAEEDLEHIRKDLGVSSVG
A0A7W1RNH4      ATLNSLGRTYMGRRQNVGTTEARERVKFLQGQIATLSGQLTASEDQLEDFRTKGSVVDPK
A0A2D8V0G3      AIANKLMQNFLTRNLDKKKQRAFESYKWLQNEVNQLADDVRATRLSVFQFREDNQMPSLE
A0A348S017      QISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLE
A0A3C1UUV7      QISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLE
A0A350I3V2      QMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLE
A0A520RGV5      QMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLE
A0A3D3XF90      QISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLE
A0A2D7B522      QMSNKLLDNFLARNLDQKRERAFQSYQWXDTEVDGLQEEVKNSRLAVFRFREKNKMPSLE
A0A356NIC2      QMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLE
A0A832MDW4      DIANTLVEEFIEQNAVLKQKRTLDTLFFLKAQANSLEKDVQEAEEKLHNYRTQVKFVSLD
A0A1V6JU76      GIANALVEEFIEQNLVQKQKRTMDMLFFLRSQANGLEVDVAKAEEDIQNYRAQVKFVSLD
A0A848ABG7      GIANALVEEFIEQNLVQKQKRTMDMLFFLRSQANGLEVDVAKAEEDIQNYRAQVKFVSLD
A0A2A2XXW5      RIADTILQVFLQQNLDDKKSKALQGLKILEQEATGKEVELEALQGKLQKYRKDKGMVSLK
A0A6N6Q6V0      DMADTLLDIFLEDNQTRKSLKAMSGYRALKVEAQAQEADLTRAIQNLAEYRVRQGALSLD
A0A2V6JLK8      DIANKIVSVYQDRRVEEEKEILNRAVTAMNEEVGKQQKRVEEAGAEMAKIRDEEHIVDLN
A0A2W5Z1A5      DIVNKIIAVYQDKRVEEEKDILNRAVGSMNEEVDKQQKKVDDAAVEVARIRDTEHIIDLN
A0A2V6EA09      DIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVAREQKAVSDAAAEVARIRDQEHIIDLN
A0A2V6GQI7      DIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVAREQKAVSDAAAEVARIRDQEHIIDLN
A0A7W1U7K0      DIANKIVAVYQEKRVQEEKEILNRAVATMNEEVAKEEKKVQESGAEVSRIRDAEHIVDLN
A0A7W0YDK6      DIANKIVAVYQVKRVQEEKEILNRAVETMNEEVTKQTRKVEEAAKEVARIRDEEHIIDLN
A0A7V9EPY1      DIANKIVAVYQEKKIQEEREILNRAVATMNEEVAKQDRRVEEAANEVARIRDEEHIIDLN
A0A838TCM2      DIANKIVAVYQVKRVQEEREILNRAVETMNEEVAKEDRRVEEAAKEVSRIRDEEHIVDLN
A0A2N8HDG3      DTLNKLIAVYNDHSTAERRTTAVKTKDFIREQRAQVGADLKQVDQKMDDIKIKNDIIADT
A0A3E1ET42      AIANEVREAYDAQRQEIEAERIRRLTQTLDAKIKSSENDLEAARIVMNEVARKHGIV---
A0A2A2YDW8      DIAVEVYEAYKARRVQEETDLSENASKQLEQAVLEHSDVVEEKRKQRDNLQRRAPSVVR-
A0A352XLN9      DIAVEVYEAYKARRVQEETDLSENASKQLEQAVLEHSDVVEEKRKQRDNLQRRAPSVVR-
A0A3D0YP62      RIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQNKSDRVAELRKRLMDIAEKVGVIWV-
A0A3D3DV47      RIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQNKSDRVAELRKRLMDIAEKVGVIWV-
A0A7Y1UNY2      DIAEKVAEAYKERRTSMEMDRAHRALNALDTELRDQEDLVEEKRKVLDTIVQAVGIPYF-
A0A2E5XJ49      LIAQEIAKSYQLVRNADERARAGEALDALEAEVRSQEDLVEDKRRHFHTIVKAVGVPYI-
A0A2E6SBY8      LVAREIAKSYQLVRNSDERARASEALDALEAEVRSQEXLVEDKRRHFHAIVKAVGVPYI-
A0A2E5QMS4      DVAKEIAESYQXGRNADERNRAGEALDALEAEVRSQEDLVEDKRRHFHSIVKAVGIPYI-
A0A2E7YXQ3      DVAKEIAESYQLGRNADERNRAGEALDALEAEVRSQEDLVEDKRRHFHSIVKAVGIPYI-
A0A2E3H787      DIAKEIAESYQLGRNADERKRAEEALDALESEVRSQEDLVEDRRRHFHAIVKAVGIPYI-
A0A2E7AGN1      AVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A2E7AKY7      AVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A3D4CU34      AVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A2E8M146      NIAKAIAESYKEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHAIVKAVGIPYI-
A0A355S8S2      NIAKAIAESYKEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHAIVKAVGIPYI-
A0A2D6DVN8      DIAKAIAKSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A3C1W2R2      DIAKAIAKSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A2E3NAY6      DIAKAIAESYQEGRNEDERKRAGDALDALEAEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A2E3II01      DIAKAIAESYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A368B8C5      DIAKAIADSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A3R7RBB5      DIAKAIADSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYI-
A0A2A2QX62      AIASAVSEAYRERRTALQSEVASQAMDQLGKAVVQQKDLVEDKRKLLSQIIRQEGIIYQG
A0A4Q3BWH6      KIAKEVAEAYRERRRKLQGDHANQTLDELRKAVLVQEDLVEDKRKLLSQIIRTENIIYWG
A0A858RHU7      AIAKAVSEAYRERRTKQQSEFAVQAMEQLRRAVQQQEDAVEDKRKLLSQIIRQEKIIYQG
A0A7V7VLV5      DIAAEVARAYKEYRSETENKEGDLALLELKKAVRAQEDTVEERRKVLANIVRAKGIIYYG
A0A3N5WCF1      DIAEEVARAYKEYRAEIETRDADRQLQELNKAVRDQEDKVEERRKVLATIVRNKGIIYRG
A0A4Q3C1K5      NVTDEVAKAYRDYRLEIENRDADKALYELNKAVRDQEDKVEERRKVLATIVRTKGIIYKG
A0A3D1TI55      AIANKIAEVFQETRLASVKKKYSDALVQMQEEMDQQKFKVRELEDNVEDLRLQNQIVFGA
A0A3R8IT45      KVANLFLEEFITFTSRQRIDQTFTILEDLKLRAETQKKKVEELQFQMQAYREKYGL-TLD
A0A2A2PYE8      KVANLFAEAYLDHNISLRTQESNNAVEGLKGTVEEQQKRVERMARELQEYKEKNNMVSLD
A0A2T6CN73      KVANHFARAYIDYNTQLRISEGVKAVEDLKGPVETQRKLVERLASELQRYKEQHKMVSLD
A0A2G4G428      QVTTLFCKAIQKNSEDERLVITNPLVEKYRMDIDSVEDKIRKLYDKRNELIKGQKLLSIA
A0A6N6PCD8      KVARTLVEEYTKGYFEQNAKSATAANDFLRKQAAELKERLAKSEQTLQEYREKHGTVFND
A0A139TUL1      DVLNYLIEVYNDHSRREKQIASTRAEDFIVKRIEKLGGQLGGVDKQVIDYKRHSRIVKDM
A0A2N8HCB0      DALNYLIEVYNDHSRREKQLAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDM
A0A2N8HP04      DALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDM
A0A2N8HRJ0      DALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDM
A0A6N2U9Y7      DALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDM
A0A6N6PAZ1      AFADAVAREYLAEIANARSAGRSNSIDLLEKESKEARSSIQAARGALSLYAR--------
A0A7V7VK26      ALADAVAREYLAEIANARTADRSNSIDLLEKESKEARRSIQAARGALSLYAR--------
A0A6I1K459      TLAQAVVEEYIKQNSEDRTGVGQNAGQFLMAEEMRIKERLLKAERSVQQYLATNNISLQQ
D5ENH7          DIANLFADEFINYKLTENIDASMVAVEGLRIRADRQKERVEELELELAEYREEHNAVSLD
A0A0R2XQ77      RVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEYREDNNAVSLD
A0A2E9IN28      EVANLFAKEFIDYNLKLNIDGSMKAVEDLRIRADQQKERVEELELKLAEYREENNAVSLQ
A0A6N4WTJ5      RVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQQKERVEELELKLAEYREDNNAVSLD
A0A366HAG0      LIANTIADSYKETRLETDNARINKAIEGLNIQIAAKELQAKQSMERMIQLKKDLDLVTLP
A0A2U8DZK4      AIANEIVGVYTEDRINLATAAQKADLAELNNQLAAQEKIVIAQRDTVERLRAELSISGID
A0A2T6DFL8      DIANEVARTYSADRIALATSDQSEGMAQLRQELLKQEQAVTRQRDAVEKLRKELNISGVD
A0A1D8AWD4      DIANAIARVYAEDRITLATSDQREGLAQLRKELDKQELAVTTQRDHVEKLRKELDIAGVD
A0A4Q1C9S2      EIANAIARVYAEDRIALATADQREGLAQLRKELVKQEQAVTDQRDHVEKLRKELDIAGVD
A0A178IH18      AIANEIARAYSEDRIAFATAEQRAGLDQLRRELAGQERAVATQRDLVEKLRAQLNISGVN
A0A2T6DT99      AIANEIGTAYSADRIDFATSQQREGLAQLRKELEKQEKVVTSQRDLVEKLRKDLNISGVD
A0A1G3ZT33      RIANEIARVYSENRINFATAGQREGMTELKKQLAAQEEVVSKQRDLVEKLRRDLNISGVD
A0A3E1E2T2      VIANEIARVYSDDRINLATSDQREGFVKLRGELIAQEQVVMLQRDTVERIRKDLNISGVD
B1ZMW1          AIANEIARVYSDDRIALATSEQREGLAHLRKELEAQEQVVSAQRDTVERLRKDLNISGVD
A0A3M1I8A3      DIVDRLANEFIERNRLLKTGRMMSTLQVLRSQAQQMEREVTELEEAVQQYREKQNFVSFD
A0A4V0XS84      KIVNTLVSIFMKQNTDDQSSKSQETFKLLTDEAKSMKVKVDRDEEAVHKFKEGHQVVSFD
A0A351WE84      RIANEMAAVYREQRLDVKRSELRRAIEVLDNEVQKQQEKVDQAESELERIRQEVGVSFLG
A0A7W1MRT6      QVANAIVAAYKEVNASIAQQQSRRRREFIQEQLKQTDSSFADATVSLSNFRSHEQVYGSD
A0A7W1YXK2      ELAQSFIEEFTRQGYEQRINVAREANGFLVQEAERLKVKLETSERELQTYREANNAVSLE
A0A2D5WGA5      DIAQALAEEYKNHRTSLQKERVKTGIDTLTNRMEKINIEITGMQGRVDRLRTDLGISDAA
A0A2E7SSH2      EIAQALAEAYEEYRQSLQQKRVQAGIDKLKERMEKTNEEISSMQSNVDALRAKLGISDAA
A0A832HNU4      LVANGVVQEFIRQNVAQKMSASTEALNWLREQLDEIKPRLEKSEAALQDYREKLQAISLE
A0A1V5QDZ6      RIANSIAQVYHDQRLSMKRRELKRAIEALEGELAKQQEKVEKSEEELERIRKDLGVSVLS
A0A4Y8P964      QIANAYAEAFIAFGLDRKLEANQHARQFLAKQLDSMRKKLALAEERLANFTEQTGIVKFP
A0A3D4HF88      HVANLFADEYINYNLRLTIENSMKAVEDLKLRVNQQRSEVEALETRLAEYKERTGSISVE
A0A1V6J089      AIANEIANVYRERRLADKRREIQHAIDAMSNEVRKQQERVEEAEAELERIRQERGIALIG
A0A3C1BZR1      EIANEVANVYRDRRLLAKRREIQRAIDAMSNEVRKQQERVEEAESELERIRQERGISLIG
A0A848WTQ6      ELANAVAQSYADGRLEEEQKRINKALTALESELAKQRERVSVSRSAMLKLMRDGNIIDLA
A0A6N6ZHN8      EVSNLFAEEFIDFNRTKAIEGNLRATEGLRDEAAKQSERIKDIERRLADFKQKNGTISVD
A0A6G6K641      KLADGVAEEYLRFTIETRNRSNQMANQMLMEEATRLKEKVSRSQLALQEFRERTGLVSLE
A0A849Y642      EIANAVAQAYEKYRLDEKYNEVNRGLQKIEEEYARQKEEVRAAREKVEQLRKELNITDLG
A0A7C4KLL2      DIANSLAEQYMAYDIQTVSATTKGAYSYLRDETERLKKKLEESERNLQKYREEAGIVSLQ
A0A1H6KPB7      LICDAVTECYKEGREAQENEVLDKAIATIQEELTRRENELLAKTDTLRKYMTTSDYIGLL
A0A2E9ISN4      AYLVEMIQGYRSLRMEELMEVNQSALLGLKNEETRVLEDLEQAKQDLETFERENQILFEK
B9XAX1          KLANAVAQEFILESLDQRFSNTKAANELLYAEAGKLKQKVEMSERNLQAYKESNKTVSLE
A0A5R8KKM9      DIANAVAESYRETRIQVDRDLADNSIKEFNIQVAAKEQLAQQARNKMFAVKKDLGIIELP
A0A7W8DJ38      SLSNQAVLSLVAELESQKSKTMQSAVQSLVSEGQRLQEKLKKSELAMHDYKRSNQAISLD
A0A7W1ZQ43      MLANSVSQEFIRQNLYDQFSTSKAANGLLHEEAMKLKAKLEESEQEIQTYREATQTISIE
A0A139TS01      NIAKAVPEAYKQDREMRENRLVETAIKSLQDVLREQEDIVNDKMMALKKLIVENDYLPST
A0A3E1EJT7      RVANLIAVEYIAYNSRLRVEESLKAVDDLKDRADQQRKRVDEIANSLLAFRQRGNLISLV
A0A848WYP9      DMALAFVEEFELTLVQQNIESAQRAKKMLETEAGNQLKRVEIAEDALQKFREENSHLRLD
A0A7C3I5X9      AIANTLATEFIDWMAGQRQERTSKMLYFLRNQASGLEGEVSQAETDLHNYRMRTKYVSLE
A0A349GXM8      AFLSLLIDEHREEWQTVQRQARNSAGGMLEQELARLDQKIRTAEDDLIEYQRLHDIARVE
A0A7V3QFN7      LLANRIAEAYRDYRVAEREKRMRRALEILKAQYEEHEAKIRKVQEELDRLRAELGITDPE
A0A4P5YP61      LLANSIFKQYVQLSYEQYVSSGLTASQFLVEEAEKLKKKMLSSEKALQTYREKVGSAAIS
A0A6B2LYM4      VVANYFAEEYIDFNRNQQIEGSLRAVDDLRSQADQQLAKIKEMEMRLADFKEKYDTLSVD
A0A6D1VXB3      QIANAYAEAFIAFGLDRKLEANQHARHFLAQQLDSMRKKLALAEEKLATFTEQTGIVKFP
I0JYY7          QIANAYAEAFIAFGLDRKLEANQHARHFLAQQLDSMRKKLALAEEKLATFTEQTGIVKFP
A0A4Y8P842      QVANAYAESFITFGLDRKLEANRHARQFLAGQIELMKKKVTESEAKLARFMEKTGIVKLP
B3DZK9          QVANAYAESFITFGLDRKLEANRHARQFLAGQIELMKKKVTESEAKLARFMEKTGIVKLP
A0A4R7S1J2      DLAVATAKGVMKWDLEQRSQSVGVANEFLMQEAERLRKKVELSEQALQKYRVENNAVSLE
A0A2A2XV69      EIANRIAEEYQRRRIGEQQGTVNRSLIQLKDEVAKQSRRVDELRAEAQRIRIENEIQDLN
A0A651H7X9      RVADLFVEEFINLNTQMRIQESLRAVEDLRDRAEQQRKVVEDLELRLQAFREDANMISLD
A0A5E6MPC4      QLANVYAQSFITFGLDRKLEANRYARKFLAGQLETLRKKVAQSEERLADFMAETGIVRVS
A0A840V0I7      ALANAIALEFNRELTGDRAEGRTSSFDILVKESEAARGRLQKAQNALAN-----------
A0A146G2Q9      EIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVEKQQAIVTKLQETMTRIRQETGIQDLN
A0A2T6D3Y2      EIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVEKQQAVVTKLQDTMTKIRQETGIQDLN
A0A6N6PKP9      KISQLVVSEFMRASSESGAQNSRGAHEFLRQEADRLKLTLAKSEQALQRYKEQNQAVSLE
A0A6N6Z250      DIANEIARVYEQNRIAFANTTQNEALGKLQEQLDLQDARVQEQRDKVEALRQELGLAGYE
A0A4V1SB02      ALANEVVNQFFLLQGSDKSGVSKDAFVALKAQEEDLRKKMAESDNALADYRQQHKAVSLD
A0A6N6QEJ2      DIANRIAEAYEQDRDLDRNDRLLRGLTTLSNALSNLEEQVRVAQTNVDHLRMFLKVPD--
A0A3C1VB86      RLANSLVKNYLGQDALVQSSVNEEAGVFLRREADRLKKKLEASDQALQDYRKQVGSVSLE
A0A6N6P5E3      DLANTIAVEYQKKRIDEQQGWVARSLVQLEDEVNKQRKKTEDLRDEMTRIRLEAKINDLN
A0A838I246      DIANKIVGVYQSTRVEEEKEIMNRAVASMNEEVAKQQKKVDDAAAEVSRIREEEGIVDLN
A0A6J4HTK1      DIANKIVAVYQDKRVDEEKEILNRAVASMNEEVGKQQKKVDESAAEVARIREAEGIIDLN
A0A838FVV7      DIANKIVAVYQDTRVDEEKEVMNRAIASMNEEVARQQKKVDDAAAEVTRIRDEEKIIDLN
A0A7C3HWX0      EIANAIAESYKGWRLTNRMEETYKGIEVLEIELGHQSNRVAELRRKLDDTRAKLSIPEGA
A0A7V4LSC4      EIANAIADTYKGWRLTNRMEETYKGIEVLESELVNQSNRVAELRRKVDDLRTRLSIPEGA
A0A2D5VY59      LIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQLREELNISDIY
A0A2D8UZZ4      LIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQLREELNISDIY
A0A353DV86      LIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQLREELNISDIY
A0A2E5EPT8      EIANTIAKVYAETREQNRITQVRKGIAKMREKLGEASNSVVQAQADVQRVREELKFDVIM
A0A5B5WZ91      NIAKAVPEAYKQDREMRENRLVETAIKSLQDVLREQEDIVNDKMMALKKLIAENDYLPST
A0A2N8HD92      NIAKTVPEAYKQDREMRENRLVETAIKSLKDVLREQEDTVNEKMMALKKLIAESSYLPTT
A0A2N8HIT2      NIAKTVPEAYKQDREMRENRLVETAIKSLKDVLREQEDTVNEKMMSLKKLIAESSYLPTT
A0A354EBD3      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A355VEB2      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
R6K1U5          NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A2N8IWC2      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A2N8I441      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A2N8I3A6      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A410SCC4      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A3R5VEW0      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A7T9B0I0      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
B2UKW3          NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A411SSG2      NIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTS
A0A6M1RXR2      DIANAVARSYERYRIEQRKKLSMGGIAVLVDRLEEHQKRIDETQRELDRLRRELQISDVD
A0A7C3DXS4      DIANAIALSYQQHRIEQRKQLSMGGIAVLVERLEEHQRRIDETQKELDRLRRELEISDVD
A0A7V6YXH8      RLANAIAETYRDHRLKLVDERAARGIEKLADQKKKHDEELAAQRLKVDQLRTSLGIVDLD
A0A2V2SDV4      KLANEIAQAYCDYRVEHRKQMTMGGVDALEKKFTEQQGKVSEAQSNVDVLRFKLQISDPV
A0A6N6PHJ5      DLANAVAETYRQWRLEKGQRLGKGGVKALEDQLKIEDEKIAKVKDELDKIRVENKISDVD
A0A7Y4QKN3      DLANWIAEAYREYRLADGRQLALGGINALEKKIAEQNAAVDKATEKLNQLRRDLKISDYE
A0A2V5PK75      RLANAIAEAYQEHRQEQREKLSQGGIDAMEKRLKEQEEKVAKKAEEVEKLREELQVPDSM
A0A1V6DME1      RIANEIAETYKEYRLAQRRELTMGGIRILEDRFQDQEKKVQAAQREVDELRAKLEISDAD
A0A3D3DIJ3      RIANAIADAYKTHRQEQRAQLSRGGIKALEERFAEQEAKVKAAQERVDNLRKELNISDAM
A0A7X7VJR5      RIANAIADAYKTHRQEQRAQLSRGGIKALEERFAEQEAKVKAAQERVDNLRKELNISDAM
A0A6I1K583      EIANKIAEVYKASRDELRLRLVDQGLKTLREKLTEHHGFVEVAKSNVNQILKDKGIIL--
A0A350EWA4      NIANEIAKVYREWRMNLSDERFQEGFDAINQQLEKAESDLKESEAEVNRLRASLEITDID
A0A832D3W5      LLANRIAEAYRDYRVAEREKRMRRALEILKAQYEEHEAKIRKVQEELDRLRAELGITDPE
A0A7V2G542      DIANTIAMVYQNRRIKDQESLYSKALSQIQDEVQKLERKVEESFSEYNRLAREAGIFDTE
A0A7C4KPD7      EIANSIAEAYRDYRQRTRLTMVSKGIETLQDELKSKEQEYSVKESNVVQLRKSLEINDID
A0A832MGU4      DIANEIANAYKEYRLEDREESAKKGLKVLEEQLAIREREFTNAQAEVDKLRKDLELNLID
A0A1M6RLZ4      MITQAIADSYREMRIEDEEKRRTEASYELEKKIQAQEDLVADHRNRLATMSQKTGIP---
A0A832M6Y9      MIANAVAQEYESYRVENIKQRTTAGLVTLKEELDKQKSEVDRAKGRVEKLRKELEID---
A0A832HP42      AIANAVAEHYKEWRLSDKKENSKRGIQVLTNKLEDINEEVKKAQARVDELRSKYNIAD--
A0A354T7G8      NIANEIAKSYMEQRNNIETEKKQKALTVLQQQISDQEELRRLAQVRSQEARRKAGIVGDW
A0A512MBZ2      DVANAVASSYMTQRIEIDSSQKREALERMQKQIAEQESLRDQARAKMLEAKKKAGIVGDW
A0A2E8MEZ0      EIAEAVSQAYIERRNSTEEGRAQEALEALNQELQDQGDLVQDYRKALTVLIQQYGIPY--
A0A7Y2T9S5      AIAKAVYEAYKERRYDLEMSVRKDQLKAIKIELQNKSDRVAELRKRLMDIAEKVGLIY--
A0A851GRQ2      IVAQAVYEAYEERRRMIERGIRDDQLKAIKGQLQNKSDRVAELRKRLMDIAEKSGIIY--
A0A6B3LBV6      QIANSLYRAYAEALDDEVNLINAQSTGDLDAQLDEQSEKVSEARIKMHNAMRELKVID--
A0A840UX61      MIAERVSKAYRLRRAELENKRSDQALAELREAVIAQEDLVEEKRRALTTLIRTERIPY--
A0A4Q2YKS3      DVATEVSEAYRQYRNDLEGQEAEKAMEELSKAVREQEDIVAERRKALSNIVREKEII---
A0A6N6P3T8      DIAAEVARAYKEYRSETENKEGDLALLELKKAVRAQEDIVEERRKVLANIVRAKGII---
A0A8A7W668      DITAEVASAYRDYRNELETKTADKGINELKKAVREQEDKVEERRKVLTTISRTKKII---
A0A2E3EC33      DIANALANAYQARRQNEEKERADTALEKLDTQIMAQMTRLEKARDMMINLMEELNIVD--
A0A2E4GN01      DLANALAXAYQXRXQNEEKXRADKALEXLXTXIXAQMTXXEXSRDMMIGLMXELNIVX--
A0A800JJX7      DIANALADAYKTRRQNEEKDRADRALEKLDTQIMSQMTRLEKSRDMMISLMEELNIVD--
A0A1Z8XU55      DIANAVADAYNIRRQEEEKNRATKALTLLDTQIKKQEGRLEAARNNMIELMEELNIVD--
A0A2E1RQR9      DIANAVADAYNIRRQEEEKNRATKALTLLDTQIKKQEGRXEAARNNMIELMEELNIVD--
A0A2E3ISQ4      DIANAVAKAYKIRRQRVEKERADTALALLDLQIQQQEKRLEDARSVMIKLMEDLNIVD--
A0A2D6W6F4      DIANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGRLEKARNNMIELMEELNIVD--
A0A2D8Z5A8      DIANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGRLEKARNNMIELMEELNIVD--
                                                                            

A0A2A2XVF1      E----------------------RQNITVERLRELSSKATEAKSERLRLESDIEQVRK-V
A0A2V5UHJ2      D----------------------KSNVIIERLLDLNKGLTAAEGDRIAWEAQVRAARG--
A0A2V5PST3      K----------------------GENIVIDRLVDLNRNLTTARAQRLEAESLNSVVQN--
A0A2V5PXM3      D----------------------RQNVVVEKLKELNQKVTEAKSLRILHETSYNQALQ--
A0A1V5QB01      E----------------------RGNVAARILGTLSSQAAQFRTQKMFLEAQQPLLSRAS
A0A800JGC6      ------------------------------------------------------------
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      Q----------------------QADIDHQELTEINKTVTDARRDFDIAQSRKNLVDQ--
A0A7C5LI63      ---------------DTAASWKQLYSLQLNSYVKLRHALELAKAKETALEK-SDTSAFIA
A0A7C5P291      ---------------RQEQVYQWKYWQIMNNLGKATVELAEAKTRKQMLDSGTDTATLLA
A0A290QGD9      Q----------------------RRDMVTETLKARNIIVTQTNARFKDAEVRWKQIQE--
A0A1D8AS58      Q----------------------RKDIVTEKLKALNAYVTQTTSRLNEAEVRWRQVQE--
I6AQC1          K----------------------TKDIQTRKLMEQGSLVTQSGARLSEATVRWQQVDE--
W0ITH7          K----------------------TKDIQTRKLMEQGSLVTQSGARLSEATVRWQQVED--
A0A139SU05      N----------------------STSIVDSRLLAVNGSLTQARLRLLEVESLAKQVDD--
A0A139SPN4      S----------------------STSIVDNRLLTINGALTAARLRLLEVESIAKQVAD--
A0A1V6E7N1      E----------------------STNLVNARLQTVSTELTRVRLARLELESQVKQIET--
A0A2D9MYT1      D----------------------SQNTTLQALLKAQTDYDAAHSRAVEAQASADEAQR--
A0A258ANJ7      E----------------------RKDLVLSKLKELGSELNQQSKERLTLETQLQACKE--
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      ST---------------------ALTEEYENSLNDKKDLRELTLEIKSIEYLKEYLEK--
A0A1G3ZFT0      ----------------------------------------------LEIKNLIQEIMV--
A0A5B5WI95      ET---------------------TISADFSSAQALEKEIFDLETQIKLAAVLADNLKK--
A0A2N8I9W1      DT---------------------TMSADFSTSQALEKEIFDLETQIKLAAILADNLKE--
A0A4Q5IH27      DT---------------------TMSADFSTSQALEKEIFDLETQIKLAAILADNLKE--
A0A2N8IBZ6      DT---------------------TMSADFSTSQALEKEIFDLETQIKLAAILADNLKE--
A0A7G6DX28      DT---------------------TMSADFSTSQALEKEIFDLETQIKLAAILADNLKE--
R6J100          DT---------------------TMSADFSTSQALEKEIFDLETQIKLAAILADNLKE--
A0A139TV24      QA---------------------SLSADFSTAQTLDNSIFELQTQIMLANDLENNLKA--
A0A2N8HT11      EA---------------------SISADFNAAQTLDNSIFELQTQMKLADGLKENLDA--
R7DS70          EA---------------------SISADFNAAQTLDNSIFELQTQMKLADGLKENLDA--
A0A2N8HNL6      EA---------------------SISADFNAAQTLDNSIFELQTQMKLADGLKENLDA--
A0A290Q2Z2      LNAR-------------------YSDMEIETLRQMQNSLIALSVDAIGRKTRYERFKS--
A0A2A2RGK2      T----------------------MLSSAQSQVGEVSNNQSLIQRRIEQIDSDLAVIRA--
A0A2A2XXF7      N----------------------MLASAQSQIAEILGVQNEIQKRIQQIESDLAVVRT--
A0A146GCJ0      E----------------------RQNIIVEKLRELNSKVTEAKSKRLQLEADIDQLKR--
A0A2T6D6H8      E----------------------RQNIIVEKLRELNTKVTEAKSKRLQLEADIEQLKR--
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      ---------------GGEN----ETQMIEEEWKRKSALLDDVRAEYLGRQVRYERLNR--
A0A2V5URB2      D----------------------KENIVVDRLADLNKRLTEAEAERIGLEAQARLIKR--
A0A2V2DJ66      Q----------------------MDDVDRRELQEMNTILTTDKRTYDAAAIQWSLLQE--
R7L5A9          T----------------------LDDVDRTELRDINAILTNDKRIFDAASTQWTLMQE--
A0A5B5WU87      ST---------------------ALTEEYENSINDKKDLRELALEIKSIEYLKQYLEE--
R7DZW0          ST---------------------ALTEEYENSLNDKKDLRELELEIKSIEYLKDYLEQ--
A0A2N8HID1      ST---------------------ALTEEYENSLNDKKDLRELELEIKSIEYLKDYLEQ--
A0A2N8HS06      ST---------------------ALTEEYENSLNDKKDLRELELEIKSIEYLKDYLEQ--
A0A6N2TNT9      ST---------------------ALTEEYENSLNDKKDLRELELEIKSIEYLKDYLEQ--
A0A4P5QM05      ----------------PDSSNAALSITAPTGIATGETQLAETRALVDRLRSQLMRVEK--
A0A4Q3C001      ----------------IENPTALISGGD-RSIVSSETAVNEARNKTEELRTKLRQIES--
B4DB23          ----------------PDKENSVISGGEGGNVLQRQQQVNEQQIKVVELERQLEMINS--
A0A5R8KA81      E----------------------KQNIVTEKLRDLNVRLTQSKTDRIRLENDREQVKT--
A0A2E6T482      --------------AGEESYS----IIEPEIVRRYESELITAKGIHTTQATLLEGLKAQS
A0A3C0DQZ7      --------------AGEESYS----IIEPEIVRRYESELITAKGIHTTQATLLEGLKAQS
A0A1Z9CBK5      --------------AGEDSYS----IVEPEIVRRYESELITAKGLYTQQATLLQGLQEQS
A0A2D6ZI96      --------------AGEDSYS----IVEPEIVRRYESELITAKGLYTQQATLLQGLQEQS
A0A358KGZ3      --------------AGEDSYS----IVEPEIVRRYESELITAKGLYTQQATLLQGLQEQS
A0A2E9ZQX4      --------------AGEDSYS----IVEPEIVRRYESELITAKGLYTQQATLLQGLQEQG
A0A3D5JZU0      --------------AGEDSYS----IVEPEIVRRYESELITAKGLYTQQATLLQGLQEQS
A0A2E6HCR0      --------------AGEDSYS----IVEPEIVRRYESELITAKGLYTQQATLLKGLKEQS
A0A1Z8WN04      --------------AGEDSYS----IVEPEIVRRYESELITAKSLYTQQATLLQGLKEQG
A0A2D7L1N4      --------------AGEDSYS----IVEPEIVRRYESELITAKSLYTQQATLLQGLKEQG
A0A2E2R937      --------------AGEDSYS----IVEPEIVRRYESELITAKSLYTQQATLLQGLKEQG
A0A520QQY4      --------------AGEDSYS----IVEPEIVRRYESELITAKSLYTQQATLLQGLKEQG
A0A2D5MR66      --------------AGEDSYS----IVEPEIVRRYESELITAKSLYTQQATLLQGLQEQS
A0A2E0PDQ1      --------------AGEDSYS----IVEPEIVRRYESELITAKSLYTQQATLLQGLQDQD
A0A2E2ZZP9      --------------AGEDSYS----IVEPEIVRRYESELITAKSLYTQQATLLQGLQDQG
A0A4P5YMI6      ---------P----EGAGAYN----TLATETLRHLDSLRNTAHLEFIEKDTRLAALRKIP
A0A7C4LRK7      ---------PY---SGRVLG-----TLEQETLRRLEAIQIEAHADFVQMEKLYSSLTNLS
A0A3C1VJ32      ---------A----SSPEPEL----TVEQLRSY--QAQKLESEQAYNVSLVQLQDLQTIQ
A0A7W1VTI1      ---------DGSIYGAISPTL----NTETLRRS--EQQRIDLLYEYNKFNDQLQQLVQLS
A0A7V4IGZ6      ---------AAG--QSLTPSMEYTVVQDLTRELNFNRSQLEADEKVL---SILKALDQEN
A0A2N9NTX7      ---------SGA--EMPGPLL----TTESLHRI--EGLRIESSAELVKMETLLSKLEELQ
B9XK55          ---------GGE--SATGPQQ----TLEPMNVMHYNTLRIDAETQYIKEEKLLSQLKQLK
A0A2A2RGF2      ----------H---EVGGSVM----SLETDTIRALESQLIEIRGLFTKKQTSVVELKKLK
A0A2G4I5Y6      ----------H---DGGGTIM----SLETDTIRSLESQLTDIRGIYIKKQTSFVELKKLK
A0A6N6PS97      ---------------GDSSQV----TLEPETMRMFERDRVNAKQMFAQTKTLHDELSGMT
A0A3M1I883      ---------AG---TAGAYSI----STERERLSTLLQALQQARSDLVYWKSKLQELERIR
A0A1V6JZ45      ---------IN---DASVYQT----SLEREKVSAMAQELTRAHSEYVYFLTKLEDLKKLD
A0A848A4B3      ---------IN---DASVYQT----SLEREKVSAMAQELTRAHSEYVYFLTKLEDLKKLD
A0A7C7Z746      ---------SI---EGIPSYA----FLEPENVKQMEGAKTRAQLEYEFAKARLNLLINKT
A0A520RRW5      ---------SA---EGSSIGM----TTEPQIVMKLEQERTVAEANLIRYETLFKELTSLT
A0A356NPK0      ---------SA---EGSSIGM----TTEPQIVMKLEQERTVAEANLIRYETLFKELTSLT
A0A2D7B5P5      ---------SA---EGSSIGM----TTEPQIVMKLEQERTVAEANLIRYETLFKELTSLT
A0A3D3XGB5      ---------SA---EGSSIGM----TTEPQIVMKLEQERTVAEANLIRYETLFKELTSLT
A0A2V6F8A1      ---------SA---EGPYAIS----TLEPQTVRSLEEQRIRAEAEFSGLAGMLNGLLQLR
A0A2V5TNH4      ---------SL---EGA--------TLEPQTVRSLEEQRIRVEAEFSGLAGLLNGLLKLR
A0A2V5X5Q6      ---------QP---EGAYAYS----TLEPQTVRSLEEQRIRVEADYSGLAGLLNGLLKLR
A0A3R5R2M8      -----------------ET----TMSADFSSSQVLEKEIFELETQIKLSSVLADNLKE--
A0A411SUQ6      -----------------DT----TMSADFSTSQALEKEIFDLETQIKLASTLADNLKE--
A0A2N8HZF2      -----------------DT----TMSADFSTSQALEKEIFDLETQIKLAAILADNLKE--
A0A354E720      -----------------DT----TMSADFSTSQALEKEIFDLETQIKLASTLADNLKE--
A0A7T8XNA1      -----------------DT----TMSADFSTSQALEKEIFDLETQIKLASTLADNLKE--
B2UPB6          -----------------DT----TMSADFSTSQALEKEIFDLETQIKLASTLADNLKE--
A0A1Q6UHJ9      ------------------N----LDDVDRNELRDINTILTSDKRAYDAASTQWNLVQE--
A0A2V2BXR0      ------------------N----LDDVDRNELRDINTILTSDKRAYDAASTQWNLVQE--
A0A3C1HEJ2      -----------------------EQAILSKQIGELNQRIAASEFNAQSLDRDLSRMTG--
A0A522ULD9      -----------------------GMQIDKMKLQAMQGDLIAARVDMLVRKSRLDQIQN--
A0A7W1RNH4      ------------------S----QGSSQVTRLVDMQAERSKIETERSALAQLLKEVNAAA
A0A2D8V0G3      ------------------E----SQNTLSQALFLASDGFQKASDEAAQAVKVVETVDNLI
A0A348S017      ------------------E----SQDTVSKALFAASQSHQLANDEAEQAQKAIDEVDKMI
A0A3C1UUV7      ------------------E----SQDTVSKALFAASQSHQLANDEAEQAQKAIDEVDKMI
A0A350I3V2      ------------------E----SQDTVSKALFAASQSHQLANDEAEQAQKAIDEVDKMI
A0A520RGV5      ------------------E----SQDTVSKALFAASQSHQLANDEAEQAQKAIDEVDKMI
A0A3D3XF90      ------------------E----SQDTVSKALFAASQSHQLANDEAEQAQKAIDEVDKMI
A0A2D7B522      ------------------E----SQDTVSKALFAASQSHQLANDEAEQAQKAIDEVDKMI
A0A356NIC2      ------------------E----SQDTVSKALFAASQSHQLANDEAEQAQKAIDEVDKMI
A0A832MDW4      ------------------E----RYNVIAEALSQAQSRYTDAKARAENAETVIVELEQ--
A0A1V6JU76      ------------------S----SYNIVAEALSQSQAQYAMAKAQAQTTQTIVEELDR--
A0A848ABG7      ------------------S----SYNIVAEALSQSQAQYAMAKAQAQTTQTIVEELDR--
A0A2A2XXW5      ------------------D----AQNIDAATMRDLKIAYETLRSTADVAKQIAQQAQE--
A0A6N6Q6V0      ------------------Q----DVNVVYLGYRQAKEVYEAQRARADAAEKLAEEAKG--
A0A2V6JLK8      -------------PEGTED----SQAPVNSIVVKQEAEVNDAETKVTTLSSKLAQIEN--
A0A2W5Z1A5      -------------PEGTED----SKTPLDTVVVKQEAEVNDVEAKVATLQSQLSQIEH--
A0A2V6EA09      -------------PEGMED----TQTAVNSIVLKQEEGVNEAEMTIEALGSRLEQIRK--
A0A2V6GQI7      -------------PEGMED----SQTAVNSIVLKQEEGVNEAEMTIEALGSRLEQIRK--
A0A7W1U7K0      -------------PEGTED----SLTAANQNVVKQEGEVNDAETSVSTLQAKLQQIEN--
A0A7W0YDK6      -------------PEGTED----SLTAANQNVVKQEAEVNDAETTVATLTAKLQQIES--
A0A7V9EPY1      -------------PEGTED----SLTAANANVVKQEGEVNDAETNVAVLTAKLQQIET--
A0A838TCM2      -------------PEGTED----SLTAANQNVVKQEGEVNDSETKVATLSAALQQIEN--
A0A2N8HDG3      -----------------EA----SISADFNAAQTLDNSIFELQTQMKLADGLKESLNA--
A0A3E1ET42      -----------DNSYQGGQGFTAVVTTKPEEYADSLRSQGVLEQQVIRLRSQLESLMK--
A0A2A2YDW8      -------------DFLTGN----AGNGYQSMQANVESQVEAAKTTLAELDSMIASIDR--
A0A352XLN9      -------------DFLTGN----AGNGYQSMQANVESQVEAAKTTLAELDSMIASIDR--
A0A3D0YP62      -----------ESERGGET----IG-GELELRQLAERQLYEAERERDQLKFQIDKLLA--
A0A3D3DV47      -----------ESERGGET----IG-GELELRQLAERQLYEAERERDQLKFQIDKLLA--
A0A7Y1UNY2      -----------EGVRGSGE----IGRSQEDIYKTAERQLYELEREKQQLDIQIKTLLK--
A0A2E5XJ49      -----------EGVFPSGR----MGQSEEEILKMAVMQQFEHEKSKRQLENQINQLVN--
A0A2E6SBY8      -----------EGVFPSGR----MGQSEEEILKMAVMQQFEHEKAKRQLENQINQLVS--
A0A2E5QMS4      -----------EGVYSSGR----MGQSEEYILKSAEMQQFGAEERKAELENQIQQLLT--
A0A2E7YXQ3      -----------EGIYSSGR----MGQSEEYILKSAEMQQFGAEERKAELENQIQQLLT--
A0A2E3H787      -----------EGIXTSGR----MGQSEENILKTAEMQQFAAEXKKXXLENQIERLLT--
A0A2E7AGN1      -----------EGVLTSGR----MGQSEETILKTAEMQQFTAEEKKGQLENQIEQLLT--
A0A2E7AKY7      -----------EGVLTSGR----MGQSEETILKTAEMQQFTAEEKKGQLENQIEQLLT--
A0A3D4CU34      -----------EGVLTSGR----MGQSEETILKTAEMQQFTAEEKKGQLENQIEQLLT--
A0A2E8M146      -----------EGVLTSGR----MGQSEEAILKSAEMQQFTAEEKKGQLENQIEQLLT--
A0A355S8S2      -----------EGVLTSGR----MGQSEEAILKSAEMQQFTAEEKKGQLENQIEQLLT--
A0A2D6DVN8      -----------EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLENQIAQLLT--
A0A3C1W2R2      -----------EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLENQIAQLLT--
A0A2E3NAY6      -----------EGVLTSGR----MGQSEETILRSAEMQQFTAEEKKGQLENQIAQLLT--
A0A2E3II01      -----------EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLENQIAQLLT--
A0A368B8C5      -----------EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLENQIAQLLT--
A0A3R7RBB5      -----------EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLENQIAQLLT--
A0A2A2QX62      -----------DSSVFQGT----SGFDKADEAETAAREYDRLDREKIQLESQIETLLK--
A0A4Q3BWH6      -----------DPSVSQGA----RGFTKADDAENAAKVYVETEQEKIQLESQIETLLK--
A0A858RHU7      -----------DQSLFQGS----GGFNEADDAENATKAFLALEQDKIQLESQIETLLK--
A0A7V7VLV5      -----------SDSYY-RN----TGMEDDNGAKSSLDTFNQLETEKMQLESMIQSLLK--
A0A3N5WCF1      -----------QDAFY-ES----GGVDEDQGARNALQIYHDIEQEKLQLESQISSLLK--
A0A4Q3C1K5      -----------QDSFY-GQ----SGVDEDQEARDAMQTYSQLQQEKMQLASQINSLLK--
A0A3D1TI55      ------------------T----GAELSKERLDQLQLELERARLDLWTAEAQLQKVES--
A0A3R8IT45      ------------------P----KKDILTKKLVEQGSVLTQTQSRLGEAEVRKNQVEA--
A0A2A2PYE8      ------------------Q----RKDIVSESLKAINAEKTRAQIAMNAAEGRINQIKE--
A0A2T6CN73      ------------------Q----RKDIVSESLKAINLEVARASIALNAAENRRNQVAE--
A0A2G4G428      ------------------K----DTNTLTAERAALVRAREDTRKAIDEMEIIWRLIGE--
A0A6N6PCD8      -----------------------KQDVTLDYLKQLNIKLEEARSNRIKIESDLPILRKAQ
A0A139TUL1      -----------------ST----TLEATFSKLQEIGTELFSTRTELIQVKVLAGLLAE--
A0A2N8HCB0      -----------------DT----TLDATFNRVQEIGTELFSTRTELIQVKVLARLLAD--
A0A2N8HP04      -----------------DT----TLDATFNRVQEIGTELFSTRTELIQVKVLARLLAD--
A0A2N8HRJ0      -----------------DT----TLDATFNRVQEIGTELFSTRTELIQVKVLARLLAD--
A0A6N2U9Y7      -----------------DT----TLDATFNRVQEIGTELFSTRTELIQVKVLARLLAD--
A0A6N6PAZ1      ------------------------------------------------------------
A0A7V7VK26      ------------------------------------------------------------
A0A6I1K459      -----------------------GQDILTEEFRTLSENCTAAKTERLVMETDYEMTKRVG
D5ENH7          ------------------S----QENIAREQLGSLNQIKLESKNNYDQFETKWKLIDS--
A0A0R2XQ77      ------------------S----QENIAGTQLSTLNTIKLENKNVYDNLETRMGLVET--
A0A2E9IN28      ------------------S----DENIAGAQLARLNEIKLSNKNLYDQLETKWNLIES--
A0A6N4WTJ5      ------------------T----SENIASAQLASLNEMKLSNKNVYDNLETRWNLIES--
A0A366HAG0      --------TSMDAKGAQDD----VMTPESAMLLDTQRDVATLQKQVRDLKAQHDQMMT--
A0A2U8DZK4      --------------LTNPR----NNSMEIERLRQMQSTLVALTVDANSLKTRYESFRD--
A0A2T6DFL8      --------------L-NAR----YSDMEIETLRQMQNTLIALSVDAIGRKTRWERFKS--
A0A1D8AWD4      --------------L-SQR----YSDMDIETLRQMQNSLIALRVDAIGRKTRWERFRN--
A0A4Q1C9S2      --------------L-SQR----YTDMDIETLRQMQNSLIALRVDAIGRKTRWERFRG--
A0A178IH18      --------------LVTPQ----GGDIEIETLRQMQNTLVALRVDAIGRRARYENFKK--
A0A2T6DT99      --------------L-SAR----YSDMEVETLRQMQNSLIALSVDAIGRKTRYERFKS--
A0A1G3ZT33      --------------L-NAR----YSDMEIERLRQMQNSLIALRVDAIGRRTRWERFKN--
A0A3E1E2T2      --------------L-NAR----YSDMEIETLRQMQNSLIALSVDAIGRKTRWERFKD--
B1ZMW1          --------------L-NAR----YSDMEIETLRQMQNSLIALSVDAIGRRTRWERFKS--
A0A3M1I8A3      ------------------A----GSNPVAQSLSQVQARYADAKATAEIMQATIRELDAHL
A0A4V0XS84      ------------------E----TENVVLLALKQRQLDLEKAVSDSISKTQLANELGN--
A0A351WE84      ------------------Q----GFRADKVRLQQLEADRIASRVDMLVRKARLNQLES--
A0A7W1MRT6      ------------------A----RVAAEATGLMTLDVTREELASDKRTLQSLLDNLQRTG
A0A7W1YXK2      ------------------D----KQNIVVETLKDLNLKLNDARTQRMKLESDFAQYKD--
A0A2D5WGA5      ---------------GEES----YSIIEPEIVRRYESELITAKGVHTTQSTLLEGLKA--
A0A2E7SSH2      ---------------GEDS----YSIVEPEIVRRYESELITAKGLYTQQATLLQGLQG--
A0A832HNU4      ------------------E----NQNIVTEKLKALSSALTKAQTDRLAAEIEWNQIEA--
A0A1V5QDZ6      ------------------Q----GVRADKLRLSQMEADRIAARVDMLVRKAQLDQLVN--
A0A4Y8P964      -----------------GV----DRSPAEQELNRVSEAMSKARFEMIRREVYLEKAKS--
A0A3D4HF88      ------------------E----REDIDLQEIMQLNQVLTTTKQVRDQSKHRWEQIQSFK
A0A1V6J089      ---------------RGLM----SIRVESTRLNALENERSAARVDMLVRKARMDQLED--
A0A3C1BZR1      ---------------RGNM----SIRVEATRLNMLEGERSGARVEMLVRKARMDQLEG--
A0A848WTQ6      ------------RSGNNQE----TITLTPGVLATSEQQIYDLKQKQAQLTTQLERLNQ--
A0A6N6ZHN8      ------------------E----RQNIAREQLTSLNNQKIEAQQIFDRLSTRWNQVQQVQ
A0A6G6K641      ------------------K----DQDIVVTRFKQLNERLNEARSRRMQLEVDMAGALKGQ
A0A849Y642      ------------GISASST----GGRLEQEELRRKEGELFEAQTALKTQKLRLENLAK--
A0A7C4KLL2      ------------------Q----SQDVLAPQLRELAAKVAQARSDTARLQRQYQRLMAQA
A0A1H6KPB7      ----------SDTGNTIPT----TVNNEEAVLTERRNKLSALDDEITQLKTHINKLKS--
A0A2E9ISN4      ------------------E----RADMDIAFVNQLLARLKSVRLERVLLENQYEQLSDAD
B9XAX1          ------------------D----RQNIIVEKLKGLNQKYTSAKADRIQMEADLKLIQS--
A0A5R8KKM9      ---------GDNRATGQDV----IDTVESATLIDRERDIYKLTNEIQSLRAQISQLQT--
A0A7W8DJ38      ------------------E----RKDLVLTKLKELSSELNQQSKERLTLETQLQACKEGK
A0A7W1ZQ43      ------------------D----REHITLGKIRDLTSRYTDAQSARLGIQAEVDQLNS--
A0A139TS01      MYRSGDNRSVMTGAMEDED----FRNSKAQLM--------KFEKDEQELAAYVAEVQR--
A0A3E1EJT7      ------------------Q----SKDIVTEKLKALNMMGTQTNAHLKEAEVKWNQVQE--
A0A848WYP9      ------------------E----EGNFAGTTLGDLDRLLSDAKNARLHAEAERTQLELIN
A0A7C3I5X9      ------------------K----GDSIIAEALSQSQTRYVEAKARAQMAQTTVDELDR--
A0A349GXM8      ----ARGTMESRHLSALME----RRNQLTTELMLLEAQYPALDGANAAVISDVARLTRAT
A0A7V3QFN7      -----ATSTQPAPLLTQET----LRRLETLRI--------EAEAKYTGLEKLLTSLKP--
A0A4P5YP61      ----------------LDD----KKDIVGQKLKEMSKKVTEAKSVRISLESDLAQIQQ--
A0A6B2LYM4      ------------------R----SQDIDNQQLISLNTRLEQDKQLYDEASTVMAQINE--
A0A6D1VXB3      GV--------------------------------------DRSPAEQELNRVSEAVSKAR
I0JYY7          GV--------------------------------------DRSPAEQELNRVSEAVSKAR
A0A4Y8P842      GI--------------------------------------NSSPTEKELAQVGDALSKAR
B3DZK9          GV--------------------------------------NSSPTEKELAQVSDALAKAR
A0A4R7S1J2      ------------------E----NQNLVVSQLQDISSKLSQQTNDRVRLETDYAALLQ--
A0A2A2XV69      -------------PDSVVD----PMQAANEVLLSVEQQVSTERLRVSTLRAKYEQISK--
A0A651H7X9      ------------------Q----RRDIVTEKLKMLNMMLTEAAARRNEAAVRWNLVQQ--
A0A5E6MPC4      -------------QMDKSP----AEQELGRLSEAIFRARLDLLRREVRLERAKEAFAGGK
A0A840V0I7      ------------------------------------------------------------
A0A146G2Q9      -------------PDTADG----GTQAENSILLQVEQQVSQESLRVAALRAKYDQVSK--
A0A2T6D3Y2      -------------PDTADG----GTQSENSILLQVEQQVSQESLRVAALRAKYDQVSK--
A0A6N6PKP9      ------------------E----KQNIVVERLKDLNTKVTAAKAERLRIEADRAQLDR--
A0A6N6Z250      --------------LDRRD----AAQPEVEALRQLERTLVNLRVEALARKTRWEQFAS--
A0A4V1SB02      ------------------E----KSNVLADRVKDLNNQVGTATNQRTAIESDLAALKQ--
A0A6N6QEJ2      -----AAETPSLVSLNTQT----MAKLELSRT--------EYRTQAATLEQLMEKVNS--
A0A3C1VB86      ------------------Q----SQDVITPQLQDLNERLTQSKASLVQAQGAYQDSLKMS
A0A6N6P5E3      -------------PESMED----PRMAEENILVADEATVNDMRLKVASLQSKAQQIGL--
A0A838I246      -------------QEGTED----TQTAVNTMVVKQEGEVNDAETKVAVLSNQLQQIER--
A0A6J4HTK1      -------------PEGTED----AQTPVNTIVMEQEKMLNEAETKVATLSTQLQGIEN--
A0A838FVV7      -------------PEGMED----AQTPVNAIVMAQEKDVNDAETAVSSLSMKLDQIQT--
A0A7C3HWX0      -----GERVSYSASLEREM----VNSLAAQLT--------YAQGEYVLYKSQFDRLRS--
A0A7V4LSC4      -----GERVSYSTSVEREM----VNSLATQLT--------YTLGEYTSLSNRLEGLRR--
A0A2D5VY59      S----AEGSSIGMTTEPQI----VLRLEQERT--------VAEAKLIRFQTLFNELEA--
A0A2D8UZZ4      S----AEGSSIGMTTEPXI----VLRLEQERT--------VAEAKLXRFQTLFNELEA--
A0A353DV86      S----AEGSSIGMTTEPQI----VLRLEQERT--------VAEAKLIRFQTLFNELEA--
A0A2E5EPT8      -----ETPGKVALALDSER----VRALEMLNI--------EMNAGLTSKKTQLEQLKS--
A0A5B5WZ91      MYRSGDNR-VMTGAMEDED----FRNSKAQLM--------KFEKDEQELAAYVAEIQR--
A0A2N8HD92      -WRNGENRNTLTAGMEEED----FRNAKSQAM--------AFEKDEKELASYVQELQR--
A0A2N8HIT2      -WRNGENRSTLTAGMEEED----FRNAKSQAM--------QFEKDEKELASYVQELQR--
A0A354EBD3      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A355VEB2      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
R6K1U5          -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A2N8IWC2      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A2N8I441      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A2N8I3A6      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A410SCC4      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A3R5VEW0      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A7T9B0I0      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
B2UKW3          -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A411SSG2      -WRNGEHRSTLTAGMEEEE----FRNAKAQAM--------DFERREKELASYVQELQR--
A0A6M1RXR2      -----AAGTGPSLLLESET----VRRMEALRI--------EAKSQYEAEAKLLEQLKS--
A0A7C3DXS4      -----AAGTGPSLLLEAET----VRRLEALRI--------EAKSQYEAEAKLLEQLKS--
A0A7V6YXH8      -----PHGTTPTPTFSSEQ----LRTLQNQLL--------LLTDLQVKQQTTLSNLLQ--
A0A2V2SDV4      -----VTENTPGTLMTGDT----LRRFESLRI--------EGLRELVSQQTLLDKLLA--
A0A6N6PHJ5      -----TAGTAPMMLSESEE----FRRYLSSRF--------EKDQAYKKQKEVFEKLSA--
A0A7Y4QKN3      -----ASSSGPSPLIESDL----YRSFEKMKM--------ESEVLYERLMTTRKELAK--
A0A2V5PK75      -----SLEAAPVQLLSAET----IHKVESLRI--------ENEADFVKQSTLLNKLKS--
A0A1V6DME1      -----AAGTSPTTLLEAEV----LRRLKAQQI--------EGEAAYVREATLLQELKT--
A0A3D3DIJ3      -----ASGDGPSPLMTAET----LRKIESLRI--------ESQAEYVRQATRLDRLKNLG
A0A7X7VJR5      -----ASGDGPSPLMTAET----LRKIESLRI--------ESQAEYVRQATRLDRLKNLG
A0A6I1K583      ------------TMDTPGM----IGTLDIDTMRAMEQENIQLATTYRRKQTRFDELKK--
A0A350EWA4      -----EASSRNEQFFDMQT----IQQFRNKHD--------LEKLEYEKMMKRLHGMEA--
A0A832D3W5      -----ATSTQPAPLLTQET----LRRLETLRI--------EAEAKYTGLEKLLTSLKP--
A0A7V2G542      -----GLENPSVTVTGTEI----LRSTESEVD--------RMRAGVATLRSRIENIDK--
A0A7C4KPD7      -----PYSGRVYGTLDSET----IRRLDAVHVDAQARYV--------ELNAQYSRLTN--
A0A832MGU4      -----PFSGHPIGSMESET----IRRLDALAV--------EAQGEYNKLNELLNYLKK--
A0A1M6RLZ4      -----YAGDKNSIGAGSNP--------AELNFRENERLYQEALRDRDSLKSIVQRLGD--
A0A832M6Y9      -----IAGG-----FGPNA----NTTLQDMELQRKEAMLSDMKADVLARRVRLEKVKD--
A0A832HP42      -----SAAETPVYQVSLER----EKVSALAVELTR------AEAEYVFYKTKLDELAR--
A0A354T7G8      -----IAGGGSSLNPGGEM----RSEKDSMVISREQALM-LADQDTLTLQAEIDEIGK--
A0A512MBZ2      -----IAGGGPSITPGVSL----ATSKDGMVASREQAML-QSDLEVQNLTSELEQLDK--
A0A2E8MEZ0      -----FDGR-----DSGQV----GQAEELMYRRAQEKLD-TLEQTRDQIQIQIRKLID--
A0A7Y2T9S5      -----IETE-----RGDET----MGDSLGLRERAEKELY-EAKREMEQVSLHINKLLS--
A0A851GRQ2      -----WETE-----KGGNT----QGISSGLVEIAEKELY-QAKRDKEQLSFQLNKLLT--
A0A6B3LBV6      -----VGKG---FYYSDEV----VTPEDRIIQTGQERLA-TLEYEISGMKSQLEGLQG--
A0A840UX61      -----VPTRSG---QGQAY----NEIDDARVAAQRYAEL-EAEKV--RLESQIETLLR--
A0A4Q2YKS3      ------YRGSESIFGNTGV----FEDDSARSAADAFAKL-EQQKI--ELESQIKSLLN--
A0A6N6P3T8      ------YYGQDSYYRNANT----EDDNGAKSAQETFTQL-ETEKM--QLESMIQSLLK--
A0A8A7W668      ------YRGDASFGNQGGL----DEDIEANYAAQRFNEL-EGEKM--QLETQIQSLLK--
A0A2E3EC33      -----LSLGEPTWLRGSQP----NTGIASLVMTAKQKEF-QAEGAIQNLRTTIKSLTD--
A0A2E4GN01      -----LSLGEPTWLRGSQP----XTGXASLVMTAKQKEF-XAEXAIQXLXTTIXSLTD--
A0A800JJX7      -----LSLGEPTWLRGSQP----NTGIASLVMTAKQKEF-QAEAAIQNLRTTIKSLTD--
A0A1Z8XU55      -----LSLGEPVWLRGSQP----NTGTASLVLAAKQREF-AAEEAIQNLRSTISSLTQ--
A0A2E1RQR9      -----LSLGEPVWLRGSQP----NTGTASLVLAAKQREF-AAEEAIQNLRSTISSLTK--
A0A2E3ISQ4      -----LSLGEPVWLRGSQP----NTGTASLVMAAKQREF-AAEEAIQNLRSTIKSLTQ--
A0A2D6W6F4      -----LSLGEPVWLRGSQP----NTGTASLVMAAKQREF-AAEEAIQNLRSTIKSLTQ--
A0A2D8Z5A8      -----LSLGEPVWLRGSQP----NTGTASLVMAAKQREF-AAEEAIQNLRSTIKSLTQ--
                                                                            

A0A2A2XVF1      PANNTDELLRIGSVATIPQ-----------------------------------------
A0A2V5UHJ2      --RNADEVPSVRNSAV--------------------------------------------
A0A2V5PST3      --KSTQYLSQVLTQGMIPT-----------------------------------------
A0A2V5PXM3      --FSNNPAALLFLPAVAND-----------------------------------------
A0A1V5QB01      DEAVLAALGPAGSGIPGVG-----------------------------------------
A0A800JGC6      ------------------------------------------------------------
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      YIKSGGKLWDLSFINSIPQ-----------------------------------------
A0A7C5LI63      LVNQPPAAPATETTATPPTTPVPAPG---------------------------------A
A0A7C5P291      LLTPAATQPA---VVSPPAAEEPAENQPLTAGAEVTITVDQDNSLTRTVKVDENGNIDFP
A0A290QGD9      --LRAAGRDLTELSFIAIQ-----------------------------------------
A0A1D8AS58      --RKATPALLLELPFIASQ-----------------------------------------
I6AQC1          --RLKNNGDLLELPFIASN-----------------------------------------
W0ITH7          --RIKANGDLLELPFIANN-----------------------------------------
A0A139SU05      --YQEAGANLLEITYIGNY-----------------------------------------
A0A139SPN4      --YQESGDNLLEITYIGSY-----------------------------------------
A0A1V6E7N1      --YQAEGRNLFEISSIATY-----------------------------------------
A0A2D9MYT1      --VFTETGEFGTIPDVAAD-----------------------------------------
A0A258ANJ7      GTLPRDELLSLPSIASHPK-----------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      --EAEFDSRLVPINSKIAD-----------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A5B5WI95      ---TVRNDGLISVDTGLAD-----------------------------------------
A0A2N8I9W1      ---TERKQGLISVETGLPD-----------------------------------------
A0A4Q5IH27      ---TERKQGLISVETGLPD-----------------------------------------
A0A2N8IBZ6      ---TERKQGLISVETGLPD-----------------------------------------
A0A7G6DX28      ---TERKQGLISVETGLPD-----------------------------------------
R6J100          ---TERKQGLISVETGLPD-----------------------------------------
A0A139TV24      ---VSKKAELISLDTGIAD-----------------------------------------
A0A2N8HT11      ---LGHKAGLISLDTGIAD-----------------------------------------
R7DS70          ---LGHKAGLISLDTGIAD-----------------------------------------
A0A2N8HNL6      ---LGHKAGLISLDTGIAD-----------------------------------------
A0A290Q2Z2      --IPAEDRINLINSELIQD-----------------------------------------
A0A2A2RGK2      --NTGEPEELLTLPSVAAE-----------------------------------------
A0A2A2XXF7      --NTGSVEELLFLPSVAAE-----------------------------------------
A0A146GCJ0      --VEKGNLDALLAINSVSN-----------------------------------------
A0A2T6D6H8      --VEKANVDELLSINSVSQ-----------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      --LSTNEFLDAIVAMGIED-----------------------------------------
A0A2V5URB2      --RDYDSLPAVISNSL--------------------------------------------
A0A2V2DJ66      --YKRDGRDLCTLPFIADL-----------------------------------------
R7L5A9          --YKRDGKDLCTLPFISEF-----------------------------------------
A0A5B5WU87      --EAEHDAKLVPINSKIAD-----------------------------------------
R7DZW0          --EAEHDARLVPINSKIAD-----------------------------------------
A0A2N8HID1      --EAEHDARLVPINSKIAD-----------------------------------------
A0A2N8HS06      --EAEHDARLVPINSKIAD-----------------------------------------
A0A6N2TNT9      --EAEHDARLVPINSKIAD-----------------------------------------
A0A4P5QM05      --LKPEELMEAARILGITD-----------------------------------------
A0A4Q3C001      --LKADELLEVLRTLNIDE-----------------------------------------
B4DB23          --LSPEQLQDALKTLGIDD-----------------------------------------
A0A5R8KA81      ---AGNDLYKLLSIPSIAN-----------------------------------------
A0A2E6T482      RE----ELRASILTAHPDA-----------------------------------------
A0A3C0DQZ7      RE----ELRASILTAHPDA-----------------------------------------
A0A1Z9CBK5      VE----ELRESIMTANPDA-----------------------------------------
A0A2D6ZI96      VE----ELRESIMTANPDA-----------------------------------------
A0A358KGZ3      LE----ELRESIMTANPDA-----------------------------------------
A0A2E9ZQX4      LE----ELRESIMTANPDA-----------------------------------------
A0A3D5JZU0      LE----ELRESIMTANPDA-----------------------------------------
A0A2E6HCR0      FE----NLRESILTAYPDA-----------------------------------------
A0A1Z8WN04      DE----ELRNSILTAYPDA-----------------------------------------
A0A2D7L1N4      DE----ELRNSILTAYPDA-----------------------------------------
A0A2E2R937      XE----XLRNSILTAYPDA-----------------------------------------
A0A520QQY4      DE----ELRNSILTAYPDA-----------------------------------------
A0A2D5MR66      SE----ELRNSILTAYPDA-----------------------------------------
A0A2E0PDQ1      SE----ELRNSILTAYPDA-----------------------------------------
A0A2E2ZZP9      SE----ELRNSILTAYPDA-----------------------------------------
A0A4P5YMI6      RN----EIKEVIVTVYPDE-----------------------------------------
A0A7C4LRK7      RA----EFKRAIQTANPDQ-----------------------------------------
A0A3C1VJ32      QTNQSKLRDVLPGVV--SD-----------------------------------------
A0A7W1VTI1      REE---LRNQLPTALFPPD-----------------------------------------
A0A7V4IGZ6      RSRLIAAIPAIPNLV--QD-----------------------------------------
A0A2N9NTX7      RTNPAALIQTIPITA--PD-----------------------------------------
B9XK55          SDE---LKQAIPTAA--PD-----------------------------------------
A0A2A2RGF2      PE----QLRNVLGPPVVND-----------------------------------------
A0A2G4I5Y6      PE----QLKNALGPPVVND-----------------------------------------
A0A6N6PS97      RP----ELRRVIPVSAPDE-----------------------------------------
A0A3M1I883      DK-GLQDLRDAILTVMPSE-----------------------------------------
A0A1V6JZ45      RT----SMREAVLVTMPTE-----------------------------------------
A0A848A4B3      RT----SMREAVLVTMPTE-----------------------------------------
A0A7C7Z746      PE----DLEVVLLTIQADP-----------------------------------------
A0A520RRW5      LE----ELRNTLLTAMPGN-----------------------------------------
A0A356NPK0      LE----ELRNTLLTAMPGN-----------------------------------------
A0A2D7B5P5      LE----ELRNTLLTAMPGN-----------------------------------------
A0A3D3XGB5      LE----ELRNTLLTAMPGN-----------------------------------------
A0A2V6F8A1      ADKGDAELRKSILTAMNDE-----------------------------------------
A0A2V5TNH4      EEKGNTELRKSILTAINDE-----------------------------------------
A0A2V5X5Q6      EEHGDSELRKSILTAINDE-----------------------------------------
A0A3R5R2M8      ---AGRNGGLISVDTGLTD-----------------------------------------
A0A411SUQ6      ---SERKHGLISVETGLPD-----------------------------------------
A0A2N8HZF2      ---TERKQGLISVETGLPD-----------------------------------------
A0A354E720      ---SERKQGLISVETGLPD-----------------------------------------
A0A7T8XNA1      ---SERKQGLISVETGLPD-----------------------------------------
B2UPB6          ---SERKHGLISVETGLPD-----------------------------------------
A0A1Q6UHJ9      --FKRDGKDLADLPFIAE------------------------------------------
A0A2V2BXR0      --FKRDGKDLADLPFIAE------------------------------------------
A0A3C1HEJ2      --LGQNVPLLVTMPVVSAD-----------------------------------------
A0A522ULD9      --LDGENLLSASQFIVGDV-----------------------------------------
A0A7W1RNH4      AAPQAAGVASPYRRLIAFP-----------------------------------------
A0A2D8V0G3      AEAEADSRTLDLSVLPYIQ-----------------------------------------
A0A348S017      REAGESGQLLDLSQIPFVA-----------------------------------------
A0A3C1UUV7      REAGESGQLLDLSQIPFVA-----------------------------------------
A0A350I3V2      REAGESGQLLDLSQIPFVA-----------------------------------------
A0A520RGV5      REAGESGQLLDLSQIPFVA-----------------------------------------
A0A3D3XF90      REAGESGQLLDLSQIPFVA-----------------------------------------
A0A2D7B522      REAGESGQLLDLSQIPFVA-----------------------------------------
A0A356NIC2      REAGESGQLLDLSQIPFVA-----------------------------------------
A0A832MDW4      --HVKAGKPIETFPAVASD-----------------------------------------
A0A1V6JU76      --HIQAGNPLETFPKIAAD-----------------------------------------
A0A848ABG7      --HIQAGNPLETFPKIAAD-----------------------------------------
A0A2A2XXW5      --WVAAGKDITDFAPLAKD-----------------------------------------
A0A6N6Q6V0      --WRKSGRDLADFPEVAKD-----------------------------------------
A0A2V6JLK8      --LKGDDLMRMLPTLDVQD-----------------------------------------
A0A2W5Z1A5      --LKGEDLMRMFAALNIQD-----------------------------------------
A0A2V6EA09      --LKGEELMRMLATLNIQD-----------------------------------------
A0A2V6GQI7      --LKGEELMRMLATLNIQD-----------------------------------------
A0A7W1U7K0      --LKGEDLMRMMPTLNIQD-----------------------------------------
A0A7W0YDK6      --LKGEELMRMMPTLNITD-----------------------------------------
A0A7V9EPY1      --LKGEDLMRMMPTLDIQD-----------------------------------------
A0A838TCM2      --LKGEDLMRMMPTLNIQD-----------------------------------------
A0A2N8HDG3      ---LGQKAGLISLDTGIAD-----------------------------------------
A0A3E1ET42      --LEGDQLIANAASLDVQN-----------------------------------------
A0A2A2YDW8      --LSADEVIRYAANLEVAG-----------------------------------------
A0A352XLN9      --LSADEVIRYAANLEVAG-----------------------------------------
A0A3D0YP62      --VADEDLPGLAA--DLPD-----------------------------------------
A0A3D3DV47      --VADEDLPGLAA--DLPD-----------------------------------------
A0A7Y1UNY2      --LESDDLMKYAAGLNLPN-----------------------------------------
A0A2E5XJ49      --LKNEELMNFAEGLKLPG-----------------------------------------
A0A2E6SBY8      --LKNEELMNFAEGLKLPG-----------------------------------------
A0A2E5QMS4      --LRDDELIDFAEGLKLPG-----------------------------------------
A0A2E7YXQ3      --LRDDELIDFAEGLKLPG-----------------------------------------
A0A2E3H787      --LKDAELIDFAEGLQLPG-----------------------------------------
A0A2E7AGN1      --LRDEELIDFAEGLQLPG-----------------------------------------
A0A2E7AKY7      --LRDEELIDFAEGLQLPG-----------------------------------------
A0A3D4CU34      --LRDEELIDFAEGLQLPG-----------------------------------------
A0A2E8M146      --LQDEELIDFAEGLQLPG-----------------------------------------
A0A355S8S2      --LQDEELIDFAEGLQLPG-----------------------------------------
A0A2D6DVN8      --LRDEELIDFAEGLQLPG-----------------------------------------
A0A3C1W2R2      --LRDEELIDFAEGLQLPG-----------------------------------------
A0A2E3NAY6      --LRDEELIDFAEGLQLPG-----------------------------------------
A0A2E3II01      --LRDEELVDFAEGLQLPG-----------------------------------------
A0A368B8C5      --LRDDELVDFAEGLQLPG-----------------------------------------
A0A3R7RBB5      --LRDDELVDFAEGLQLPG-----------------------------------------
A0A2A2QX62      --YDGAQLLAHASGLSLPD-----------------------------------------
A0A4Q3BWH6      --YDGPQLMNYASGLSLPD-----------------------------------------
A0A858RHU7      --YDGEQLLNYAGGLGLPD-----------------------------------------
A0A7V7VLV5      --YSSDQLMVYASGLQLPD-----------------------------------------
A0A3N5WCF1      --YDSDQLMVYAGGLNLPD-----------------------------------------
A0A4Q3C1K5      --YDSDQLMVYAAGLDLPD-----------------------------------------
A0A3D1TI55      --LEGKQLEDAIPFLVNDP-----------------------------------------
A0A3R8IT45      --RIKAGGDLTELPFIAAN-----------------------------------------
A0A2A2PYE8      --VRQRSGDLTELPFIASQ-----------------------------------------
A0A2T6CN73      --LKARGGNLTELPFIATQ-----------------------------------------
A0A2G4G428      --YKQTGKDLYDVAQVRSD-----------------------------------------
A0A6N6PCD8      T-LPPEELLAIQSVSGLPD-----------------------------------------
A0A139TUL1      ---GGRERDMIPANIGIQD-----------------------------------------
A0A2N8HCB0      ---RSRQQDMIPANIGIQD-----------------------------------------
A0A2N8HP04      ---RSRQQDMIPANIGIQD-----------------------------------------
A0A2N8HRJ0      ---RSRQQDMIPANIGIQD-----------------------------------------
A0A6N2U9Y7      ---RSRQQDMIPANIGIQD-----------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A7V7VK26      ------------------------------------------------------------
A0A6I1K459      --SKVSELLTLVSIARTPE-----------------------------------------
D5ENH7          --YKLEGKNLWELSFISEQ-----------------------------------------
A0A0R2XQ77      --FRREGRNLWELSFIAEE-----------------------------------------
A0A2E9IN28      --YRRQGKELWELSFISEQ-----------------------------------------
A0A6N4WTJ5      --YRREGKDLWELSFIAEQ-----------------------------------------
A0A366HAG0      --LEGDELIRLAGEMKVEN-----------------------------------------
A0A2U8DZK4      --IPPDKRLSLVNAQLIED-----------------------------------------
A0A2T6DFL8      --IPAGERQSLVNSELIPD-----------------------------------------
A0A1D8AWD4      --IPAADRRNLVNSELIQD-----------------------------------------
A0A4Q1C9S2      --IPTADRRNLVNSELIQD-----------------------------------------
A0A178IH18      --IPEADRANLVNSELITD-----------------------------------------
A0A2T6DT99      --IPPEERLNLVNSELIQD-----------------------------------------
A0A1G3ZT33      --IPAGERVTLANSELIQD-----------------------------------------
A0A3E1E2T2      --IPFEERVSLVNSELIPD-----------------------------------------
B1ZMW1          --IAPADRLSLVNSELIQD-----------------------------------------
A0A3M1I8A3      KAGRPAETFPSVANDSR-------------------------------------------
A0A4V0XS84      --LVRAGLSAEGAQMAMLQ-----------------------------------------
A0A351WE84      --LEGTELMNASSYVVMDQ-----------------------------------------
A0A7W1MRT6      GATHSEKLDALLASPSITS-----------------------------------------
A0A7W1YXK2      --LARGDPRALLVLSSIAD-----------------------------------------
A0A2D5WGA5      --QSDEELRASILTAHPDA-----------------------------------------
A0A2E7SSH2      --QSPDELRESIMTAHPDA-----------------------------------------
A0A832HNU4      --QLKDGQDPATIPAIAAD-----------------------------------------
A0A1V5QDZ6      --LSGEELMNASSYIVSDP-----------------------------------------
A0A4Y8P964      --AMEAGKLAAIPDSPF-------------------------------------------
A0A3D4HF88      AEGKPLQDLPFIAEMPL-------------------------------------------
A0A1V6J089      --LEGDKLMDAAAYIVQDP-----------------------------------------
A0A3C1BZR1      --LEGDRLMDAAAYIVQDP-----------------------------------------
A0A848WTQ6      --VGGEDLIKMAVSLDVAD-----------------------------------------
A0A6N6ZHN8      --ESGGSLLDLNFIATSSN-----------------------------------------
A0A6G6K641      --SNAEDLLKVPSIAQNAD-----------------------------------------
A0A849Y642      --LDLRELKDTINFLQPEG-----------------------------------------
A0A7C4KLL2      SNVSDLLLLPQIAAVPE-------------------------------------------
A0A1H6KPB7      --LKDSELMDYVRQTDLLA-----------------------------------------
A0A2E9ISN4      ILTVNEALAATRETEGRSQ-----------------------------------------
B9XAX1          --LTNQPEAILTLPSILQD-----------------------------------------
A0A5R8KKM9      --LDGDALIRQAGELRVEN-----------------------------------------
A0A7W8DJ38      --LPRDELLNLPTIASHPK-----------------------------------------
A0A7W1ZQ43      --ISTNPAAILALPSVQAD-----------------------------------------
A0A139TS01      --LPDDKLMDYVTNSDLLN-----------------------------------------
A0A3E1EJT7      --WTKAGRSLSELPFITSQ-----------------------------------------
A0A848WYP9      PEEDPERVFEIGHYVEQEH-----------------------------------------
A0A7C3I5X9      --HIQEQKPLETFPLIASD-----------------------------------------
A0A349GXM8      GEIKPSESSRDEEEAPVPG-----------------------------------------
A0A7V3QFN7      --LSKEELRKVLPTASPDA-----------------------------------------
A0A4P5YP61      ---LGTNIGALLGIASVAN-----------------------------------------
A0A6B2LYM4      --ARDSGDPLWELGFIANN-----------------------------------------
A0A6D1VXB3      FEMIRREVYLEKAKAAMDA-----------------------------------------
I0JYY7          FEMIRREVYLEKAKAAMDA-----------------------------------------
A0A4Y8P842      FEMIKKEVFYERAKNGLDS-----------------------------------------
B3DZK9          FEMIRKEVFYERAKNGLDM-----------------------------------------
A0A4R7S1J2      --MKSRPDEAVNLQIVANH-----------------------------------------
A0A2A2XV69      --LSDDQIMRSISTLDVQD-----------------------------------------
A0A651H7X9      --YREEGRPLTEISFIANN-----------------------------------------
A0A5E6MPC4      AGVPENPYTVELKKL---------------------------------------------
A0A840V0I7      ------------------------------------------------------------
A0A146G2Q9      --MTDEQIMRSLTTLEIED-----------------------------------------
A0A2T6D3Y2      --MTDEQIMRSLTTLEIED-----------------------------------------
A0A6N6PKP9      --LQGEPPERLLTLPSIAG-----------------------------------------
A0A6N6Z250      --VAPEDRLAVVNDELVTD-----------------------------------------
A0A4V1SB02      --IPTENVEELLKLNSLSA-----------------------------------------
A0A6N6QEJ2      --KKGDELRHFLSSARPTQ-----------------------------------------
A0A3C1VB86      --TNTEDLLAYPQIAIEPD-----------------------------------------
A0A6N6P5E3      --MTDDQIMRSLKTFEMDD-----------------------------------------
A0A838I246      --LKGEDLMRMMPTLQIQD-----------------------------------------
A0A6J4HTK1      --LKGEDLMRMMPTLNIQD-----------------------------------------
A0A838FVV7      --LKGEDLMRMMPTLNIQD-----------------------------------------
A0A7C3HWX0      --LSTNDLRKAILTTFQAE-----------------------------------------
A0A7V4LSC4      --LSANELRQAILTAVPGE-----------------------------------------
A0A2D5VY59      --MTLDQLKNTILTAMPGN-----------------------------------------
A0A2D8UZZ4      --MTLDQLKNTILTAMPGN-----------------------------------------
A0A353DV86      --MTLDQLKNTILTAMPGN-----------------------------------------
A0A2E5EPT8      --LSPKVLGNALMTVLPNE-----------------------------------------
A0A5B5WZ91      --LPDDKLMDYVTNSDLLN-----------------------------------------
A0A2N8HD92      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A2N8HIT2      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A354EBD3      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A355VEB2      --LPDDKLLDYVISSDLLN-----------------------------------------
R6K1U5          --LPDDKLLDYVISSDLLN-----------------------------------------
A0A2N8IWC2      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A2N8I441      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A2N8I3A6      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A410SCC4      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A3R5VEW0      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A7T9B0I0      --LPDDKLLDYVISSDLLN-----------------------------------------
B2UKW3          --LPDDKLLDYVISSDLLN-----------------------------------------
A0A411SSG2      --LPDDKLLDYVISSDLLN-----------------------------------------
A0A6M1RXR2      --VPRDQLPQVLSAAM-RD-----------------------------------------
A0A7C3DXS4      --VPREELPQVLSAAM-RD-----------------------------------------
A0A7V6YXH8      --YDKEELRNSIQTALDQP-----------------------------------------
A0A2V2SDV4      --FSPKDVVNVLPTVI--P-----------------------------------------
A0A6N6PHJ5      --IDIVALRDVLPGFQ--P-----------------------------------------
A0A7Y4QKN3      --ETPESLRFVLPQIA--P-----------------------------------------
A0A2V5PK75      --LKYQELTQVLPTTV--A-----------------------------------------
A0A1V6DME1      --TAPEDLKSVLPTAV--A-----------------------------------------
A0A3D3DIJ3      KELGPEGLAQAITTDA--P-----------------------------------------
A0A7X7VJR5      KELGPEGLAQAITTDA--P-----------------------------------------
A0A6I1K583      --LPADQLRNALNYVAPDE-----------------------------------------
A0A350EWA4      --LTSIDQLKVALPTSFPD-----------------------------------------
A0A832D3W5      --LSKEELRKVLPTASP-------------------------------------------
A0A7V2G542      --LKGEELMRALPQLEIND-----------------------------------------
A0A7C4KPD7      --MNRVELKRALVTVQP-------------------------------------------
A0A832MGU4      --LSRPELKKAVLQANPD------------------------------------------
A0A1M6RLZ4      --LDNEALISAMAGLNLPE-----------------------------------------
A0A832M6Y9      --LTIEQIENVLQPLGLED-----------------------------------------
A0A832HP42      --LSRLDLRKAVLTAMPTE-----------------------------------------
A0A354T7G8      --LSIEELIARASGLKLDN-----------------------------------------
A0A512MBZ2      --LSPDELVARASGLRLDN-----------------------------------------
A0A2E8MEZ0      --TPNEDLIRTAAGLELPE-----------------------------------------
A0A7Y2T9S5      --VDNDDLISVVAEL--PE-----------------------------------------
A0A851GRQ2      --LSREELIAVAAEL--PE-----------------------------------------
A0A6B3LBV6      --LEGTDLIRKAAMLGIED-----------------------------------------
A0A840UX61      --YSGPQLMTYAAGLNLPE-----------------------------------------
A0A4Q2YKS3      --YRTEQLMVYASGLDLPE-----------------------------------------
A0A6N6P3T8      --YSSDQLMVYASGLALPD-----------------------------------------
A0A8A7W668      --YDSEQLLVYAAGLDLPD-----------------------------------------
A0A2E3EC33      --LEGEELIKSAVDLGIKN-----------------------------------------
A0A2E4GN01      --LKGEELIKSAVDLGIKN-----------------------------------------
A0A800JJX7      --LKGEELIKSAVDLGIKN-----------------------------------------
A0A1Z8XU55      --LEGEELIKSAVDLGVKN-----------------------------------------
A0A2E1RQR9      --LEGEELIKSAVDLGVKN-----------------------------------------
A0A2E3ISQ4      --LEGAELIKSAVDLGVKN-----------------------------------------
A0A2D6W6F4      --LEGAELIKSAVDLGVKN-----------------------------------------
A0A2D8Z5A8      --LEGAXLIKSAVDLGVKN-----------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------PT----------
A0A1V5QB01      ------------------------------------------------LMSIAAMGVETN
A0A800JGC6      ------------------------------------------------------------
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      RTGEVAIAGLQLAG----------------------------------QNQAAPVPEKTT
A0A7C5P291      PLGRVQAGGRTPAGLRDHLQERLQKEFYLTSPVRVTLGTATAPVLTITDNTGAAAPPPAA
A0A290QGD9      ------------------------------------------------PI----------
A0A1D8AS58      ------------------------------------------------SL----------
I6AQC1          ------------------------------------------------PL----------
W0ITH7          ------------------------------------------------QL----------
A0A139SU05      ------------------------------------------------NT----------
A0A139SPN4      ------------------------------------------------GT----------
A0A1V6E7N1      ------------------------------------------------DQ----------
A0A2D9MYT1      ------------------------------------------------AE----------
A0A258ANJ7      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------MG----------
A0A1G3ZFT0      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------NG----------
A0A2N8I9W1      ------------------------------------------------SG----------
A0A4Q5IH27      ------------------------------------------------SG----------
A0A2N8IBZ6      ------------------------------------------------SG----------
A0A7G6DX28      ------------------------------------------------SG----------
R6J100          ------------------------------------------------SG----------
A0A139TV24      ------------------------------------------------SG----------
A0A2N8HT11      ------------------------------------------------SG----------
R7DS70          ------------------------------------------------SG----------
A0A2N8HNL6      ------------------------------------------------SG----------
A0A290Q2Z2      ------------------------------------------------PN----------
A0A2A2RGK2      ------------------------------------------------PK----------
A0A2A2XXF7      ------------------------------------------------PK----------
A0A146GCJ0      ------------------------------------------------LPQ---------
A0A2T6D6H8      ------------------------------------------------LPH---------
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------AN----------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------PI----------
R7L5A9          ------------------------------------------------QQ----------
A0A5B5WU87      ------------------------------------------------MG----------
R7DZW0          ------------------------------------------------MG----------
A0A2N8HID1      ------------------------------------------------MG----------
A0A2N8HS06      ------------------------------------------------MG----------
A0A6N2TNT9      ------------------------------------------------MG----------
A0A4P5QM05      ------------------------------------------------ST----------
A0A4Q3C001      ------------------------------------------------PT----------
B4DB23          ------------------------------------------------TT----------
A0A5R8KA81      ------------------------------------------------QRA---------
A0A2E6T482      ------------------------------------------------Q-----------
A0A3C0DQZ7      ------------------------------------------------Q-----------
A0A1Z9CBK5      ------------------------------------------------Q-----------
A0A2D6ZI96      ------------------------------------------------Q-----------
A0A358KGZ3      ------------------------------------------------Q-----------
A0A2E9ZQX4      ------------------------------------------------Q-----------
A0A3D5JZU0      ------------------------------------------------Q-----------
A0A2E6HCR0      ------------------------------------------------Q-----------
A0A1Z8WN04      ------------------------------------------------Q-----------
A0A2D7L1N4      ------------------------------------------------Q-----------
A0A2E2R937      ------------------------------------------------Q-----------
A0A520QQY4      ------------------------------------------------Q-----------
A0A2D5MR66      ------------------------------------------------Q-----------
A0A2E0PDQ1      ------------------------------------------------Q-----------
A0A2E2ZZP9      ------------------------------------------------Q-----------
A0A4P5YMI6      ------------------------------------------------L-----------
A0A7C4LRK7      ------------------------------------------------H-----------
A0A3C1VJ32      ------------------------------------------------AE----------
A0A7W1VTI1      ------------------------------------------------QN----------
A0A7V4IGZ6      ------------------------------------------------QQ----------
A0A2N9NTX7      ------------------------------------------------SY----------
B9XK55          ------------------------------------------------AI----------
A0A2A2RGF2      ------------------------------------------------EI----------
A0A2G4I5Y6      ------------------------------------------------EI----------
A0A6N6PS97      ------------------------------------------------A-----------
A0A3M1I883      ------------------------------------------------AL----------
A0A1V6JZ45      ------------------------------------------------AR----------
A0A848A4B3      ------------------------------------------------AR----------
A0A7C7Z746      ------------------------------------------------N-----------
A0A520RRW5      ------------------------------------------------LR----------
A0A356NPK0      ------------------------------------------------LR----------
A0A2D7B5P5      ------------------------------------------------LR----------
A0A3D3XGB5      ------------------------------------------------LR----------
A0A2V6F8A1      ------------------------------------------------L-----------
A0A2V5TNH4      ------------------------------------------------L-----------
A0A2V5X5Q6      ------------------------------------------------L-----------
A0A3R5R2M8      ------------------------------------------------NG----------
A0A411SUQ6      ------------------------------------------------SG----------
A0A2N8HZF2      ------------------------------------------------SG----------
A0A354E720      ------------------------------------------------SG----------
A0A7T8XNA1      ------------------------------------------------SG----------
B2UPB6          ------------------------------------------------SG----------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------PT----------
A0A522ULD9      ------------------------------------------------S-----------
A0A7W1RNH4      ------------------------------------------------TLLRNEA-----
A0A2D8V0G3      ------------------------------------------------NSPI--------
A0A348S017      ------------------------------------------------SSEI--------
A0A3C1UUV7      ------------------------------------------------SSEI--------
A0A350I3V2      ------------------------------------------------SSEI--------
A0A520RGV5      ------------------------------------------------SSEI--------
A0A3D3XF90      ------------------------------------------------SSEI--------
A0A2D7B522      ------------------------------------------------SSEI--------
A0A356NIC2      ------------------------------------------------SSEI--------
A0A832MDW4      ------------------------------------------------PV----------
A0A1V6JU76      ------------------------------------------------GK----------
A0A848ABG7      ------------------------------------------------GK----------
A0A2A2XXW5      ------------------------------------------------EQ----------
A0A6N6Q6V0      ------------------------------------------------QV----------
A0A2V6JLK8      ------------------------------------------------PT----------
A0A2W5Z1A5      ------------------------------------------------PT----------
A0A2V6EA09      ------------------------------------------------PT----------
A0A2V6GQI7      ------------------------------------------------PT----------
A0A7W1U7K0      ------------------------------------------------PT----------
A0A7W0YDK6      ------------------------------------------------PT----------
A0A7V9EPY1      ------------------------------------------------PT----------
A0A838TCM2      ------------------------------------------------PT----------
A0A2N8HDG3      ------------------------------------------------SG----------
A0A3E1ET42      ------------------------------------------------DT----------
A0A2A2YDW8      ------------------------------------------------QD----------
A0A352XLN9      ------------------------------------------------QD----------
A0A3D0YP62      ------------------------------------------------VG----------
A0A3D3DV47      ------------------------------------------------VG----------
A0A7Y1UNY2      ------------------------------------------------NG----------
A0A2E5XJ49      ------------------------------------------------SA----------
A0A2E6SBY8      ------------------------------------------------SA----------
A0A2E5QMS4      ------------------------------------------------SQ----------
A0A2E7YXQ3      ------------------------------------------------SQ----------
A0A2E3H787      ------------------------------------------------SQ----------
A0A2E7AGN1      ------------------------------------------------SQ----------
A0A2E7AKY7      ------------------------------------------------SQ----------
A0A3D4CU34      ------------------------------------------------SQ----------
A0A2E8M146      ------------------------------------------------SQ----------
A0A355S8S2      ------------------------------------------------SQ----------
A0A2D6DVN8      ------------------------------------------------SQ----------
A0A3C1W2R2      ------------------------------------------------SQ----------
A0A2E3NAY6      ------------------------------------------------SQ----------
A0A2E3II01      ------------------------------------------------SQ----------
A0A368B8C5      ------------------------------------------------SQ----------
A0A3R7RBB5      ------------------------------------------------SQ----------
A0A2A2QX62      ------------------------------------------------NV----------
A0A4Q3BWH6      ------------------------------------------------NI----------
A0A858RHU7      ------------------------------------------------NI----------
A0A7V7VLV5      ------------------------------------------------NV----------
A0A3N5WCF1      ------------------------------------------------NI----------
A0A4Q3C1K5      ------------------------------------------------NL----------
A0A3D1TI55      ------------------------------------------------S-----------
A0A3R8IT45      ------------------------------------------------HL----------
A0A2A2PYE8      ------------------------------------------------PQ----------
A0A2T6CN73      ------------------------------------------------AT----------
A0A2G4G428      ------------------------------------------------ER----------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------AG----------
A0A2N8HCB0      ------------------------------------------------AG----------
A0A2N8HP04      ------------------------------------------------AG----------
A0A2N8HRJ0      ------------------------------------------------AG----------
A0A6N2U9Y7      ------------------------------------------------AG----------
A0A6N6PAZ1      ------------------------------------------------------------
A0A7V7VK26      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
D5ENH7          ------------------------------------------------PR----------
A0A0R2XQ77      ------------------------------------------------SR----------
A0A2E9IN28      ------------------------------------------------PR----------
A0A6N4WTJ5      ------------------------------------------------PR----------
A0A366HAG0      ------------------------------------------------ET----------
A0A2U8DZK4      ------------------------------------------------PG----------
A0A2T6DFL8      ------------------------------------------------QN----------
A0A1D8AWD4      ------------------------------------------------TN----------
A0A4Q1C9S2      ------------------------------------------------TN----------
A0A178IH18      ------------------------------------------------TN----------
A0A2T6DT99      ------------------------------------------------PN----------
A0A1G3ZT33      ------------------------------------------------TN----------
A0A3E1E2T2      ------------------------------------------------IN----------
B1ZMW1          ------------------------------------------------TN----------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------QYGGRLTG----
A0A351WE84      ------------------------------------------------S-----------
A0A7W1MRT6      ------------------------------------------------NQV---------
A0A7W1YXK2      ------------------------------------------------SPT---------
A0A2D5WGA5      ------------------------------------------------Q-----------
A0A2E7SSH2      ------------------------------------------------Q-----------
A0A832HNU4      ------------------------------------------------KT----------
A0A1V5QDZ6      ------------------------------------------------A-----------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------T-----------
A0A3C1BZR1      ------------------------------------------------T-----------
A0A848WTQ6      ------------------------------------------------AS----------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A849Y642      ------------------------------------------------N-----------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------ETTPGSLS----
A0A2E9ISN4      ------------------------------------------------VTPEGAPAVDPG
B9XAX1          ------------------------------------------------PA----------
A0A5R8KKM9      ------------------------------------------------ET----------
A0A7W8DJ38      ------------------------------------------------------------
A0A7W1ZQ43      ------------------------------------------------MA----------
A0A139TS01      ------------------------------------------------AEILAADS----
A0A3E1EJT7      ------------------------------------------------AK----------
A0A848WYP9      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------SQ----------
A0A349GXM8      ------------------------------------------------GETKSAKEDAAQ
A0A7V3QFN7      ------------------------------------------------L-----------
A0A4P5YP61      ------------------------------------------------DPT---------
A0A6B2LYM4      ------------------------------------------------AE----------
A0A6D1VXB3      ------------------------------------------------GKLAAI------
I0JYY7          ------------------------------------------------GKLAAI------
A0A4Y8P842      ------------------------------------------------GKSVTI------
B3DZK9          ------------------------------------------------GKSLTI------
A0A4R7S1J2      ------------------------------------------------PT----------
A0A2A2XV69      ------------------------------------------------PT----------
A0A651H7X9      ------------------------------------------------PI----------
A0A5E6MPC4      ------------------------------------------------------------
A0A840V0I7      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------PT----------
A0A2T6D3Y2      ------------------------------------------------PT----------
A0A6N6PKP9      ------------------------------------------------AAV---------
A0A6N6Z250      ------------------------------------------------QN----------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------E-----------
A0A3C1VB86      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------AT----------
A0A838I246      ------------------------------------------------PT----------
A0A6J4HTK1      ------------------------------------------------PT----------
A0A838FVV7      ------------------------------------------------PT----------
A0A7C3HWX0      -------------------------------------------------EV---------
A0A7V4LSC4      -------------------------------------------------EI---------
A0A2D5VY59      ------------------------------------------------LR----------
A0A2D8UZZ4      ------------------------------------------------LR----------
A0A353DV86      ------------------------------------------------LR----------
A0A2E5EPT8      ------------------------------------------------IN----------
A0A5B5WZ91      ------------------------------------------------AEILAA------
A0A2N8HD92      ------------------------------------------------AESVGA------
A0A2N8HIT2      ------------------------------------------------AESVGA------
A0A354EBD3      ------------------------------------------------AETVGA------
A0A355VEB2      ------------------------------------------------AETVGA------
R6K1U5          ------------------------------------------------AETVGA------
A0A2N8IWC2      ------------------------------------------------AETVGA------
A0A2N8I441      ------------------------------------------------AETVGA------
A0A2N8I3A6      ------------------------------------------------AETVGA------
A0A410SCC4      ------------------------------------------------AETVGA------
A0A3R5VEW0      ------------------------------------------------AETVGA------
A0A7T9B0I0      ------------------------------------------------AETVGA------
B2UKW3          ------------------------------------------------AETVGA------
A0A411SSG2      ------------------------------------------------AETVGA------
A0A6M1RXR2      ------------------------------------------------DPQ---------
A0A7C3DXS4      ------------------------------------------------DPQ---------
A0A7V6YXH8      ------------------------------------------------DAT---------
A0A2V2SDV4      ------------------------------------------------DAT---------
A0A6N6PHJ5      ------------------------------------------------DSE---------
A0A7Y4QKN3      ------------------------------------------------DPT---------
A0A2V5PK75      ------------------------------------------------DSL---------
A0A1V6DME1      ------------------------------------------------DPQ---------
A0A3D3DIJ3      ------------------------------------------------DTL---------
A0A7X7VJR5      ------------------------------------------------DTL---------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------SAL---------
A0A832D3W5      -------------------------------------------------DA---------
A0A7V2G542      -------------------------------------------------PT---------
A0A7C4KPD7      -------------------------------------------------DT---------
A0A832MGU4      -------------------------------------------------PA---------
A0A1M6RLZ4      ------------------------------------------------IKV---------
A0A832M6Y9      -------------------------------------------------PT---------
A0A832HP42      -------------------------------------------------QQ---------
A0A354T7G8      -------------------------------------------------PS---------
A0A512MBZ2      -------------------------------------------------PN---------
A0A2E8MEZ0      -------------------------------------------------NQ---------
A0A7Y2T9S5      -------------------------------------------------VG---------
A0A851GRQ2      -------------------------------------------------VG---------
A0A6B3LBV6      -------------------------------------------------QT---------
A0A840UX61      -------------------------------------------------NV---------
A0A4Q2YKS3      -------------------------------------------------NI---------
A0A6N6P3T8      -------------------------------------------------NV---------
A0A8A7W668      -------------------------------------------------NI---------
A0A2E3EC33      -------------------------------------------------ET---------
A0A2E4GN01      -------------------------------------------------DI---------
A0A800JJX7      -------------------------------------------------ET---------
A0A1Z8XU55      -------------------------------------------------ET---------
A0A2E1RQR9      -------------------------------------------------ET---------
A0A2E3ISQ4      -------------------------------------------------ET---------
A0A2D6W6F4      -------------------------------------------------ET---------
A0A2D8Z5A8      -------------------------------------------------ET---------
                                                                            

A0A2A2XVF1      ----------------------VAEARRQLSDSNMEIAAMQ---DRYGERHPKFIAALAK
A0A2V5UHJ2      ----------------------IGSLKAELGKFEAEYASLA---KEFKAGYPPLDNVKTR
A0A2V5PST3      ----------------------LRSTLLTLEAEKIKQS------TVFKPDHPRMIELNQQ
A0A2V5PXM3      ----------------------VTDIRGNVGRLESDLANLR---QRYKEKHPKYIQTASQ
A0A1V5QB01      APAPAVGGLEGLVEYGVVQQRGWQEQRRVKSLLEARLAEYR---TKFRDAHPLVQQTMRE
A0A800JGC6      ----------------------CFLRKTLIDKAEEEVVELK---KRYGPKWPTLIEAENK
A0A7Y2T8X5      ----------------------VLASNELLKAKRDELVLLK---LRYKSKHPKMIEARAI
A0A1J4XH17      ----------------------VEQLLSDLATKNIEISSLE---KRYGAKHPKMIEATRA
A0A7C5LI63      VGDGASVYGAVLQAAPVMNDTIVKNLMELERRRTKLEARVSELLTICKPKHPAVQAVQKE
A0A7C5P291      APAANALSSPPPTLLRMMGDEHGQKLFEYENQRRQLLARLTELRKIYRPKHPALADTERQ
A0A290QGD9      ----------------------IGELKKQQAEQKVVVAQLS---ERYRAKHPRMIDATRM
A0A1D8AS58      ----------------------IVQLVQQVAAQKIVLAQMR---ERYRDKHPRMIEAHNS
I6AQC1          ----------------------VSQLASQIAMQTITIKQLR---ERYKEKHPKMIEASNA
W0ITH7          ----------------------VAQLASQVAMQTITVKQLR---ERYKEKHPRMIEANNA
A0A139SU05      ----------------------VAPLRGQMTTLLQEQARLA---ERYLERHPRMIEVTNA
A0A139SPN4      ----------------------VAPLRTQLSTLLQEQARLA---ERYLERHPRMIETTNA
A0A1V6E7N1      ----------------------IPALNAQIAELTRTQTVLG---ERYLERHPLMIELANK
A0A2D9MYT1      ----------------------VKKMRGDLALALAELASLR---ERYLEKHPKIIEKRSS
A0A258ANJ7      ----------------------VSGILSQIASQKSALAVLA---ERYKPKHPKYEAVQVV
A0A1Z8ZMT6      ----------------------ALEAEKEMAVAEKAIQDLS---IRYGLKHPKIISGTDQ
A0A2E8MCT7      ----------------------ALEAEKEMAVAEKAVQDLS---IRYGPKHPKIISATDH
A0A139TLN4      ----------------------IRDQIGVFNDTLLKKTSLK---VNAGDNNPIVRELEAN
A0A1G3ZFT0      ----------------------IEKQLINLRMTKHEMF------YQYTKSHPSMINLKRR
A0A5B5WI95      ----------------------ISRQIEGYNEAFLEYQKIA---GSAGSQNPIAVGLRER
A0A2N8I9W1      ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPITVSLRDR
A0A4Q5IH27      ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPITVSLRDR
A0A2N8IBZ6      ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPITVSLRDR
A0A7G6DX28      ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPITVSLRDR
R6J100          ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPITVSLRDR
A0A139TV24      ----------------------VSRQIEAYNTAYLEYQKIA---GSAGSQNPIVVSLTKK
A0A2N8HT11      ----------------------VSRQIEAYNAAYLEYQKVA---GSAGGQNPIVVTLTKR
R7DS70          ----------------------VSRQIEAYNAAYLEYQKVA---GSAGGQNPIVVTLTKR
A0A2N8HNL6      ----------------------VSRQIEAYNAAYLEYQKVA---GSAGGQNPIVVTLTKR
A0A290Q2Z2      ----------------------IQNLLQAYLIADQNVTKFR---ARLGAAHPELIGATDN
A0A2A2RGK2      ----------------------VAQYSESLNARQRDLTIVA---QRYRSKHPTYVAIKTQ
A0A2A2XXF7      ----------------------VAQYSESLNARQRELTLIS---QRYRAKHPAYISVKTQ
A0A146GCJ0      ----------------------VALIREQLLNAEGDLAGLK---ERYLPKHPKYIAASMR
A0A2T6D6H8      ----------------------VAVIREQLVSAEAELAALK---DRYLPKHPKYIAGVTR
A0A6B3L938      ----------------------ALALNQELNQFRTELSALR---QRYLPKHPRRIEAEAV
A0A2A2R5D6      ----------------------LTSLRAKKYAAESDLEQMRK--SGLEGNHPRIKSREAE
A0A2V5URB2      ----------------------IQSLRAQVVQLESEHAKLA---AQFLPGYPRLAQVKAQ
A0A2V2DJ66      ----------------------ISKLVSDRSQYQVSVSTLE---KRYKEKHPRMIEARKA
R7L5A9          ----------------------IAKLLTDRSTQQVFIASLE---KRYKEKHPSMIEARKT
A0A5B5WU87      ----------------------IRDQIGVFNDTLLKKTSLK---VNAGDNNPIVRELEAN
R7DZW0          ----------------------IRDQISVFNDTLLKRTSLK---VNAGDNNPIIRELEAN
A0A2N8HID1      ----------------------IRDQISVFNDTLLKRTSLK---VNAGDNNPIIRELEAN
A0A2N8HS06      ----------------------IRDQISVFNDTLLKRTSLK---VNAGDNNPIIRELEAN
A0A6N2TNT9      ----------------------IRDQISVFNDTLLKRTSLK---VNAGDNNPIIRELEAN
A0A4P5QM05      ----------------------VEKTLPLLQDAKAEEAKFFS--AGLGENHPRMKSLRAQ
A0A4Q3C001      ----------------------VRENLPLLQQAAAEEAKLLA--SGLGEAHPKIASLRQM
B4DB23          ----------------------VSRNLPLLQDAAAEHARLTN--LGLGVNHPRIKALDAQ
A0A5R8KA81      ----------------------VAELRSQISLAESEMANLS---QRYRPKHPRFIQMQDR
A0A2E6T482      ----------------------LDALIRELHTGEQTVANQS---IDLGEQHPRIKGLKKV
A0A3C0DQZ7      ----------------------LDALIRELHTGEQTVANQS---IDLGEQHPRIKGLKKV
A0A1Z9CBK5      ----------------------LDALIREYQTGQTTLANKS---IDLGEGHPTIKSLKAA
A0A2D6ZI96      ----------------------LDALIREYQTGQTTLANKS---IDLGEGHPTIKSLKAA
A0A358KGZ3      ----------------------LDALIREYQTGQTTLANKS---IDLGEGHPTIKSLKAA
A0A2E9ZQX4      ----------------------LDALIREYQTGQTTLANKS---IDLGEGHPTIKSLKAA
A0A3D5JZU0      ----------------------LDALIREYQTGQTTLANKS---IDLGEGHPTIKSLKAA
A0A2E6HCR0      ----------------------LDALVREYQTGQTTLANKS---IDLGEGHPTIKSLRAA
A0A1Z8WN04      ----------------------LDALVREYQTGQNSLANKS---IDLGEGHPTIKSLRAV
A0A2D7L1N4      ----------------------LDALVREYQTGQNSLANKS---IDLGEGHPTIKSLRAV
A0A2E2R937      ----------------------LDALVREYQTGQNSLANKS---IDLGEGHPTIKSLRAV
A0A520QQY4      ----------------------LDALVREYQTGQNSLANKS---IDLGEGHPTIKSLRAV
A0A2D5MR66      ----------------------LDALVREYQTGQTTLANKS---IDLGEGHPTIKSLRAA
A0A2E0PDQ1      ----------------------LDALVREYQTGQTTLANKS---IDLGDGHPTIKSLRAA
A0A2E2ZZP9      ----------------------LDALFREYQTGQTTLANKS---IDLGDGHPTIKSLRAA
A0A4P5YMI6      ----------------------LATLLQKQTLTIQELAAKS---KDLGAQHPEVIRVNSL
A0A7C4LRK7      ----------------------LAVLMEELARAEHKRSLLE---PDYSADHPEMLRVNKL
A0A3C1VJ32      ----------------------LGSLLAQYHEAQRKIAALK---VDYSPANLDVTRVQTL
A0A7W1VTI1      ----------------------LVSLLESWTLANQRFSSAV---EDFGREHPEVRKLQRL
A0A7V4IGZ6      ----------------------FSSLSEQLNLAEQALIKIS---KDYGPESPTYKTAKEL
A0A2N9NTX7      ----------------------LNSLMEQVTVADQRLVMVQ---KDYGPENDETKKARES
B9XK55          ----------------------LIQLLQDLIGAETKLVTLL---ADYGDKHPEVLRTQKL
A0A2A2RGF2      ----------------------LARRLEEHSAAEKEFVSKG---KDLGPNHPDYVRMQAL
A0A2G4I5Y6      ----------------------LSRRLEEYSAAEKEFVSKG---KELGPNHPDYVRMQAV
A0A6N6PS97      ----------------------LNTHLRDLAKIEQQLAQSR---KDYSDEHPEIQKLTAV
A0A3M1I883      ----------------------LPKRIDDLDVVEQNLSKLL---KDYTPENPEVQRYMAL
A0A1V6JZ45      ----------------------LGELLGALSLAQQEVARLR---EDFSNDYPEMKRKLAL
A0A848A4B3      ----------------------LGELLGALSLAQQEVARLR---EDFSNDYPEMKRKLAL
A0A7C7Z746      ----------------------LETLLAEKYQAQQELTSLE---VFYGPENTDVQNANAL
A0A520RRW5      ----------------------LTSLLNEFDRGHQQLSQMK---AIHGPDHPQMQASNSL
A0A356NPK0      ----------------------LTSLLNEFDRGHQQLSQMK---AIHGPDHPQMQASNSL
A0A2D7B5P5      ----------------------LTSLLNEFDRGHQQLSQMK---AIHGPDHPQMQASNSL
A0A3D3XGB5      ----------------------LTSLLNEFDRGHQQLSQMK---AIHGPDHPQMQASNSL
A0A2V6F8A1      ----------------------LSKLMMDLATTEANLAKLK---ETLGPQHPDFKGVAAM
A0A2V5TNH4      ----------------------LSKLMMDLSTTEANLAKLK---ETLGPENSDFKAMAAV
A0A2V5X5Q6      ----------------------LSKLMTDLSTTEANLAKLN---AGLGPRNPEFIAMAAM
A0A3R5R2M8      ----------------------LSRQIENYNEAWLEYRKIA---GSAGSRNPIAAGLRDR
A0A411SUQ6      ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPIAVSLRDR
A0A2N8HZF2      ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPIAVSLRER
A0A354E720      ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPITVSLKDR
A0A7T8XNA1      ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPIAVSLRER
B2UPB6          ----------------------IARQIEHYNEAYLEYQKIA---GSAGSQNPIAVSLRDR
A0A1Q6UHJ9      ----------------------LPQISKLLTDKSSQQVFVASAEKRYKEKHPRMIEARKA
A0A2V2BXR0      ----------------------LPQISKLLTDKSSQQVFVASAEKRYKEKHPRMIEARKA
A0A3C1HEJ2      ----------------------VSAAMIAVLTQENAMDLVK---RDLKPKHPDYIKAQTQ
A0A522ULD9      ----------------------LNSLRQQVTDTQVSLKLML---ENLGENHPDVKRLRAG
A0A7W1RNH4      ----------------------ASEILRSLSSVEDERAKLL---TRRTAADPDVAVLTNR
A0A2D8V0G3      ----------------------IQQLRVSLAAAEAELASLE---VKYLEKWPAVIVAKEQ
A0A348S017      ----------------------IKTIRANLVMAKTDLAALQ---VKYLEKWPAVIEAKER
A0A3C1UUV7      ----------------------IKTIRANLVMAKTDLAALQ---VKYLEKWPAVIEAKER
A0A350I3V2      ----------------------IKTIRANLVMAKTDLAALQ---VKYLEKWPAVIEAKER
A0A520RGV5      ----------------------IKTIRANLVMAKTDLAALQ---VKYLEKWPAVIEAKER
A0A3D3XF90      ----------------------IKTIRANLVMAKTDLAALQ---VKYLEKWPAVIEAKER
A0A2D7B522      ----------------------IKTIRANLVMAKTDLAALQ---VKYLEKWPAVIEAKER
A0A356NIC2      ----------------------IKTIRANLVMAKTDLAALQ---VKYLEKWPAVIEAKER
A0A832MDW4      ----------------------VKDLQRQLTTLENDLAVLL---KRYKDKHPTIIAARSR
A0A1V6JU76      ----------------------VNSLQLQLSGQENELAGLL---KRYKDKHPAVIQARSK
A0A848ABG7      ----------------------VNSLQLQLSGQENELAGLL---KRYKDKHPAVIQARSK
A0A2A2XXW5      ----------------------VAYLRKQVNDNSSKLAGLR---TKYRERHPRVIQPATQ
A0A6N6Q6V0      ----------------------VNQLKVTLSQTASQFAGVT---NRYGPKHPTYTTLAST
A0A2V6JLK8      ----------------------VQKILPNYQDTVAQEALLLN--SGLGEDHPKVKSVRAA
A0A2W5Z1A5      ----------------------TLKILPNYQDAVAQEASLLN--SGLGENHPKVKALRAQ
A0A2V6EA09      ----------------------IQKILPNYQEAVAQDAFFLN--SGLGENHPKVKALRAT
A0A2V6GQI7      ----------------------IQKILPNYQETVAQDAFFLN--SGLGENHPKVKALRAT
A0A7W1U7K0      ----------------------IQKILPNFQEAVASEAQLLN--SGLGENHPRVKALRAT
A0A7W0YDK6      ----------------------VQKILPNYQEAVANEATLLN--SGLGPNHPKVKALRAT
A0A7V9EPY1      ----------------------ILKILPNYQEAVANEAQLLN--SGLGENHPKVKALRAT
A0A838TCM2      ----------------------VLKILPNYQEAVASEAQLLN--SGLGENHPKVKALRAT
A0A2N8HDG3      ----------------------VSRQIEAYNTAYLEYQKVA---GSAGGQNPIVVTLTKK
A0A3E1ET42      ----------------------IKALYPEYQKSVIEESRLLN--SGFGKNHPKIRGLRES
A0A2A2YDW8      ----------------------LKSLFPEYQEQVRMLSGMQV--QGLGPRHPNVLAQEST
A0A352XLN9      ----------------------LKSLFPEYQEQVRMLSGMQV--QGLGPRHPNVLAQEST
A0A3D0YP62      ----------------------FREAYNKFEDAKAELQTAKA--SGLGNKHPDIVMRTTR
A0A3D3DV47      ----------------------FREAYNKFEDAKAELQTAKA--SGLGNKHPDIVMRTTR
A0A7Y1UNY2      ----------------------VTTLYEAFQSTVRELDALRA--SGLGARHPNVAMLARK
A0A2E5XJ49      ----------------------VPELHRAWMAGKRSIATMEA--SGLGRKHPNIRMALIA
A0A2E6SBY8      ----------------------VPELHRAWMAGKRSIATMEA--SGLGRKHPNIRMALIA
A0A2E5QMS4      ----------------------VPVLRARIQESKLNMAAMEA--SGLGRKHPSMEMSLIA
A0A2E7YXQ3      ----------------------VPVLRARIQESKLNMAAMEA--SGLGRKHPSMEMSLIA
A0A2E3H787      ----------------------VPVLRGRLQESKVNIAAXEA--SGLGRKHPQVEMGLIA
A0A2E7AGN1      ----------------------VPVLRSRFQESKVNIAALQA--SGLGRKHPSVEMALIA
A0A2E7AKY7      ----------------------VPVLRSRFQESKVNIAALQA--SGLGRKHPSVEMALIA
A0A3D4CU34      ----------------------VPVLRSRFQESKVNIAALQA--SGLGRKHPSVEMALIA
A0A2E8M146      ----------------------VPVLRGRYQESRVNIAALEA--SGLGRKHPSVEMAYIA
A0A355S8S2      ----------------------VPVLRGRYQESRVNIAALEA--SGLGRKHPSVEMAYIA
A0A2D6DVN8      ----------------------VPVLRARYQEGKVNIAALEA--SGLGRKHPSVEMAYIA
A0A3C1W2R2      ----------------------VPVLRARYQEGKVNIAALEA--SGLGRKHPSVEMAYIA
A0A2E3NAY6      ----------------------VPVLRARYQESKVNIAALEA--SGXGRKHPSVEMAYIA
A0A2E3II01      ----------------------VPVLRARYQESKVNIAALEA--SGLGRKHPSVEMAYIS
A0A368B8C5      ----------------------VPVLRARYQESKVNIAALEA--SGLGRKHPSVEMAYIS
A0A3R7RBB5      ----------------------VPVLRARYQESKVNIAALEA--SGLGRKHPSVEMAYIS
A0A2A2QX62      ----------------------IPVLLPQFQSAKREYDSAMS--SGLGERHPKMVSLATN
A0A4Q3BWH6      ----------------------IPVLLPQYQEQKRTYEAMKS--QGRGERHPMMVSQATT
A0A858RHU7      ----------------------IPTLLPQYQEQKREFEGMKS--SGLGSRHPTVEGQAAI
A0A7V7VLV5      ----------------------VQTLYPKYLEQKTQFQGLKR--GGLGLQHPTMLAQTQM
A0A3N5WCF1      ----------------------IRTLYPQYQEAKRQLDGLKI--SGLGDRHPTILVAVDQ
A0A4Q3C1K5      ----------------------IRNLYPLYLEAERTLESLKI--KGLGDRHPTILAAKDQ
A0A3D1TI55      ----------------------YNTLNQQLVEAEIAYRAAE---ENYGPKHPEMVKFQTT
A0A3R8IT45      ----------------------VAQLSQLVSMRKIEVKQLR---DRYKDKHPKMIEANNA
A0A2A2PYE8      ----------------------VVQLGQLLAERKIAIATLR---ERYRDKHPKMIEALNS
A0A2T6CN73      ----------------------IVELLKQLAAQKVQLEQLG---ARYRAKFPKMIEAQNS
A0A2G4G428      ----------------------VASFGSKISDLRVAVRTME---EKYTDEHPTLIQARAQ
A0A6N6PCD8      ----------------------VQEALKLITTKESEFSQIK---KRYLELHPKYIQTQSE
A0A139TUL1      ----------------------IAKQIELFNDNFLQYKKLS---ASAGKQNPMVSSLAEN
A0A2N8HCB0      ----------------------IAKQIELFNDNFLQHKKLF---ASAGRQNPMVSSLAEN
A0A2N8HP04      ----------------------IAKQIELFNDNFLQHKKLF---ASAGRQNPMVSSLAEN
A0A2N8HRJ0      ----------------------IAKQIELFNDNFLQHKKLF---ASAGRQNPMVSSLAEN
A0A6N2U9Y7      ----------------------IAKQIELFNDNFLQHKKLF---ASAGRQNPMVSSLAEN
A0A6N6PAZ1      ----------------------TLEVHKTLDIKENELAALQ---RRYLPKHPKMITASAE
A0A7V7VK26      ----------------------ALEIHKSLDTKENELAAML---HRYLPKHPKMITAIAE
A0A6I1K459      ----------------------VQSLKEKIQAQETSLANLK---LRYREKHPAMIQAHTE
D5ENH7          ----------------------VASLLQNISATKIEIASLS---KRYREKHPMMIQQLQT
A0A0R2XQ77      ----------------------VAGLLDRISGVKIGISSSS---KRYREKHPVMIEQLQI
A0A2E9IN28      ----------------------VSSLLQRISGTRISISSLS---KRYREKHPAMIQLLQT
A0A6N4WTJ5      ----------------------VSNLLEQISGTKIQISSLS---KRYRDKHPVMIQQLQT
A0A366HAG0      ----------------------IRRMGPTYQELLLKQQSLAT--AGLGRKHPTMRGIAGS
A0A2U8DZK4      ----------------------TQRLQQIYLEAEQNVTKLS---ARLGEAHPEMIVAREN
A0A2T6DFL8      ----------------------IQNLLQAYLVADQKVTQLQ---GRLGEAHPDLIAAVDN
A0A1D8AWD4      ----------------------IQNLLQAYLISDQTVTRLM---ARLGAAHPDLIAAIDN
A0A4Q1C9S2      ----------------------IQSLLQAYLVAEQNVTRLM---GRLGSAHPDLIAAVEN
A0A178IH18      ----------------------IQNLLQAYLVADQNVTRLR---SRLGEAHPELITATDN
A0A2T6DT99      ----------------------IQNLLQAYLVADQNVAKLK---TRLGEAHPELIAAMEN
A0A1G3ZT33      ----------------------IQNLLQAWLVADQTVARLK---SRLGEAHPDLIAAVDN
A0A3E1E2T2      ----------------------IQNLLQAYLLADQNVTKLK---ARLGEAHPDLISAIDN
B1ZMW1          ----------------------IQNLLQAYLVADQNVTRLQ---SRLGEAHPDLIAAVDN
A0A3M1I8A3      ----------------------VIELQKRLTGYRTDLGAML---QRYGEKHPAVVTLRSQ
A0A4V0XS84      ----------------------IQELKKSLTEKESQLANLT---QRYRDEHPTIVRLRDE
A0A351WE84      ----------------------IASIRQQLIDTEVALKLML---ENMGVNHPDVKRLQAG
A0A7W1MRT6      ----------------------VEALFAQLVQLRTRRDTLTVGNWGAARSNPDVIKLDTL
A0A7W1YXK2      ----------------------VLEAKKRVAEDEAQIAMLR---LRYRAEHPKFLEAQSE
A0A2D5WGA5      ----------------------LDALIRELHTGQQTLANQS---IDLGEQHPRIKGLKKV
A0A2E7SSH2      ----------------------LDALIREFQTGQTTLANKS---IDLGEGHPTIKSLKAA
A0A832HNU4      ----------------------VEVFRQQLAEKQLALVVLR---QRYKEKWPAVITAKAE
A0A1V5QDZ6      ----------------------LQAIRAQLIDSEVTLKLML---ENYGAKHPEVLRVQAG
A0A4Y8P964      ----------------------TVDLKKNLLKEQAKYHELE---DIYKEEYPKMSRIKAE
A0A3D4HF88      ----------------------VQDLQSQLSELKVSQSSAA---KRYREGHPRMISINQS
A0A1V6J089      ----------------------LLSIRQQYIDSQVSLQLMLKN-GVVGENHPDVLRLRGA
A0A3C1BZR1      ----------------------LMGIRQQLIDSQVSLQLMLKN-GVMGENHPDVLRLKGA
A0A848WTQ6      ----------------------IAQVYPQYLDQSIALERMRN--LGLGAKHPKVLALSKE
A0A6N6ZHN8      ----------------------IPSLLQRLSEAKIGLAGLQ---ERFRDKHPKMIAARQT
A0A6G6K641      ----------------------VRLAQERWAQEEANLRAIS---ARYREKHPRHIDQVAR
A0A849Y642      ----------------------IPGLISAVMDAERTMETLKA--SELGPNHPDVVKAKKS
A0A7C4KLL2      ----------------------VQALRSALSKSEQDFKILS---LRYKDKHPKYIDAAVQ
A0A1H6KPB7      ----------------------VRELYTRSQTEESTLSKMHM--DGYGEKHPALLSMVQE
A0A2E9ISN4      AETPPEAAKNYGAYDHLNTGIQWQETQVRLDELQNEYKQLA---AVFKDTHPRMIDLKGE
B9XAX1          ----------------------VMETRRRVVEQEAQVATLL---LRYKPNYPKMLQAQRQ
A0A5R8KKM9      ----------------------IRTIGPAYQGLLMRQESVAG--SGLGPKHPTMISLGKE
A0A7W8DJ38      ----------------------VSSILTQLQTQKASLALIA---ERYKPKHPKYEAIQVV
A0A7W1ZQ43      ----------------------VSELRKRLVEQETRVALLA---VEYQPTFPKLRQARQQ
A0A139TS01      ----------------------LRKTYQEYMEKDKERENLKA--QNLGPKHPKMVALQET
A0A3E1EJT7      ----------------------VGQLLVQVTTQKLSVTQLR---DRYKDKHPRLIEAVNA
A0A848WYP9      ----------------------IAKLLLFRNQKRAEFAKVR---RQFTPSHPTYKDFEDE
A0A7C3I5X9      ----------------------VRSLQSQLATLENELAGLL---KRYKDKYPAVIQARSR
A0A349GXM8      QTDETIQG--------------FQNLRVRLMRLEADQAELL---KVLKDDHPRLKAVRDE
A0A7V3QFN7      ----------------------LSSYLEQLANAEQRLVLLR---RDYGPNHPEVVKVTEQ
A0A4P5YP61      ----------------------VRDIKSNLSKFESEFATIK---QRYLPKHPKYMGTLSA
A0A6B2LYM4      ----------------------VSDLLNKLTVNKIQIATLS---KKFRAMHPTMIAAQEQ
A0A6D1VXB3      ------PD--------------SPFTVDLKKILLKEQAKYRELEDIYKEEYPKMSRLRTE
I0JYY7          ------PD--------------SPFTVDLKKILLKEQAKYRELEDIYKEEYPKMSRLRTE
A0A4Y8P842      ------PD--------------NQYTMDLKKNLLKEQAKYRELEEIYKEDYPKMVRLKAG
B3DZK9          ------PD--------------NQYTMDIKKNLLKEQAKYRELEEIYKEDYPKMVRLKAG
A0A4R7S1J2      ----------------------LNGISTALAARRSEFAALQ---SRYKSKHPKYTAAQSD
A0A2A2XV69      ----------------------ITQMLPQFQEVASEEARLLN--SGLGVNHPTVKSMRAK
A0A651H7X9      ----------------------VNDLRARLAAKEIEMAQLR---DRYRDLHPTMIEARNS
A0A5E6MPC4      ----------------------LLKEEAKYREME----------EIYKPEYPRMVQVHAE
A0A840V0I7      ----------------------YQGVLDTLKSLEEKEAVALELSRRYLPKHPKMMAAQSE
A0A146G2Q9      ----------------------ITQLYPQFQEAASEEARMLN--AGLGANHPNVKALRAK
A0A2T6D3Y2      ----------------------ITQLYPQFQEAASEEARMLN--AGLGVNHPNVKSLRAK
A0A6N6PKP9      ----------------------VVEVQRKIGEKEAELATLS---RRYKPEYPKYLEATGS
A0A6N6Z250      ----------------------IQQLAQAYLVQQQEVERLR---SQLGEKHPELASRVAK
A0A4V1SB02      ----------------------LPDVLRARTAVMEKEAAFATVLERYKSKHPKYGEAQAQ
A0A6N6QEJ2      ----------------------LTALIASLNLAKQKQRQLS---PDLGPEHPEVKRVIGL
A0A3C1VB86      ----------------------MVQISTDLARLENDFAVIR---QRYREAHPKYILAASS
A0A6N6P5E3      ----------------------ISQILPQYEACVSEEARMLN--SGLGPNHPSIKSLDAK
A0A838I246      ----------------------IQKIQPIYQETVAQEALLLN--SGLGENHPKVRALRAT
A0A6J4HTK1      ----------------------IQKILPNYQDAVAQEALMLN--SGLAENHPKVRALRAT
A0A838FVV7      ----------------------IQKILPNYQDAVAQEALMLN--SGLAENHPRVKALRAT
A0A7C3HWX0      ----------------------LPKLLHDLTTSEQMLARLL---QDYSPEHPEVKSARAV
A0A7V4LSC4      ----------------------LPKLLNDLKSTEQLLAKLL---QDYSPEHPEVQAYRAM
A0A2D5VY59      ----------------------LTHLLNEYDTTRQALARLS---AIHGPEHPERKSLYTL
A0A2D8UZZ4      ----------------------LTHLLNEYDTTRQALARLS---AIHGPEHPERKSLYTL
A0A353DV86      ----------------------LTHLLNEYDTTRQALARLS---AIHGPEHPERKSLYTL
A0A2E5EPT8      ----------------------LPRLYEQLATAQQELVAKG---KELGPKNPEIERMTKV
A0A5B5WZ91      ------DS--------------LRKTYQEYMEKDKERETLKS--QNLGPKHPKMVALQET
A0A2N8HD92      ------KA--------------LRETYAEFSEKLKEKENLKA--QNIGPKHPKMLALVET
A0A2N8HIT2      ------KA--------------LRETYAEFSDKLKEKENLKA--QNIGARHPKMLALLET
A0A354EBD3      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGPKHPKMLALLET
A0A355VEB2      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGPKHPKMLALLET
R6K1U5          ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
A0A2N8IWC2      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
A0A2N8I441      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
A0A2N8I3A6      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
A0A410SCC4      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
A0A3R5VEW0      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
A0A7T9B0I0      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
B2UKW3          ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
A0A411SSG2      ------DA--------------LRKTYAEFSDKLKEKENLKS--QNIGARHPKMLALLET
A0A6M1RXR2      ----------------------LTELLQSLNLAEQALIQLR---RDYADEHPTVVTVRKQ
A0A7C3DXS4      ----------------------LTELAQSLNLAEQTLIQLR---RDYADEHPTVVTVKRQ
A0A7V6YXH8      ----------------------LMAYFNSLNEAEQVFRSVS---RDYNEAHALYQNAQSN
A0A2V2SDV4      ----------------------LTSWLEQRNMLQQRFIALT---NILGERHADVVTVQSQ
A0A6N6PHJ5      ----------------------LSSLIGELNAADQKYVSQI---NDLGPSHPQIQAVNDL
A0A7Y4QKN3      ----------------------LTAMIDQQRAAKQGIIAKR---SELGESHPEYLKILTF
A0A2V5PK75      ----------------------LSSLLEQKNMTEQALVIRQ---KEYGDKHVEVIKLQRQ
A0A1V6DME1      ----------------------LAELLQQLNLVEQERIRLA---RDLTDDHPAVVTVTRQ
A0A3D3DIJ3      ----------------------LTSLLDQLTMAEQRLIALE---ADYGPENTEVLKCKGL
A0A7X7VJR5      ----------------------LTSLLDQLTMAEQRLIALE---ADYGPENTEVLKCKGL
A0A6I1K583      ------------------------LLTKRLDELSLAEKEFISKSKDLGPLNPEYARMKDV
A0A350EWA4      ----------------------IVNFAGMFQSEADAERQLAGLLGQFGRDHPTVMSAQAE
A0A832D3W5      ----------------------LLSSYLEQLANAEQRLVLLR--RDYGPNHPEVVKVTEQ
A0A7V2G542      ----------------------VSKVLPLFQDAEAAEVRMLN--SGLGPKHPDVLALRAQ
A0A7C4KPD7      ----------------------ILMGLLEDLNKTEQQLALTA--QDYGEAHPEYKRLVEL
A0A832MGU4      ----------------------LSDLLNKLAETEQKR-ALNE--ADYAKDHPVMVALDKL
A0A1M6RLZ4      ----------------------VQNLNEMYLDASRERGSLIA--AGLGANHPRVKMSRTR
A0A832M6Y9      ----------------------ITNTKQNYLQADAFLESLKK--QGIGSDHPRMQQAVAQ
A0A832HP42      ----------------------LPQLLSEL-ALAEQTLAQRR--VDYSSEHPDVKRAAAL
A0A354T7G8      ----------------------LASNTTEYNKLIVQREGLMN--AGMGRRHPNVESLSSQ
A0A512MBZ2      ----------------------LTSMTAEYQKLQITREGLSQ--QGLGRKHPLVQTADKQ
A0A2E8MEZ0      ----------------------VTSYYTGYRAADEQVSAMIA--SGLGPNHPEVKAMRLR
A0A7Y2T9S5      ----------------------FREAYNKYEDAVAELQTMKA--SGLGNKHPDIEMRRTR
A0A851GRQ2      ----------------------FQEYYNKYIEAKRELQQMLA--QGFGENHPDIVMRKTG
A0A6B3LBV6      ----------------------IQRYYPMFNDLLLEEQQALE--SGLGANHPTVRAIRTQ
A0A840UX61      ----------------------IRTLHPQYLEAQRTLDALKA--GGLGENHPNVRQQKEV
A0A4Q2YKS3      ----------------------VKTLYPQYLEMQNNLDAAKT--QGFGDRHPTVLELSGR
A0A6N6P3T8      ----------------------VQTLYPKYLEQKTQFQGLKR--QGLGLQHPTMLANAQM
A0A8A7W668      ----------------------IKTLYPQYLDLKRQIDGLKA--SGLGDRHPTIISQNLI
A0A2E3EC33      ----------------------LSSGWSSYQALELSRAALVE--SGVGNKHPKIINIDSQ
A0A2E4GN01      ----------------------LSNGWSSYQTLELSRAALVE--SGVGKKHPKILNIDKQ
A0A800JJX7      ----------------------LSTGWSSYQALELSRAALVE--SGVGEKHPKILNIDSQ
A0A1Z8XU55      ----------------------LTSGWTEYQSLELNRAALVD--SGVGIKHPKILNIDSQ
A0A2E1RQR9      ----------------------LTSGWTEYQSLELXRAALVD--SGVGXKHPKILNXXSQ
A0A2E3ISQ4      ----------------------LNSGWSEYQTLELSRAALID--SGVGVKHPKIVNIDSQ
A0A2D6W6F4      ----------------------LNSGWSEYQTLELSRAALID--SGVGVKHPKIVNIDSQ
A0A2D8Z5A8      ----------------------LNSGWSEYQTLELSRAAXID--SGVGVKHPKIVNIDSQ
                                                                            

A0A2A2XVF1      AESLKKSL----RESAGKAGDILNRQ---------YEAACQTE----SK----------L
A0A2V5UHJ2      LEETRRHL----NSEIDKEVKGIEAG---------FAAARNKE----SE----------L
A0A2V5PST3      IKEATQSL----NTEINNVVRGIREN---------YVAARAKE----QA----------L
A0A2V5PXM3      LVEWKNTL----TNAVLNVPQVVRSL---------YESARTAE----AA----------L
A0A1V5QB01      LKEVQDAL----NIELQFALRQYYAQ---------LEALSIRE----QA----------S
A0A800JGC6      LKSHKDSF----DTELKQVSVISPVE---------------------KE----------Y
A0A7Y2T8X5      LNDLKQRF----RREITAVSQLPSELEFWAQHREQVDFYNQAV----EKSGVADPMVSPV
A0A1J4XH17      KEQTEIEL----KSALDSSINKVYAN---------YDHARDFL----IQ----------S
A0A7C5LI63      LNEVKDNI----QYQVRLARDIQRSE---------VAFLEQQL----AE----------T
A0A7C5P291      LQELGEKI----DAEIQFIREKVNAD---------YQLAKQRY----EQ----------I
A0A290QGD9      LSQIDAEL----AKATAEAASIVEGD---------YQSALRNA----DE----------A
A0A1D8AS58      LTQTEKEL----GRAIDSMAATVEAD---------FQTARRND----ED----------A
I6AQC1          LTQAQLEL----QKAVKIAAELVKSE---------YEAALNSN----KE----------A
W0ITH7          LTQAQLEL----QKALKIAAELTKSE---------YQTAFNAD----KE----------A
A0A139SU05      IIITQEHL----DLAVQGAIADLKTS---------LIEVKKTI----AQ----------L
A0A139SPN4      IITTQEHL----DFAVQGAIADLHAS---------LTEVNKTI----SQ----------L
A0A1V6E7N1      LRVAQEQL----RTQVSLAIADLKSR---------LAKTADSE----RT----------F
A0A2D9MYT1      IEALQESL----KNAENRIFDSIMNK---------AKLAKATD----VQ----------L
A0A258ANJ7      IHNQEQQL----TTILDDAFHLLQSS---------WEHARELE----HR----------L
A0A1Z8ZMT6      INLKTKIL-------LSAMKDVLSSD------------LETDYWRGFQD----------Q
A0A2E8MCT7      IDLKTKIL-------LSAMMDVLSND------------LETDYWRGFQD----------Q
A0A139TLN4      LASLKDAL----KRSVNNYYTSLLVK---------KKNVEEQH----EG----------T
A0A1G3ZFT0      IAMLHEEK----KELLNEVKKLPLMD----------------------------------
A0A5B5WI95      MDSTLSAA----NKALANYRSNQNLK---------LEELKKKR----ET----------L
A0A2N8I9W1      MNSTRAAA----NKALSNYRSNLNLK---------LNQLISKR----DS----------L
A0A4Q5IH27      MNSTRAAA----NKALSNYRSNLNLK---------LNQLISKR----DS----------L
A0A2N8IBZ6      MNSTRAAA----NKALSNYRSNLNLK---------LNQLISKR----DS----------L
A0A7G6DX28      MNSTRAAA----NKALSNYRSNLNLK---------LNQLISKR----DS----------L
R6J100          MNSTRAAA----NKALSNYRSNLNLK---------LNQLISKR----DS----------L
A0A139TV24      MDATRAAA----FRSLSNLRDNLNLR---------LQELTRKR----ED----------I
A0A2N8HT11      MDATRSAA----SRSLDNLRNNLELK---------LQELTRKR----QD----------I
R7DS70          MDATRSAA----SRSLDNLRNNLELK---------LQELTRKR----QD----------I
A0A2N8HNL6      MDATRSAA----SRSLDNLRNNLELK---------LQELTRKR----QD----------I
A0A290Q2Z2      RAKIKEQL----DAQLRGYESALEIA---------YKEADARV----AE----------L
A0A2A2RGK2      IDLTKADL----KRVLKDAVTLLANS---------RNRLEVQS----TE----------M
A0A2A2XXF7      IDLTKADL----RRVLNDAVNLLESA---------RNRLEVQA----NE----------T
A0A146GCJ0      IANLRQSL----ATEATQASETLSRL---------YEAAKDSE----VK----------L
A0A2T6D6H8      IANLKQAL----DSEVKQAGETLSRL---------YEASRESE----MK----------L
A0A6B3L938      YEDLYNRF----RREIDTASRTTEERDFWGLKRDEMRELDIEVRTAQTP----------S
A0A2A2R5D6      LAKIDEQI----NANAAGKRRALEID---------VQVTKARV----TQ----------L
A0A2V5URB2      LQETRSKL----AQQIRSVVEGINSA---------YLAAAGKE----RA----------L
A0A2V2DJ66      LDQVDKEL----AAALDSAYEKVRST---------YLTMKNNY----EM----------S
R7L5A9          LDQIEKEL----ALAVDAAYAKVQAS---------YETARQNY----EQ----------S
A0A5B5WU87      LSSLKDAL----KRSVNNYYTSLLVK---------KKNIQDQH----EK----------T
R7DZW0          LNSLKDAL----KRSVNNYYTSLLVK---------KKNVQDQH----EQ----------T
A0A2N8HID1      LNSLKDAL----KRSVNNYYTSLLVK---------KKNVQDQH----EQ----------T
A0A2N8HS06      LNSLKDAL----KRSVNNYYTSLLVK---------KKNVQDQH----EQ----------T
A0A6N2TNT9      LNSLKDAL----KRSVNNYYTSLLVK---------KRNVQDQH----EQ----------T
A0A4P5QM05      REVYAKIL----SDQLDSIKRSLNTR---------LGIEEATL----KT----------F
A0A4Q3C001      SAVYRQNL----DNALEAIRRAQATN---------LKVSEDTL----AA----------L
B4DB23          MATYQKIL----GDQLNTIKITQANR---------LRLEKDKL----SG----------L
A0A5R8KA81      LKDLQRSQ----LENIALAAEGMENA---------YNSALATE----QK----------V
A0A2E6T482      VATLEGQI----DDRIKGVLAGLELR---------VKSSKAQV----EE----------L
A0A3C0DQZ7      VATLEGQI----DDRIKGVLAGLELR---------VKSSKAQV----EE----------L
A0A1Z9CBK5      LESLDQQI----DNRIKGILAGLELR---------VQSSLAQV----XE----------L
A0A2D6ZI96      LESLDQQI----DNRIKGILAGLELR---------VQSSLAQV----XE----------L
A0A358KGZ3      MESLNQQI----DNRIKGILAGLELR---------VNSSLAQV----RE----------L
A0A2E9ZQX4      MESLNQQI----DNRIKGILAGLELR---------VNSSLAQV----RE----------L
A0A3D5JZU0      MESLNQQI----DNRIKGILAGLELR---------VNSSLAQV----RE----------L
A0A2E6HCR0      LQSFDSQI----QNRIQGILAGLELR---------VSSSLAQV----NE----------L
A0A1Z8WN04      LSTFEGQI----QNRIKGILAGLELR---------VKSSLAQV----NE----------L
A0A2D7L1N4      LSTFEGQI----QNRIKGILAGLELR---------VKSSLAQV----NE----------L
A0A2E2R937      LSTFEGQI----QNRIKGILAGLELR---------VKSSLAQV----NE----------L
A0A520QQY4      LSTFEGQI----QNRIKGILAGLELR---------VKSSLAQV----NE----------L
A0A2D5MR66      LQSFEAQI----ENRIQGILAGLDLR---------VKSSLAQV----KE----------L
A0A2E0PDQ1      LQSFEAQI----ENRIQGILAGLELR---------VKSSLAQV----NE----------L
A0A2E2ZZP9      LQSFEAQI----ENRIQGILAGLELR---------VKSSLAQV----NE----------L
A0A4P5YMI6      LEKITAQV----ADRVDGILRGKEAD---------LAAARARD----EE----------L
A0A7C4LRK7      IETLERQV----NDRLDGIIKGLETR---------VISYKARA----QE----------L
A0A3C1VJ32      IDTLDGQI----IDRVAGIMVTLQSQ---------VNSKKASL----DS----------L
A0A7W1VTI1      LDEIDSQL----NDKVDGILKGLANR---------VAATKSSL----DQ----------L
A0A7V4IGZ6      VDDLKQKL----DARVDGLLLGLETR---------VESLRKRV----ES----------I
A0A2N9NTX7      VSDLKQKI----KDRVDGIMLGLQAK---------VASVRESL----DQ----------M
B9XK55          VNELNAKI----DDRVKGIMVGMDAR---------VASLLAVV----KN----------S
A0A2A2RGF2      IVKLNQQV----EDRVSGIMLNLETD---------LKAQAAAL----AL----------T
A0A2G4I5Y6      IVKLSQQV----DDRVNGIMLSLETD---------LKAQAAAL----EL----------T
A0A6N6PS97      AAKLNQQI----EERIEGVLRGVQVT---------MNRSKSVL----DE----------L
A0A3M1I883      KDTLQKQI----TNRLNGILEGMRAQ---------VASFKARY----DE----------I
A0A1V6JZ45      VEQIDQQV----EARLTGILTGLENQ---------VISLKARR----DE----------L
A0A848A4B3      VEQIDQQV----EARLTGILTGLENQ---------VISLKARR----DE----------L
A0A7C7Z746      LDKVNQQI----RDHVRKMIQGYASM---------AAIALDHS----EA----------L
A0A520RRW5      LLTLNDQI----KKEITGVLRGLQTQ---------VNAARNQL----TE----------L
A0A356NPK0      LLTLNDQI----KKEITGVLRGLQTQ---------VNAARNQL----TE----------L
A0A2D7B5P5      LLTLNDQI----KKEITGVLRGLQTQ---------VNAARNQL----TE----------L
A0A3D3XGB5      LLTLNDQI----KKEITGVLRGLQTQ---------VNAARNQL----TE----------L
A0A2V6F8A1      QAHLDEEI----NRRINGILGGLKVR---------VDAFKANL----DT----------L
A0A2V5TNH4      QANLDTNI----NQRIEGMLAGLKLK---------VDAFRLHL----DS----------L
A0A2V5X5Q6      QANLDTNI----NQRINGILGGLKLK---------VDAFKLNL----DT----------L
A0A3R5R2M8      MESTRAAA----NKALANYRNNLDIK---------LKELNAKR----DS----------L
A0A411SUQ6      MNSTRAAA----NKALSNYRSNLDLK---------LNQLINKR----NS----------L
A0A2N8HZF2      MNSTRAAA----NKALSNYRSNLNLK---------LNQLISKR----NS----------L
A0A354E720      MNSTRAAA----NKALSNYRSNLDLK---------LNQLIDKR----NS----------L
A0A7T8XNA1      MNSTRAAA----NKALSNYRSNLDLK---------LNQLIDKR----NS----------L
B2UPB6          MNSTRAAA----NKALSNYRSNLDLK---------LNQLINKR----NS----------L
A0A1Q6UHJ9      LDQINKEL----ASAIESAEQKVQAA---------YEAARQNY----EQ----------S
A0A2V2BXR0      LDQINKEL----ASAIESAEQKVQAA---------YEAARQNY----EQ----------S
A0A3C1HEJ2      LAAAQSQL----TNAVLKVVGAYATK---------LSAAKAEE----QE----------L
A0A522ULD9      LEELRQRL----ADGLAGMKKGLEAD---------YQVAKAKY----NV----------L
A0A7W1RNH4      ITELEDQL----RQIAVTYEEGLKNQ---------VAAEDASM----AA----------F
A0A2D8V0G3      IRKLTDEI----QQQAGQELKILREQ---------ARFANERA----DR----------A
A0A348S017      IVKLTEEI----QKVAQDEIDLLREQ---------ARYQQARA----VR----------A
A0A3C1UUV7      IVKLTEEI----QKVAQDEIDLLREQ---------ARYQQARA----VR----------A
A0A350I3V2      IVKLTEEI----QKVAQDEIDLLREQ---------ARYQQARA----VR----------A
A0A520RGV5      IVKLTEEI----QKVAQDEIDLLREQ---------ARYQQARA----VR----------A
A0A3D3XF90      IVKLTEEI----QKVAQDEIDLLREQ---------ARYQQARA----VR----------A
A0A2D7B522      IVKLTEEI----QKVAQDEIDLLREQ---------ARYQQARA----VR----------A
A0A356NIC2      IVKLTEEI----QKVAQDEIDLLREQ---------ARYQQARA----VR----------A
A0A832MDW4      IDETRKSL----DRAVQNLVETLRAE---------ARLTRVTE----QT----------I
A0A1V6JU76      IEETHRSV----QGAAQQVAEILRSE---------ARLAKASE----QI----------L
A0A848ABG7      IEETHRSV----QGAAQQVAEILRSE---------ARLAKASE----QI----------L
A0A2A2XXW5      LQADTQKL----RDESERALQGIFQM---------AELEKSRE----VE----------A
A0A6N6Q6V0      LANARESL----DAQVQRVLKSLEAT---------ATIEKNTE----AQ----------A
A0A2V6JLK8      RQVYTRQL----EQQVGIIRQGLERN---------LKTAQGTR----DE----------L
A0A2W5Z1A5      KQVFARQL----QEQVGIVRSALEKN---------LKTAEKTR----DE----------L
A0A2V6EA09      KAVYAKQL----EEQMASIRSALEKN---------LKTAQTTR----ER----------M
A0A2V6GQI7      KAVYAKQL----EEQMASIRSALEKN---------LKTAQTTR----ER----------M
A0A7W1U7K0      KAVYVRQL----EQQVTSVREALQRN---------LNSARETR----DQ----------L
A0A7W0YDK6      KAVYVRQL----EQQVSSVRDALARN---------LKSTEATR----DE----------L
A0A7V9EPY1      KEVYVRQL----EQQVASVRDALRRN---------LNTAQTTR----DE----------L
A0A838TCM2      KQVFVRQL----EEQVVSVRDALQRN---------LNSARATR----DQ----------L
A0A2N8HDG3      MDATRSAA----ARSLDNLRNNQKLQ---------LQELTKKR----EN----------I
A0A3E1ET42      INTTRKTL----ETAVSGFKDSLKVQ---------ISQAEQTL----AK----------G
A0A2A2YDW8      VDSLFKQL----QASVVSFKDSLKIK---------RETKNVEL----VE----------L
A0A352XLN9      VDSLFKQL----QASVVSFKDSLKIK---------RETKNVEL----VE----------L
A0A3D0YP62      IEELKKGL----EKRAVNVRQSLTHK---------LGIIEGRV----NK----------M
A0A3D3DV47      IEELKKGL----EKRAVNVRQSLTHQ---------LGIIEGRV----NK----------M
A0A7Y1UNY2      VDSIKGDL----ERTVVALREILQTQ---------LELVESRL----EK----------M
A0A2E5XJ49      QDKLEEDL----RSAVVTLKDLLRTQ---------LELVDGQL----EK----------L
A0A2E6SBY8      QDKLEEDL----RAAVVTLKDLLRTQ---------LELVDGQL----EN----------L
A0A2E5QMS4      QNKMQEDL----GGAVVVLRELLKTQ---------LRLVNGQL----AK----------I
A0A2E7YXQ3      QNKMQEDL----GGAVVVLRELLKTQ---------LRLVNGQL----AK----------I
A0A2E3H787      QAKIEEDL----KAAVVVLRELLKTQ---------LSLVXGXL----EK----------I
A0A2E7AGN1      QEKLQEDL----KASVVVLRELLKTQ---------LDLVNGQL----VK----------I
A0A2E7AKY7      QEKLQEDL----KASVVVLRELLKTQ---------LDLVNGQL----VK----------I
A0A3D4CU34      QEKLQEDL----KASVVVLRELLKTQ---------LDLVNGQL----VK----------I
A0A2E8M146      QSKLQEDL----KSSVVVLRELLKTQ---------LSLVNGQL----VK----------I
A0A355S8S2      QSKLQEDL----KSSVVVLRELLKTQ---------LSLVNGQL----VK----------I
A0A2D6DVN8      QEKLSEDL----KSSVVVLRELLKTQ---------LNLVNGQL----DK----------I
A0A3C1W2R2      QEKLSEDL----KSSVVVLRELLKTQ---------LNLVNGQL----DK----------I
A0A2E3NAY6      QEKLKEDL----KSSVVVLREXLXTQ---------LNLVDGQL----EK----------I
A0A2E3II01      QKKLSEDL----KSSVVVLRELLKTQ---------LNLVNGQL----EK----------I
A0A368B8C5      QEKLSEDL----KSSVVVLRELLKTQ---------LNLVDGQL----EK----------I
A0A3R7RBB5      QEKLSEDL----KSSVVVLRELLKTQ---------LNLVDGQL----EK----------I
A0A2A2QX62      LVAMEKQL----DEAVANLRETLKVK---------LELSKEQL----AR----------L
A0A4Q3BWH6      LEGMERDL----TEAVANLRETLKAK---------LSLSQEQL----AR----------L
A0A858RHU7      IDKMQQDL----VEAVANLREILKAK---------LELAKEQS----LK----------L
A0A7V7VLV5      LESMKKQL----DEGVVSLRDTLQAK---------LELAEARF----KR----------A
A0A3N5WCF1      IENMKRQL----DEGVVNLRATLQAQ---------LDLAVNRL----KS----------V
A0A4Q3C1K5      IAGMKKQL----DEGVVNLRATLQAQ---------LDMATDRL----KN----------V
A0A3D1TI55      IDELRRAK----EQKLVAIKEGLASR---------YDVAQRRV----EN----------L
A0A3R8IT45      LAQAELEL----KRAVDSAAASVISE---------YETAKNAD----TE----------A
A0A2A2PYE8      FQQTEREL----KRAVENVSAQVESD---------FQAASRTF----KN----------L
A0A2T6CN73      YDQIKREL----DRAIASACAQVESD---------YQSALNTY----RQ----------N
A0A2G4G428      LKQTEAEL----QNAIVTSVNRIQVA---------IQNAHANY----AA----------I
A0A6N6PCD8      LRGLRETL----DRAARKGASIALNA---------YQGAKEAE----AK----------L
A0A139TUL1      MKEMRESI----VRSISNYCDVLRVR---------MGELERER----DE----------L
A0A2N8HCB0      MKEMRESI----GRSIANYCNALEVR---------MSELEKER----DE----------L
A0A2N8HP04      MKEMRESI----GRSIANYCNALEVR---------MGELEKER----NE----------L
A0A2N8HRJ0      MKEMRESI----GRSIANYCNALEVR---------MGELEKER----NE----------L
A0A6N2U9Y7      MKEMRESI----GRSIANYCNALEVR---------MGELEKER----NE----------L
A0A6N6PAZ1      LTQLKEQF----IREFEDARQAASDK---------PYWDLAG-----KD----------L
A0A7V7VK26      LQQLKEQF----ALEFEDARQAASDK---------AYWDVVG-----KD----------L
A0A6I1K459      LNSLRQQF----EDEVLKAPVRLSQQ---------LKAAQERE----RG----------L
D5ENH7          LQESEVEL----GEAVQNSVDKVYAS---------YIEAKSNF----EL----------A
A0A0R2XQ77      LQESEVEL----VTAVKDSINKLSSA---------FAESKNNF----EL----------A
A0A2E9IN28      LQESEQEL----AIAVKNSVDKIYAS---------YSEAKSNF----EL----------A
A0A6N4WTJ5      LQESEAEL----VFAVQNSVNKIGAA---------YAESKSNF----EL----------A
A0A366HAG0      LEQTRALL----LEAAQDYRKNLGVR---------ITTVERQL----EE----------A
A0A2U8DZK4      LSKIKTQL----EAQLTGYEFTLKSK---------AEEAEARV----TE----------L
A0A2T6DFL8      RAKIKEQL----DAQLRGYENSLEIA---------YKEAEARV----AE----------L
A0A1D8AWD4      SAKIQQQL----DSQLRGYESSLEMA---------FKEAEARV----TE----------L
A0A4Q1C9S2      GAKIQQQL----DSQLRGYESSLEMA---------YKEAEARV----TE----------L
A0A178IH18      RAKIREQL----DAQLRGYENGLEIS---------CKEAEARV----AE----------L
A0A2T6DT99      RAKIREQL----DGQLRGYENALEIA---------YKEADARV----AE----------L
A0A1G3ZT33      RAKISEQL----DALLTGYEKSLEIS---------CKEAEARV----TE----------L
A0A3E1E2T2      RAKIKEQL----DAQLRGYENALEIA---------YKEAEARV----TE----------L
B1ZMW1          RAKIREQL----DGQLRGYESALEIA---------YQEADSRV----AE----------L
A0A3M1I8A3      IAETEKEL----QQTVKDVIETLRKS---------AELRQIEL----AN----------L
A0A4V0XS84      VRSLRSAF----ERESQALGDGVRAD---------ARIAQSIE----AA----------F
A0A351WE84      VDELKKKL----NESLVGLKIGLNAD---------YEVAKAKF----DA----------L
A0A7W1MRT6      IQTTQGEL-----------VSAVRSN---------IDAVNARL----SS----------L
A0A7W1YXK2      LAQVTADL----NKTILKAGETIGSA---------YEVATVNE----HK----------L
A0A2D5WGA5      VSTLEGQI----DDRIQGVLAGLELR---------VKSSKAQV----EQ----------L
A0A2E7SSH2      LDSLNQQI----DNRISGILAGLELR---------VNSSLAQV----QE----------L
A0A832HNU4      LEEVQEKL----KKACDDAIQAVKGR---------YLTAKAKE----ES----------L
A0A1V5QDZ6      VDELRKKL----ENALNGMKTGLRAN---------YEVALQRY----EV----------L
A0A4Y8P964      IEGLNKEI----NEEKEATIEKLEAD---------YEAAKKHY----ES----------L
A0A3D4HF88      IDETQSEL----TAAVNSAVQKVHAA---------YVISDTNY----NH----------A
A0A1V6J089      QDELRRQL----DSALAGLKAGVKAD---------YEVARQKY----EA----------L
A0A3C1BZR1      VEELRRQL----ASALEGLKAGIKAD---------YEVARQKY----EA----------L
A0A848WTQ6      IDKMREYL----ATGADTIRETLATQ---------LQIATDSL----AR----------I
A0A6N6ZHN8      LQETQQEL----QKAATEAAGRLKKD---------YENAKDNL----ES----------A
A0A6G6K641      VEAAKREL----PAAAMRAAATMKEQ---------YETAKETE----SR----------I
A0A849Y642      YETLKAQL----DGQLGGVMRALKIA---------VDEQEQKV----KL----------L
A0A7C4KLL2      IEAMKRDLHLAATNALARLLEAIKVD---------IEDAKINQ----EG----------L
A0A1H6KPB7      HENTKQKL----TEGLVGLKDALEQT---------LSLKEEGR----KS----------I
A0A2E9ISN4      ITKAQSSL----AHQNELALKRFEAH---------YEALKLQE----AG----------I
B9XAX1          LDDLKDAL----RSLASKAPKLVQSA---------YDGALARE----NN----------L
A0A5R8KKM9      IETARTLL----LDAANDYRNNLAFR---------ITTGERQL----AE----------A
A0A7W8DJ38      INSQEEQL----NVVLADAMHLLESS---------CEHAREME----RR----------L
A0A7W1ZQ43      LVELEKVV----YSFAEKVRSSVQAS---------YDAALARE----KN----------L
A0A139TS01      ANILKEKL----NKELVGLRSSLRSK---------LEMVTASR----VK----------W
A0A3E1EJT7      LNQTEQEL----QASLATAAESIKAE---------YENAVQTD----EG----------A
A0A848WYP9      LAGIEEQV----RLTAGKVADTIRKR---------VKTAEEHE----KN----------L
A0A7C3I5X9      IDDTRQAI----ERAAKAVAEVIRAD---------ARLAKASE----AS----------A
A0A349GXM8      IKSIQDQL----ASMAEVQMRNLRDR---------HRALSIQL----NA----------I
A0A7V3QFN7      IQDLNKKI----DERIEGILKGLQTQ---------VESAKAQV----EK----------L
A0A4P5YP61      LTEWRNAL----TNAVMKIPQTIEIS---------YRGAKSSE----ET----------F
A0A6B2LYM4      LDQTQSEL----DKAVNTAASRFEKD---------FERTEANL----RN----------S
A0A6D1VXB3      IEGLNKEI----SEEKEATIEKLEAD---------YEAAKRHY----ES----------L
I0JYY7          IEGLNKEI----SEEKEATIEKLEAD---------YEAAKRHY----ES----------L
A0A4Y8P842      IEGLNQQL----TDEKQAVVEKLEAE---------YEAAKKNF----ES----------L
B3DZK9          IDGLNQQL----AEEKQAVVEKLEAE---------YEAAKKNF----ES----------L
A0A4R7S1J2      IANLEARF----REALPQVSVSLEAS---------LLASLESAKVNEKK----------L
A0A2A2XV69      KEVMATQL----VTQIASLRASMEAN---------IRIGEDSI----TQ----------L
A0A651H7X9      IQQTRTEL----NQAVEQAAARVHSE---------FQTAERSV----AE----------A
A0A5E6MPC4      IQGLQDEL----NQEKEASVADLDAE---------YEAAKRNY----AG----------I
A0A840V0I7      LETFQKRF----LSEFDSVRNA-QAD---------KDYWQSTH----DE----------W
A0A146G2Q9      KEVMQRQL----AEQTAILRKTLETN---------LAIAEQGL----KS----------L
A0A2T6D3Y2      KEVMQRQL----AEQTAILRKTLETN---------LTIAEQGL----TS----------L
A0A6N6PKP9      LAELKVSL----GEAILKAASLLGTA---------FESTKANE----EK----------L
A0A6N6Z250      LRVLREQL----DDLLAGYEKALKIG---------YLEAQARV----TA----------L
A0A4V1SB02      LSEAKSKL----RTAVANAGDALRQQ---------YRSLTETE----EK----------L
A0A6N6QEJ2      ISEINDQL----DKEVQGMVDALSAQ---------LEIARGNV----RE----------L
A0A3C1VB86      LAGLKGQL----AANALKARARIQES---------LRIAYQNVLTAKQG----------L
A0A6N6P5E3      KRVYAQQL----KNQIAVLRQSLTAN---------LEIAQKSL----QA----------M
A0A838I246      KEVYVKQL----EEQVTSIRSALEKN---------LRSAQTTR----DE----------L
A0A6J4HTK1      KEVFTRQL----EEQVKIIRSALEKN---------LATAGTTV----TE----------L
A0A838FVV7      KEVYTRQL----EEQVVIIRSALEKN---------LATSQATR----DE----------M
A0A7C3HWX0      RDQIEQQV----TERIEGMMLGLESR---------VKSLQERY----EA----------L
A0A7V4LSC4      RDETDRQI----NERIRGIMVGLETQ---------VQAAKGRY----DA----------L
A0A2D5VY59      LEEIETQV----TSEITGVLRGLQSQ---------VNAAQNEL----NE----------L
A0A2D8UZZ4      LEEIETQV----TSEITGVLRGLQSQ---------VNAAQNEL----NE----------L
A0A353DV86      LEEIETQV----TSEITGVLRGLQSQ---------VNAAQNEL----NE----------L
A0A2E5EPT8      ILEIQLQI----EGRVKGIMSGLEAE---------AKALQSGY----DN----------R
A0A5B5WZ91      ANILKEKL----SKELVGLRSSLKSK---------LEMVAASR----MK----------W
A0A2N8HD92      ERILSDKL----NKELIGLRSSLKSK---------LEMVSASR----KH----------W
A0A2N8HIT2      ERILGEKL----NKELIGLRSSLKSK---------LEMVSASR----KH----------W
A0A354EBD3      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A355VEB2      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
R6K1U5          ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A2N8IWC2      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A2N8I441      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A2N8I3A6      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A410SCC4      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A3R5VEW0      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A7T9B0I0      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
B2UKW3          ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A411SSG2      ERILGDKL----NKELIGLRSSLKSK---------LEMVAASR----KH----------W
A0A6M1RXR2      IEDLKRKI----TNRVDGLLLGLEVR---------VASLKERL----DS----------I
A0A7C3DXS4      IEDLKRKI----NNRVDGLIRGLEVR---------VASLKERL----DS----------I
A0A7V6YXH8      IAEILTKI----DERIKGILLGLETR---------LAETTSRV----VQ----------L
A0A2V2SDV4      LDDLNAKI----AAKATGILQGVQTR---------VAAVKDSL----AK----------L
A0A6N6PHJ5      RELLNKKI----DARVGGILKGLETQ---------VSTAKSEL----DS----------I
A0A7Y4QKN3      ERDLETNI----NSHVEGSLKAIDTR---------VSEAKAQL----DK----------I
A0A2V5PK75      LDDLQDKI----AKRVEGIITSLEAR---------VAAVQTNL----AL----------L
A0A1V6DME1      IKDIETKI----AQRADGIIRGLEKR---------VASMKAYL----DS----------L
A0A3D3DIJ3      AEDLHKKI----KSRVEGIMLGLDTR---------VISLSNSL----VN----------L
A0A7X7VJR5      AEDLHKKI----KSRVEGIMLGLDTR---------VLSLSNSL----VN----------L
A0A6I1K583      IAKIETQI----EARVVGLMKGLETD---------LLADKATL----AE----------R
A0A350EWA4      LDKARETI----KSRVEAMLIGQKND---------ALALSNNL----VE----------L
A0A832D3W5      IQDLNKKI----DERIEGILKGLQTQ---------VESAKAQV----EK----------L
A0A7V2G542      KAVFIQQL----SDQIGSIRNSLRIN---------LRMSESQL----QV----------L
A0A7C4KPD7      LTTQERLV----DERLTGILEGLRAL---------VEKSQAGV----VE----------L
A0A832MGU4      LETLERQV----NDRLEGIIMGLEAK---------VASLKANA----EV----------L
A0A1M6RLZ4      VEALRKQL----DEKVTEVRDVLKDK---------LDLENQRV----QR----------L
A0A832M6Y9      LSKLRSQL----NSLIQGVKQSLDID---------LSVAQSKL----ES----------L
A0A832HP42      LEQVNKQI----EDRLDGILSGLTNQ---------VVSLKARR----DQ----------L
A0A354T7G8      IDKLKTFI----EAEARAHVQGLQNR---------LDGAKRKR----DS----------F
A0A512MBZ2      LAKSKELI----LAETQSYIEGLKNR---------FDAAKMRR----ET----------L
A0A2E8MEZ0      ADGALENA----GKEVMSLKEVLETR---------LNLVDKQV----EK----------M
A0A7Y2T9S5      ITELKKNL----EKRAINVRDSLKHR---------LVLVEGKV----EK----------L
A0A851GRQ2      ITELEASL----ERRAHNVRDSLKHK---------LDLLEGRV----EK----------M
A0A6B3LBV6      LDSLRGLL----MEAVSDVRGALEIQ---------ITQLEKRL----AE----------A
A0A840UX61      LDGLWSQL----QDGVVALRETLNAQ---------LELSKRQA----EG----------L
A0A4Q2YKS3      VANMKKQL----DEGVVNLRDVLRAR---------LEMATAQL----AQ----------V
A0A6N6P3T8      IESMKKQL----DEGVVSLRDTLQAK---------LELAEARF----KR----------A
A0A8A7W668      LERTKEDL----NEGVVNLRTRLQGQ---------LEMSKERL----ES----------A
A0A2E3EC33      LALRMKQL----LDAVDVHKKALETQ---------LSMAEQQF----QN----------S
A0A2E4GN01      LKLRMMQL----LDAVEVHKKALQTQ---------LSMAEQQF----QN----------S
A0A800JJX7      LALRMIQL----LDAVDVHKGALQTQ---------MAMAEQQL----QN----------S
A0A1Z8XU55      LNLRMKQL----LGAVETHKKALSTQ---------LTMAEQQF----EN----------S
A0A2E1RQR9      LNLRMKQL----LGAVETHKKALSTQ---------LTMAEQQF----EN----------S
A0A2E3ISQ4      LKLRMNQL----LDAVETHKKALTTQ---------LSMAEQQY----EN----------S
A0A2D6W6F4      LNLRMNQL----LDAVETHKKALTTQ---------LAMAEQQY----EN----------S
A0A2D8Z5A8      LNLRMNQL----LDAVETHKKALTTQ---------LAMAEQQY----EN----------S
                                                                            

A0A2A2XVF1      TVALKEQEVAALDLNKMA-IPFNVLQREVESDRVLYESVIKRMKETAVT-GAVDQAPYTL
A0A2V5UHJ2      RVAMEDQKKATLNLKDSA-VQYAILAREVDTNKQLYDGVLQRLKEIGVA-AEVRTSN-IY
A0A2V5PST3      EVETGKQQQAALNLKEVG-VQYAVLQEEVNVNKNLYDSILKRLNETTIS-NDIAVSN-MQ
A0A2V5PXM3      ETALREQESAALELSSQA-LHYSSLSREVDSDRALYEAVLNRIKETALT-KEIKPGK-VR
A0A1V5QB01      KRVEQEWEEEALEVSRKQ-QEYQNIQRNFGRLQSLYDLAFNRLKEIDIS-VGIEPES-VQ
A0A800JGC6      WDNLPEEIDKIINVQNRG----QFITAELKNKEDLRNGLLSKIDSLVVG-NKNSREF-SI
A0A7Y2T8X5      DETESEASWLVVLQAALA-SREASLQSSIQSKQSLYDTVTKRITEIDVA-EENDNRK-IK
A0A1J4XH17      EKRLAQKEKGIINLSKIK-VEYSTLSRDFEVNQGLYQSMVLRLNTEMAQ-IDLKKPS-AR
A0A7C5LI63      EKNLRLADNEVQQKTREL-MGGTILSEDLERLRSQHRALLNQITTLDVR-QGFRYRN-IS
A0A7C5P291      KSTADQVEAEALGDSQRM-LEIKSMRANVDRVQTLYNTLLGKLMQIDVT-QSFNTRS-IS
A0A290QGD9      RSGLVEQETQSLGIDRAG-VEYESLDRELKIEEQVLQHLMGRMRETTMS-STLDTQN-AR
A0A1D8AS58      RANLARQEKESLDLDRDA-VEYSNLERDLAINEHLLNTLLSRMRETSMS-STIETQS-AR
I6AQC1          RAILAQIEKESFEIDKAA-VDYQMIERDFLVNSSILDNTIKRIRELDIT-STIEGQN-IQ
W0ITH7          RGALAQIERDSLNMDKIG-VDYQMLEQDFLINREILDRTIGRIREIDLT-STIEGQN-VQ
A0A139SU05      ENEYAENEKEALSLRNMR-VDFESLQNEAAVARANYMQILDRLNQTTTT-KYLEKVP-IR
A0A139SPN4      ETEYTAAEQEALNLRNMR-VDFESLQNEALVARSNYMQILDRLNQTTTT-KYLEKVP-IR
A0A1V6E7N1      EQEKQLQETEFFKLRDLR-GEYNSLKNQADVAQKNYIDILDRLNQTTTT-KSLEKLP-LQ
A0A2D9MYT1      AGVLTIRKSEQQSMNQKS-IEYNNLSRTATQSETMYNLALQRXKETELQEKDIVQN--MH
A0A258ANJ7      QEQLKKQESEALDLEQLA-VQYNVLKREMESDQAVYESVLTRIKQVDVS-KGMETPP-IW
A0A1Z8ZMT6      IDDIENEENFKDLRNAMK-LRASLLTNSVETKNELYNTLLSRVGVLKTDAEGVEAEV-IK
A0A2E8MCT7      IDDIKNEENFRELRNAMK-LRASLLTNSVETKNELYNTLLSRVGVLKTDAEGVEAEV-IK
A0A139TLN4      RAHIRAVSGKE--------RAVNQIAREQRVRESLYIFLLNKREENSLA-LAATEDN-AR
A0A1G3ZFT0      -------------------QMMLNLLRDVKMKNALNTILLSKIQEMKII-QAGLLSD-VR
A0A5B5WI95      SERLTKTATKE--------QEFTPLIREHKVKEELYLNLLSKEQENAMA-LAAAESS-AR
A0A2N8I9W1      TERLTETASRE--------QEIIPLIREHKVKEELYLMLLSKEQENALA-MAVTESS-AR
A0A4Q5IH27      TERLTETASRE--------QEIIPLIREHKVKEELYLMLLSKEQENALA-MAVTESS-AR
A0A2N8IBZ6      TERLTETASRE--------QEIIPLVREHKVKEELYLMLLSKEQENALA-MAVTESS-AR
A0A7G6DX28      TERLTETASRE--------QEIIPLVREHKVKEELYLMLLSKEQENALA-MAVTESS-AR
R6J100          TERLTETASRE--------QEIIPLVREHKVKEELYLMLLSKEQENALA-MAVTESS-AR
A0A139TV24      TRRLAATSGKA--------RKLTPLNREHGVKEEYYLTLLTKEQENELA-LETTPSS-AR
A0A2N8HT11      AKRLTATSGKA--------RELTPLDREHRVKEELYLTLLSKELENDLT-LALTESS-AR
R7DS70          AKRLTATSGKA--------RELTPLDREHRVKEELYLTLLSKELENDLT-LALTESS-AR
A0A2N8HNL6      AKRLTATSGKA--------RELTPLDREHRVKEELYLTLLSKELENDLT-LALTESS-AR
A0A290Q2Z2      KNQLAQAKVDQILSARDRMRPFEEAARKLEDETRLLSTLKVTLRQREID-FQVPKRS-IE
A0A2A2RGK2      KTAREAAEKRLLEVTHKS-IEYNDIKREQETDQALYNSVISRLKEVDVS-KQLTESP-VR
A0A2A2XXF7      KIAREKAEGRLIEVTAKS-IEYNDIKREQETDQALYNSVLSRLKEVDIT-KQLTESP-VR
A0A146GCJ0      EAALQEQEAKALELNKVA-IPYNVLQRDVESDRALYESVTKRLKETAIT-QGIEQAP-YR
A0A2T6D6H8      ETALQEQEERALELDKVA-IPYNVLQRDVESDRALYESVTKRLKETAIT-QGVEQPP-FR
A0A6B3L938      ARAAAKDRWLSLVQSSLS-ARASILESRILNQRRLYETVTNRLTEIDVA-DETSNAE-VT
A0A2A2R5D6      EKEVGVLTDQVRMQKTTELAKFREAKKEQDRQQLLYDQFVIRKKQSVVD-KQITNDP-AT
A0A2V5URB2      KLQMDKQKSDALALKDAS-VEYAILARETNTNSQLYDGVLERFKEINVA-GEIPASN-IS
A0A2V2DJ66      QQRLNKKREEILQLGRKA-IVYKALERERKVAEGMHAEFIAAMNVRLAQ-VSLITDT-AK
R7L5A9          QKRLAEKKEEILSLGKKA-IIYKSLERERMVAEGMHASLISAMNVRTAQ-VSLINEG-AS
A0A5B5WU87      REHIRNVSSRE--------RDVNYIDREQRVRESLYVFLLNKREENSLA-LAATEDN-AR
R7DZW0          REHIRNVSSRE--------RAVNHIEREQRVRESLYVLLLNKREENSLA-LAATEDN-AR
A0A2N8HID1      REHIRNVSSRE--------RAVNHIEREQRVRESLYVLLLNKREENSLA-LAATEDN-AR
A0A2N8HS06      REHIRNVSSRE--------RAVNHIEREQRVRESLYVLLLNKREENSLA-LAATEDN-AR
A0A6N2TNT9      REHIRNVSSRE--------RAVNHIEREQRVRESLYVLLLNKREENSLA-LAATEDN-AR
A0A4P5QM05      ETNVDKTHKVQIDEKTRM-SRYVEKKSAYLMTKTLLFEIRRQYDKAKMN-NILTQIP-VK
A0A4Q3C001      EQKLEQTRSAQIIDKNSS-SRYTEAKTKYLNAKKILEAAELRYSTARME-RGVDIDP-AR
B4DB23          QEMSKASRTDDIKEKASL-VEYVDAKNKYIQARKLYESVELSYVTQKMN-NSVKGDS-AK
A0A5R8KA81      AQGLAEQERLALDLGKIA-IEYNALARDVESNQALYASVQKRLKETDIT-RTIEFAP-WR
A0A2E6T482      QRDVDEAKQRESDMREKG-REYFDAKRELANTTRIRDTILLRIMQEEVD-LELPTESTVE
A0A3C0DQZ7      QRDVDEAKQRESDMREKG-REYFDAKRELANTTRIRDTILLRIMQEEVD-LELPTESTVE
A0A1Z9CBK5      QKAVDDAKAKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A2D6ZI96      QKAVDDAKAKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A358KGZ3      QKSVDDAKAKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKTSSVE
A0A2E9ZQX4      QKSVDDAKAKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKTSSVE
A0A3D5JZU0      QKSVDDAKAKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKTSSVE
A0A2E6HCR0      QMAVDDAKSKEAKVQEEG-REYFDAKRRLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A1Z8WN04      QKAVDSAKSKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A2D7L1N4      QKAVDSAKSKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A2E2R937      QKAVDSAKSKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A520QQY4      QKAVDSAKSKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A2D5MR66      QKAVDNAKSKEAKIQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A2E0PDQ1      QKAVDNAKTKEAKIQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A2E2ZZP9      QKAVDNAKTKEAKIQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKESSVE
A0A4P5YMI6      TRAVEEAKVKNREAAEKM-RDYLTAVRDVEQLERMRDSLKFKIQQEDID-MDMPKTSMVE
A0A7C4LRK7      TAKVEDAKKKERLAAEKM-QPYLAAKDKFELDRQLMSTLKLRVSSATLDNLKIGYSSTVK
A0A3C1VJ32      VQQVEEAKQKDHDNATKN-QPYYDEKRKLDQLLDSHKLLYTKIVIDTID-AQIPKTTMVE
A0A7W1VTI1      EATVAEAKGKETEFAALF-RPYFDAKNDLQDLLLIRKALKIKIDQETFE-ANLPVSTAVE
A0A7V4IGZ6      QTRLDTARSNDIARAEIT-RPYWEKKREYEQLLSFRRILETRLSLEQVN-VTLPRSGMVT
A0A2N9NTX7      KKEVDEATKTDISKASES-APYWKAKRELEEQEHFRAILDLKIISEKVD-LSLPKTTMVE
B9XK55          EDKVNEAKSNDLVLAESS-RPYFIEKSQLDHLKKFREILEFRAAQEQVD-RALPKTTMVQ
A0A2A2RGF2      ETKLEEAKVRNRTAAEKN-RTYQMALTDLEDLKRLRATMNAKIIVEESD-VAMSRSNSVR
A0A2G4I5Y6      ETKLEEAKVRNRTAAEKN-RTYQMARDDLDDLKRLRATMNAKIIVEESD-IDMSRSNAVR
A0A6N6PS97      EKAVADAKKQDGIKMENY-RPYFAAKRDLETENKIRETIFLRILQETVD-DKIPKNGMVD
A0A3M1I883      SNQVAQAERAVAEEAARF-SQYFDLKRQWENEQRIRDTLLLRTLQETID-SALPTESVVE
A0A1V6JZ45      QKAVDDGKKLVVEEAKRS-REYWSSKRELENKQKIRDAILMRMLQEEVD-AELPKESMVR
A0A848A4B3      QKAVDDGKKLVVEEAKRS-REYWSSKRELENKQKIRDAILMRMLQEEVD-AELPKESMVR
A0A7C7Z746      QIRLDEVKKEERKATTKY-RPYSRAKEKLDELKKIKASLHIRLLAEQVD-VNIPTAAIVD
A0A520RRW5      TSAVESAKASDAEKTAEY-RPYFTAKRDLENLSKISDMIMIRILQETVD-AALPTDSIVE
A0A356NPK0      TSAVESAKASDAEKTAEY-RPYFTAKRDLENLSKISDMIMIRILQETVD-AALPTDSIVE
A0A2D7B5P5      TSAVESAKASDAEKTAEY-RPYFTAKRDLENLSKISDMIMIRILQETVD-AALPTDSIVE
A0A3D3XGB5      TSAVESAKASDAEKTAEY-RPYFTAKRDLENLSKISDMIMIRILQETVD-AALPTDSIVE
A0A2V6F8A1      AKSVDDARKKDADMTEKY-RPYFEAKRRLDNLQKLRDAVHLRVLQETVD-AALPKTSIVE
A0A2V5TNH4      AGAVDHARTNDAFMTEQY-RPYFKAKRRLDDLTKLRDAVHLRILQETVD-AALPKTSIVE
A0A2V5X5Q6      ASAVDHARTNDAFMTEQY-RPYFKAKRKLDDLQKLRDAVHLRILQETVD-AALPKTSIVE
A0A3R5R2M8      AERMARTATRE--------QELTPLVREHKVKEELYLILLSKEQENAMA-LAATEAS-AR
A0A411SUQ6      TERLTETAIKE--------QEIIPLIREHKVKEELYLMLLSKEQENALA-MAVTESN-AR
A0A2N8HZF2      TERLTETAIRE--------QEIIPLVREHKVKEELYLMLLSKEQENALA-MAVTESS-AR
A0A354E720      TERLTETAIKE--------QEIIPLIREHKVKEELYLMLLSKEQENALA-MAVTESN-AR
A0A7T8XNA1      TERLTETAIKE--------QEIIPLIREHKVKEELYLMLLSKEQENALA-MAVTESN-AR
B2UPB6          TERLTETAIKE--------QEIIPLIREHKVKEELYLMLLSKEQENALA-MAVTESN-AR
A0A1Q6UHJ9      QKRLLEKKEQILDLGRKA-IVYKSIEREKQVAEGMHAAFIASMNVRLAQ-VNLINEG-AN
A0A2V2BXR0      QKRLLEKKEQILDLGRKA-IVYKSIEREKQVAEGMHAAFIASMNVRLAQ-VNLINEG-AN
A0A3C1HEJ2      KAGLSGLESRRRDLDAAA-GEYGIIQNKLKFNRELYERIVKERQVTKVV-QTLNKDP-VA
A0A522ULD9      EQELTTVKKTDIDAEREKYLPYNKAERKLDTERAVLNALKARLAQQGIE-LQIPRTP-VE
A0A7W1RNH4      SRDLSKIPAQE--------ATYQRLQRQPKVLEDMYGMLQTKLKEAEIQ-AATVDAT-VQ
A0A2D8V0G3      RVTYDEAQVAMNRLNELK-VEYDNLVMEKEQSEQLYTAMLAKTKEMDLN-TKDMMQN-LE
A0A348S017      LDSLNARQADMNRLNQLK-VEYDNLVMQKMQSEELYTSMLAKTKEMDLS-TKDMMQN-LV
A0A3C1UUV7      LDSLNARQADMNRLNQLK-VEYDNLVMQKMQSEELYTSMLAKTKEMDLS-TKDMMQN-LV
A0A350I3V2      LDSLNARQADMNRLNQLK-VEYDNLVMQKMQSEELYTSMLAKTKEMDLS-TKDMMQN-LV
A0A520RGV5      LDSLNARQADMNRLNQLK-VEYDNLVMQKMQSEELYTSMLAKTKEMDLS-TKDMMQN-LV
A0A3D3XF90      LDSLNARQADMNRLNQLK-VEYDNLVMQKMQSEELYTSMLAKTKEMDLS-TKDMMQN-LV
A0A2D7B522      LDSLNARQADMNRLNQLK-VEYDNLVMQKMQSEELYTSMLAKTKEMDLS-TKDMMQN-LV
A0A356NIC2      LDSLNARQADMNRLNQLK-VEYDNLVMQKMQSEELYTSMLAKTKEMDLS-TKDMMQN-LV
A0A832MDW4      ASNVKDWEERLTEWTKAK-KDYDILVRKADTSKTLFNLVLSKMKEVELL-GKDRANN-IR
A0A1V6JU76      AANVKEWEDQQMEWNKAK-MQYDVLMRKAQSSKALFDTVLAKMKEIELV-QRDKGNN-IR
A0A848ABG7      AANVKEWEDQQMEWNKAK-MQYDVLMRKAQSSKALFDTVLAKMKEIELV-QRDKGNN-IR
A0A2A2XXW5      LRKYTESVERVFALDEAK-ISYDIMEQQLKRVEGFYQTILTKAKDFDIG-AKDLLQN-MK
A0A6N6Q6V0      KGKFAEAEKEVTRLSELK-VKYDVLSRQKERSEAMFQLILNKTKEYDLS-SKDIVQN-MT
A0A2V6JLK8      RKRLEQINAKQLQTKNLS-ANYARAKNAYIKEKTLFDGVRTRAQTQTME-MAMPRFA-VS
A0A2W5Z1A5      RARLNEINEKQLSTKNLS-ANYTRAKNNYIKEKLLLDSVRQRAQTQTME-MAMPRVA-VS
A0A2V6EA09      DKRLAEINTRQLATKTLS-ANYVRAKNAYIKERLLLDGIRMRAQTQTME-LAMPRIA-VS
A0A2V6GQI7      DKRLSEINTRQLATKTLS-ANYVRAKNAYIKERLLLDGIRMRAQTQTME-LAMPRIA-VS
A0A7W1U7K0      QKRLATINEAQVTSKNLS-ANYTRAKNAYIKEKSLRDGVRLRAQSETME-MAMPRQA-LS
A0A7W0YDK6      KKRLEMINERQLTSKNLS-ANYTLAKNAYIKEKSLLDGVRLRAQTQTME-MAMPRQA-VS
A0A7V9EPY1      KKRLTNINEAQLAQKNLS-ANYVRAKNAYIKEKSLRDGVRLRAQTQTME-MAMPRQA-IS
A0A838TCM2      NKRLTDINEAQLSQKNLS-ANYVRAKNAYIKEKSLRDGVRLRAQTQTME-MAMPRQA-VS
A0A2N8HDG3      GKRLTATSGKA--------RELTPLDREHRVKEELYLTLLSKELENDLT-LALTESS-AR
A0A3E1ET42      QELTDTKKLSTVEDRAKQ-SEYATEKTKFEMQRQLLQQVKEHSMKTAVD-KEVPRKP-IE
A0A2A2YDW8      NNRLVEVKDMSKENIIAM-TQIQNVHDEFTTQQKLLDEMKQKLTTDRIN-LRQPQNI-IQ
A0A352XLN9      NNRLVEVKDMSKENIIAM-TQIQNVHDEFTTQQKLLDEMKQKLTTDRIN-LRQPQNI-IQ
A0A3D0YP62      REVRDKKQDEGTDRARAF-QEFNIARKDYETAQGIKDQMQIKYDIEKTK-LAIPPTN-II
A0A3D3DV47      REVRDKKQDEGTDRARAF-QEFNIARKDYETAQGIKDQMQIKYDIEKTK-LAIPPTN-II
A0A7Y1UNY2      GEVVSHRRDAAVDKALES-HDYIEAKREYEQAQQMLQSMKLQHSSKRIA-LQIPKNP-IT
A0A2E5XJ49      RQVVEESRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKITNSARRIA-LKIPKNP-IT
A0A2E6SBY8      RKVVEESRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKITNSARRIA-LKIPKNP-IT
A0A2E5QMS4      KERVEERRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKNP-IT
A0A2E7YXQ3      KERVEERRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKNP-IT
A0A2E3H787      KDRVEDRRFDAVXKAXQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKNP-IT
A0A2E7AGN1      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A2E7AKY7      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A3D4CU34      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A2E8M146      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A355S8S2      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A2D6DVN8      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A3C1W2R2      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A2E3NAY6      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A2E3II01      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A368B8C5      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A3R7RBB5      KDRVEDRRFDAVDKALQS-QDYVEAKQDYETAKAMLSQMKLTNSARRIA-LKIPKTP-IT
A0A2A2QX62      KSRKESTNEDAIGKGIAN-QTFIDAKNEFESALRLLETLQAKEIVERMQ-DKVTDDP-II
A0A4Q3BWH6      KTRMDTKEDDAVKQGIAN-QTFVDAKNDFETAQRLLEQLKVKLISEEMQ-TKITEDP-II
A0A858RHU7      EARMNEKKDGAIKKGIAN-QAFVDAKNDFETSQRLLEQLKIKQISEEMN-QKVIEEP-II
A0A7V7VLV5      QASKNDKRGEAIKRGLDA-QDYVDAKREFESEQEMLQQMKLKLIGEEIS-GKMPNDS-IV
A0A3N5WCF1      EVMKDESRDEAIKRGLDA-QDYVDAKREFETDQQLLETMKLKQMGETIS-RKIPGES-VE
A0A4Q3C1K5      ENLKDDTREDAIKRGLDN-QDYVDAKRDFETDQELLQQMRLKQIDRNIR-EKMTNDS-IV
A0A3D1TI55      EQEMDLLRNQDLERHREAFLPFERALRDRDAAKQVLTALEHRVAQEVIE-LEIPSTP-VE
A0A3R8IT45      RAILEQIKTESLSTDKEG-VAYQMLERDFMMNEQLFLKTVERIKETELT-NTIEAQN-VQ
A0A2A2PYE8      EEDLAKRTEDSLQLDRAA-LEYNDREREYRTNEKILDAIVARSRETSMT-SGITTQN-AR
A0A2T6CN73      QEELKRRTQDSLAVDHAA-LDYENMQRELKIQEDILTTITARRTETSMS-SNIATQN-AR
A0A2G4G428      ISNLDKKDDEIARLTVAN-NELERVDKEIKSQEDFLSRQKQSFEEAKIR-SSTTGTT-TS
A0A6N6PCD8      KTALQEQQKGGVELSRIA-IQYDELRRQVDSDKLLYESVLTRAKETKVG-EAIENSN-IR
A0A139TUL1      NRGLSDMASKD--------EGLVPLLREQKVMEELYLMLLKKREENALA-LATTEPS-AR
A0A2N8HCB0      NRLLSDMASKD--------EGLVPLLREQKVMEELYLMLLKKREENALA-LATTEPS-AR
A0A2N8HP04      NRLLSDMASKD--------EGLVPLLREQKVMEELYLMLLKKREENALA-LATTEPS-AR
A0A2N8HRJ0      NRLLSDMASKD--------EGLVPLLREQKVMEELYLMLLKKREENALA-LATTEPS-AR
A0A6N2U9Y7      NRLLSDMASKD--------EGLVPLLREQKVMEELYLMLLKKREENALA-LATTEPS-AR
A0A6N6PAZ1      PDRQAHPEDYLHAARQLLLARIGVLESETQSATTVFNTMLTRIKESSVN-QESEESS-AE
A0A7V7VK26      PDRQSHPEEYLHSARQLLLARIGVLESETLSATSVFNTMLTRIKETSVN-QESEVSS-AE
A0A6I1K459      EQVLKEQEKKLNQMQSQR-FELDRLQGDLSSQRKLYDAVIQRLREIDLT-GGMKKND-VR
D5ENH7          SQRLAEKESELIGLSKVR-VEYNSLLRELEVQQSFFQALNSRMTQEQAQ-VSLKEAS-AR
A0A0R2XQ77      SQRLAEKEAELIELSKTR-VEYSSLEREMDVQQGFLQALVGRMTQERAA-VNLKNPN-SR
A0A2E9IN28      SQRLAEKEQELIDLSKTR-IEYNSLLRDLSVQQNFFQALNSRMTTEKAQ-VNLKNPN-AR
A0A6N4WTJ5      SQRLAEKEAELIELSKTR-VEYSSLLRELDVQQGFLQALVARMTQEKAQ-VNLKNPN-SR
A0A366HAG0      EKHNKDTRAKSLDSQAGH-HEYLAAKREWETLQQDTAKLKDTKAQKEIE-RDGSKTP-IT
A0A2U8DZK4      KKQLEEAKASQIENASKRMRPFEEAMQKLDEATRLYTTFKLTLRQREID-YNQPKRP-VE
A0A2T6DFL8      KSQLAQAKVDQILSARDRMRPFEEAAQKLEDETRLLTTLKLTLRQREID-FQVPKKT-IE
A0A1D8AWD4      ERQLAQAKVDQILSARERMRPFEEATGKLDDEQRLLTTLKLTLRQREID-FQVPKKT-IE
A0A4Q1C9S2      ERQLAQAKVDQILSARERMRPFEEATTKLEDEQRLLTTLKLTLRQREID-FQVPKKT-IE
A0A178IH18      EKQLEEARARQITSSTDRMRPFEEAVRKLDDETRLLSTVKLVLRQREID-YQVPKRT-IE
A0A2T6DT99      KNQLGQAKVDQILSARERMRPFEEALQKLEDDTRLLSTTKLTLRQREID-FQVPKRT-IE
A0A1G3ZT33      ESQLAQARVDQILSARERMRPFEEAATRLDDEARLLTTLKLTLRQREID-FQVPKRT-IE
A0A3E1E2T2      KRQLSQAKVDQILSARDRMRPFEEAAQKLEDETKLLTTLKLTLRQREID-FQVPKRT-IE
B1ZMW1          KNQLAQAKVAQILSARERMRPFEEAAQKLEDETRLLTTLKLTLRQREID-FQVPKRT-IE
A0A3M1I8A3      EENLRYWEQKQQEWNKAK-TTYDVLQRKADASRALFNMVLSRLSEAEVM-QRDTANN-IN
A0A4V0XS84      RKALAEQEQKLLTMNKLK-IQHDSLNRELQQSKLLYEKITSRLKEIEVT-GNIKDKN-FT
A0A351WE84      EAELQAAKHSDIEDEKKKFLPFDRAERNVIIQRDILNALRARITQQGIE-VEVPRTP-VE
A0A7W1MRT6      DDLRGRNAAQLQKLPSVQ-AVEARLLQRVETARKMADQLREEYQRARIS-EAVEVGQ-VE
A0A7W1YXK2      EDALRAQEKLSLALNKIA-IPYSGLEREVESDRALYQSILTRLKETDVT-KALEKSP-IR
A0A2D5WGA5      QRDVEEAKRRESDVREKG-REYFDAKRELANTTRIRDTILFRIMQEEVD-LALPKSS-T-
A0A2E7SSH2      QKSVDDAKAKEAKVQEEG-REYFDAKRKLSNTTRMRDTILFRIMQEEVD-LDLPKTS-S-
A0A832HNU4      QQALREQEQTAIALDRKL-TEYNLLKRNAEIDRQLYNTILTRMKEASVA-GKMEKNN-IR
A0A1V5QDZ6      EKELEATRASDIDSERDRFLPFDKAEREVLVQRQILDALRARIAQEGIA-VEVPRTP-VE
A0A4Y8P964      EEEWKEAMVKVKKEGRLL-SQYALLKREADTDREMYTSLLKRLKETDIT-SALNSGN-IE
A0A3D4HF88      KAEISRKEKDLIGLAKTK-VEFNAIKTDLEANRDLHRAMVLRLNTEIAQ-VNLKNPT-AR
A0A1V6J089      DSELASIKATDIESESENYLPFDRAERNVAVNRDILTALRARITQTGIE-VEVPRTT-VD
A0A3C1BZR1      DEELSLIKTSDIESEGENYLPFDRAERNVSVNRDILTALRARITQTGIE-VEVPRTA-VE
A0A848WTQ6      EQMHGDKREESMDEREDY-VAYEKAKEEYHHQNLLLQNMEANFHQTKID-SNMTSTP-IR
A0A6N6ZHN8      KQRLATMEQEIIELDRLR-PEYNALVNDLQISKQMYDVYQSRLQQATVA-NRVETPN-AR
A0A6G6K641      EKEFQDQEKDTYTLGKTQ-VEYDGLKRDVEQDIAVFNGVLSSLKQSDVS-KGFETDS-VE
A0A849Y642      SDDVEKLRAREQVSHAAKYVPFVDAMRNLENQQTVLENINARLKQERIE-IGLPRRP-VR
A0A7C4KLL2      EKELKQLEADALRVSQHA-IQYSLLSRELEADRALFDSVLNRLKETSLA-AEQQPEK-LR
A0A1H6KPB7      KRAFDEVTEIVRNKTQSD-ILVMSAIRDYRTEKSRYEDLENEYINQTMN-RRASRPI-IQ
A0A2E9ISN4      ESVLNNWRSEQFLSVANQ-SEYKQLSSKVAHFERKYNLVYGRL----LE-NTGTTEP-FF
B9XAX1          EAALKEVQMESLDLDRKG-IEYNVLMREVQSDLALYDSVLKRLKETDLS-KGLEKAS-IA
A0A5R8KKM9      QKTYQEQRSKSLEADTNN-QEYLHAKEEWEGLNRDLWKLRDTLAQQQIE-RDIPATP-FT
A0A7W8DJ38      QEQLKKQESDALDLEQLA-VQYNVLKREMESDQAVYESVLSRIKQVDVS-RGMETPP-IW
A0A7W1ZQ43      EQALRQTQAEAMELDKKS-VGYNVLLRELQSDRALYDSVLKRLKETDLS-KGLGQAS-LT
A0A139TS01      AKIVAQKEEDLRKHVMKM-PVYEQTSREYDTALDQLKTLDARYKDEIAR-LRVPRES-VE
A0A3E1EJT7      RKALADQETKSLEIDKYA-VEYDNLNRDFRVNEQLLESMMSRMRETSVT-SSIETES-AR
A0A848WYP9      MASVQEQKTKMLELDGVL-KQFRAKKRAVDAAYQTYHSLLERINETDVT-EGVTERQ-IT
A0A7C3I5X9      AATVAEWENRQMEWNRAK-MEYDVLARKAETKKALYNAVLARMSEMDLT-QKDRVNN-IR
A0A349GXM8      ETAEYKWQAKNLTASQRQ-AEYSRLRSEVGRLAAHYNTLYTRLHDMRVS-EELKSEH-FV
A0A7V3QFN7      KEEVEKARQADIAEVEKS-RPYFDKKRELDELIRFRTILAYRIAAENTN-VNLPKTA-V-
A0A4P5YP61      EAALKEQEALELVLNKQK-LEFDTLSREVESDRGLYENVMKKMKESQIS-KELQSDK-LR
A0A6B2LYM4      EDRLALNQQKLIELDRIR-PEYNALARDLAISQELYNHYYNRLQQAAVK-VTTEGQT-AR
A0A6D1VXB3      EEEWKEAMVKVKKEGRLL-SQYALLKREADTDREMYTGLLKRLKETDIT-SALNSGN-IE
I0JYY7          EEEWKEAMVKVKKEGRLL-SQYALLKREADTDREMYTGLLKRLKETDIT-SALNSGN-IE
A0A4Y8P842      EEEWKRTLSKLRDENTLL-AKYAMLKREADANQQMYMGLLKRLKETDIT-SALNSGN-IE
B3DZK9          EEEWKKTLLKLKDENSLL-AKYAMLKREADANQQMYMGLLKRLKETDIT-SALNSGN-IE
A0A4R7S1J2      QEALAEQEKKSFELDALS-IEYNVRKREMESDKAVYESVISRLKEVDLT-KGMDQSK-LK
A0A2A2XV69      EQRLRESQAKQQTSKTRA-SGYYEAKNNYIQAKKILEAAEMRLSTETMQ-RTMPQDP-TV
A0A651H7X9      RAALSNQESEALNLGRLA-VSYDSLANEAQVNELIYQSIVARMRETTMT-STLESGN-AR
A0A5E6MPC4      EQEFQKAMEKVRGETKAL-SRYTILKREADTDREMYVGVLKRMRETDIT-SAINASN-VE
A0A840V0I7      DQAQGDPNERLQTARRLLIARSSVLENEIESQTSVFNSMLTRMQESGIN-QQAVESE-ID
A0A146G2Q9      QDKLDKVRSDWQTSKTSS-IGYYEAKNNWLQARKVLEAAQTRLATEKME-QTIPQSP-TT
A0A2T6D3Y2      QEKLTKVRADWQTSKTSS-IGYYEAKNNWLQARKVLEAAQTRLATEKME-QTIPQSP-TT
A0A6N6PKP9      EAALRGQEGIALELSQMA-IPYKSLERDVEADRTLYDALVARLKETDVA-QGVSRFA-VR
A0A6N6Z250      EDELARARQEQIDTAGEKYRVFDDAVKDLREAETVLRSMRLQLRQREIE-LQVPKRT-IE
A0A4V1SB02      TEQLKKAEADALDFDKIA-YPYNALKRDAETNRSLHDSIMTRMKEIDIT-STLAKSP-YK
A0A6N6QEJ2      EKLYDSAIEKTAQENKSF-APYAKAKRDLEFSMQVRQSMRLQLNQELIN-GQISKKS-S-
A0A3C1VB86      ETQMHEVETNAMKLSDSA-VRFNVLTRELRSDQALFDSVIGRLGETSVA-GQITAER-IR
A0A6N6P5E3      EQKLSEAKTGQQDAKTNS-LHYQQAKNSYLKAKRILESAETRYSTEAMQ-RTMPQSP-AT
A0A838I246      AKRLEQINQKQLASKNLS-ATYTRAKNNYIKEKLLLDGVRTRAQTHTME-MAMPRTA-VS
A0A6J4HTK1      RRRLDDVNQKQLSAKNTS-ANYTRAKNNYIKERALLDGVRMRTQTQTME-LAMPRMA-VS
A0A838FVV7      RKRLEELNERQLAGRNLS-ATYTRAKNTYIKERMLLDGIRTRAQTQTME-LAMPRMA-VS
A0A7C3HWX0      LKRVEEGKARVAEEATQQ-REYYALKSDLEKEERVYDALYLRTLQEKFD-AKIPAGQ-SI
A0A7V4LSC4      LQRLEEGKARVAEEATQQ-REYYALKSDLEKEERVYDAMYLRTLQEKFD-AKIPS-E-SI
A0A2D5VY59      TAAVENAKANDALKTAKY-RPYFTAKRDLENLSKISDMIMIRILQETVD-ASLPTES-I-
A0A2D8UZZ4      TAAVENAKANDALKTAKY-RPYFTAKRDLENLSKISDMIMIRILQETVD-ASLPTES-I-
A0A353DV86      TAAVENAKANDALKTAKY-RPYFTAKRDLENLSKISDMIMIRILQETVD-ASLPTES-I-
A0A2E5EPT8      MTQLDKAREQNRTAAENG-QRYMDVQKKLERLERIRDTIELKIESEEID-ADIGRTA-A-
A0A5B5WZ91      EKIVAQKEEDLRHHVMKM-PVYEQTSREYDTALDQLKTLDARYKDEIAR-LRVPRES-IE
A0A2N8HD92      EETVALKEKALQDHVLKV-PMYEQASRDYDAALDQLKDLSSRYTDEIAR-LRVPRDA-VE
A0A2N8HIT2      EATVAQKEEALQKHVLQV-PMYEQASRDYDAALDQLKDLDSRYKDEIAR-LRVPREA-IE
A0A354EBD3      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
A0A355VEB2      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
R6K1U5          EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
A0A2N8IWC2      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREV-IE
A0A2N8I441      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREV-IE
A0A2N8I3A6      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
A0A410SCC4      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
A0A3R5VEW0      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
A0A7T9B0I0      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
B2UKW3          EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
A0A411SSG2      EATVAQKEEDLQKHVLQV-PMYEQASRDYDAALDQLKELDSRYKDEIAR-LRVPREA-IE
A0A6M1RXR2      VAEFEEARRKDIEKVEKS-RPYFEKKRELENLVAFQRVLENKLKAERID-VDLPKTA-M-
A0A7C3DXS4      VAEFEDARRKDIEKVEKS-RPYFEKKRELENLIAFQRLLENKLKAEKID-VDLPKTA-M-
A0A7V6YXH8      SNALETAKKADLEMAETS-RAYYAEKQKLAELLQFNTVLGLRIAAQQTE-RALPRNA-M-
A0A2V2SDV4      EHEVDQAMTNDLVKAVQS-QPYFEAKRKVEEAETKLKLLTMKIYTEKLD-NELPKTA-M-
A0A6N6PHJ5      GKAVEDARLIDQDKLTKT-RPYFDKKRELEELNDLRRLITRKKNIEEVD-LKLPKSE-Q-
A0A7Y4QKN3      ITSLVVAKSNDLRRSEET-LPYFDQKRKVEELKQFQQVLERKINIEGIS-VDLPKTA-Q-
A0A2V5PK75      QAQVDKATANDIGNSKRW-RPYFDKKRELDEQQRFRQILTMKIASEKID-QKLPKTL-M-
A0A1V6DME1      TRNVEEAMRVDIEKAEKS-RPYFEAKQRLEEVMRFRSILNLKLAQERID-VDLPRTA-M-
A0A3D3DIJ3      QQEVGRATTNDVTQANLT-RPYFEAKRALEELQRFRQVLDAKIAFEKID-VELPKTL-M-
A0A7X7VJR5      QQEVGRATTNDVTQANLT-RPYFEAKRALEELQRFRQVLDAKIAFEKID-VELPKTL-M-
A0A6I1K583      TQKLEEVKKQSREIAESR-RVYQLAGQELERQQRLRETVENKIKVEELD-RDIKRTT-A-
A0A350EWA4      ERTIAAKEAEFRQKSSNI-MPYISAKEEYLRRRNVRDSVAMKIAQEKIN-YALNSTF-I-
A0A832D3W5      KEEVEKARQADIAEVEKS-RPYFDKKRELDELIRFRTILAYRIAAENTN-VNLPKTA-V-
A0A7V2G542      EDKLTERRTSEQSTKALS-SDVTEAKNRYVQSKRILESANARYQTALMD-LSMPKSA-AK
A0A7C4KPD7      AKHLDEAKKKDREAGAKL-MEYYSAKEELETARTVKNALAMRIQAAILD-NQKIQYS-V-
A0A832MGU4      KQTVEAAKERERVAAEKM-RPYLLARENLEHKRQLWNALTLKAASAAID-KQIGVTT-VK
A0A1M6RLZ4      SKSKDSAKGERLATAYDY-TLFNALVQEYEQARAVLSQIKINLTNELLK-DNLMVDP-IR
A0A832M6Y9      EAEVALLKERARGVRGDKLAPYEDAQRELETQQSIYALVAGRYKQESVD-AQISIQP-VT
A0A832HP42      QRAVEEAKRQVTEEAQKS-GEYFLAKRELENKQKIRDAILLRTLQEEVD-MALPKLS-M-
A0A354T7G8      QTYNDDAKKELQDMQSLY-NEYKTAKDEVTYLEDLLVKMRSRFFEEKAG-IELVKSP-AT
A0A512MBZ2      QTYSKEADKEQISKGATY-NDYKIAMDDVTYIEALLLKFRESYSENNAS-LQLVKSP-AT
A0A2E8MEZ0      KQMVREKKDGTVDLSMRQ-HQYNSAKEEYEQSRMMYREMSVKQQQQRVL-LKMPRTP-IT
A0A7Y2T9S5      KAVVNDLQDEGTEKARSI-QEFNIARKEYQTARGIKEGMEVRYDIEKTK-TVLPPTN-II
A0A851GRQ2      QEVVNAQKEEGTVTARDI-QEFNIARKEYQTALAIKDNMDIQYDREKTK-LEMPMTN-IV
A0A6B3LBV6      EESEDEKVEEYIAGALDN-AEYEHYREEYRTEKELLKALTMSTYTKKIE-ENKALRP-VS
A0A840UX61      KKAANEKEDEAVTMGIAR-QSFDDARADFETAQALLEDLKIKEIGEQMQ-RRISEDP-VI
A0A4Q2YKS3      EILKGEKKGEAVRQGIDT-QDYVDAKREFETDLELLQTMKLKYITEKAS-GKLNGES-IA
A0A6N6P3T8      QANKNDKRGEAIKHGLDA-QDYVDAKRTFESEQEMLQQMKLKLIGEEIS-GKMPNDS-IV
A0A8A7W668      KLKKQESKSEALERNIDT-NDYVDAKRDYESDLGLLEQMKLQLTNQEII-QGAPSET-IL
A0A2E3EC33      KETKERTEKASLKERKDN-VRYIEAKKEYELCKEMLNGMQSQLAKEKID-AAGQRTP-MV
A0A2E4GN01      KETKERTEKASLKERKDN-VRYIEAKKEYELSKEMLNGMQSQLAKEKID-AAGQRTP-MV
A0A800JJX7      KETKERTEKASLKERKDN-VRYIEAKKEYELCKEMLNGMQSQLAKEKID-AAGQRTP-MV
A0A1Z8XU55      RESKERTEKMSLQERKQN-VRYIEAKKEYELSKEMLNGMQSQLAKETID-KEGQRTP-LV
A0A2E1RQR9      RESKERTEKMSLQERKQN-VRYIEAKKEYELSKEMLNGMXSQLAKETID-KEGQRTP-LV
A0A2E3ISQ4      KESKERTEKMSLQERKQN-VQYIEAKKEYELSKEMLNGMQSQLAKETID-SAGQRTP-LV
A0A2D6W6F4      KESKERTEKMSLQERKQN-VRYIEAKKEYELSKEMLNGMQSQLAKETID-SAGQRTP-LV
A0A2D8Z5A8      KESKERTEKMSLQERKQN-VRYIEAKKEYELSKEMLNGMQSQLAKETID-SAGQRTP-LV
                                                                            

A0A2A2XVF1      IEE-----PLVAS--LPSKPNRTRTLAMALIMAFFFAIGAVIFFDSLNSSLRSVDEAESF
A0A2V5UHJ2      VMG--K--ALPPG--SPSYPDKRRSMLLGVLLGLAAGIGLAFFLEQLDNTLKSPEEAERY
A0A2V5PST3      ITQ--S--AERPE--FPNSPNIPIDLTMYAAMGLFIGAGLAFFLEYLNSRLETPEHVWRA
A0A2V5PXM3      VIQ--H--AEVPE--LPAKPEKLRVILLGLLAGLGSGLLLALFLNSLDRSLKTVDQTEEY
A0A1V5QB01      IME--R--ARPAS--SPVTPRKLQSIFIAALIGLGVGLGLVFGLEYIDDSLRYPEEVTDL
A0A800JGC6      AME-----AVLPE--GPIGPSFVKTFGLFFVGALASGIGLAILLGFLDPSIRTVAELEEY
A0A7Y2T8X5      IAE-----RAYPS--GNIEVDKYKRLSQGLVGGMLFGFAIAYLMGMIDYKIYDVRTVETA
A0A1J4XH17      IID--F--AVAPG--HPAKPKKVIILALGLMGGIASGLGAVFAIAFFDDRIKTAFDIESV
A0A7C5LI63      VLE--P--AIVEP--QPVYPKKTKGLMVAAFLGIGLGLALAFFVEYIDDSIKLAEEVERD
A0A7C5P291      VLE--P--ALIEQ--DPVFPKKTKGLLLAAVFGIGLGLALAFFIEYIDDSIKLAEEVERD
A0A290QGD9      V--IDR--AFPSQPEQYVKPVILLNLGLGLVGGLGLGLAVAIFVAFIDDRVKSSFDIEGQ
A0A1D8AS58      V--VDR--ASPALKP--ASPNVLLNLALGFLGGLALGTAFAFFVAYVDDRVKSSFDIESV
I6AQC1          ISPISR--AVPAREDQYVEPRIVLNLAGGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESV
W0ITH7          IRPISR--AVPAREDEYVEPRIVLNLAGGFILGIGFGLAFAFVVAFIDDRVKSSFDIESV
A0A139SU05      LLD--R--AQVSG--RPYTPNFPKIVRMCVMMFCVVFFGTAFGLDFIDDRIKSAWDIENF
A0A139SPN4      LLD--R--AQVAS--HPYTPNFPKIIRVCVMMFLVVFFGTAFGLDFIDDRIKSAWDIENF
A0A1V6E7N1      PLD--R--AVPAG--APFTPDLARIIRTSSLLFVALFLAVAIGLNFIDDRIKSTWDVEHY
A0A2D9MYT1      VID--L--ATAQM--HAIKPKKLLTAFLGIIGGLGAGFGLAFFVNFLDDSIKSQEDIETY
A0A258ANJ7      VHQ--L--AMVPG--DPVSPNAKKVVGSSTAGGFMLGLAIIGLIVIQDRSIRSVDDARQK
A0A1Z8ZMT6      HED-----APRAW--APFSPNRKKIMIKNTLLGLCGGLALAFMFQFVDNKIHGVADVEQT
A0A2E8MCT7      HED-----APRAW--APFSPNRKKIMVKTTMLGLCGGLALAFMFQFVDNKIHGVADIEQT
A0A139TLN4      IVD--A--VRGGD--GPLAPNVPKILLVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESL
A0A1G3ZFT0      ILS--Y--AKIPD--SAVPIERAKLYGGSIIIGLIASIILIFGRKFIFPRIEDPYWTETR
A0A5B5WI95      VLE--T--AHGSD--LPIAPKTEQYIAAGTLGGAALCFFAFLGLGMMNNKVKNKHDLTGQ
A0A2N8I9W1      VLE--T--AHGPN--FPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPST
A0A4Q5IH27      VLE--T--AHGPN--FPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPST
A0A2N8IBZ6      VLE--T--AHGPN--FPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPST
A0A7G6DX28      VLE--T--AHGPN--FPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPST
R6J100          VLE--T--AHGPN--FPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPST
A0A139TV24      VLE--T--AHGSN--APIAPNTRKFVLGGAAGGAALCLFAFMGVAILNNKVKNRHDLDAI
A0A2N8HT11      VLE--S--AHGTD--YPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAV
R7DS70          VLE--S--AHGTD--YPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAV
A0A2N8HNL6      VLE--S--AHGTD--YPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAV
A0A290Q2Z2      ILN--Y--AEPAR--RAAKPSWPLNIAFAVLFGGVLGIGTAVLIEFFDTSFRNVAELEGR
A0A2A2RGK2      IHE-----TAVGA--GPIRPSATKKWIQSLLGGAAIGVGLALLMFFMDTSMKTVDQVESV
A0A2A2XXF7      IHE-----PAVGA--APIRPSATKTWIQNLLGGLAIGIGIAIAIFMLDTSIKTVDQVEQF
A0A146GCJ0      VIE--E--PMVPN--VPSKPRIKLILLVSLVAGLGLGVALVVVIDLLDASLRTVDEAESY
A0A2T6D6H8      IIE--E--PMVPS--APAKPRVKVILAAGLLLGVMAGVGLVFVLDLLDHSLRTVDEAESF
A0A6B3L938      VFE--E--ASIPP---PSKYKHLITLAAGTVLGSGVGVGLVFLLSLLDYKIYNVRTAEEA
A0A2A2R5D6      IIS--K--AEPND--MPFRPNLTINLIASGVAGLVLGIVLAFFIEYLDTSVKTMDDVEKL
A0A2V5URB2      ILD--R--AEIPR--QPSQPQKRRNLMLGALLGLMGGLGLALLLEHLNNTLRTPDEVERY
A0A2V2DJ66      VID--K--AGISP--LPSSPNYILNFVGGFILALFGGIAMAFAVAFLDDRAKSAYDVETV
R7L5A9          IID--R--AAPAL--RPSSPNYVLNIILGIIAGIIGGICMAFLVAFLDDRAKSAYDIEAV
A0A5B5WU87      MVD--G--VRGGA--GPLAPNVPKILLVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESL
R7DZW0          MVD--G--VRGGN--GPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETL
A0A2N8HID1      MVD--G--VRGGN--GPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETL
A0A2N8HS06      MVD--G--VRGGN--GPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETL
A0A6N2TNT9      MVD--G--VRGGN--GPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETL
A0A4P5QM05      IWQ--R--AQPGL--YHEKPSVILYTIIAAIFGIVAGIGLAFFVEYLDTSVKTVDDIERH
A0A4Q3C001      IKE--K--AEPPM--GYAKPPVKLYLTLAALIGLVVGVGLAFFIEYLDTSVKTLDDVERF
B4DB23          IWE--K--AEKAE--YPSEPNVPAYMGMAAIIGLVLGVGLAFFIDYLDTSVKTLDDVERY
A0A5R8KA81      VVE--T--PQVAE--DPSKPRKMRTWLIGLGVGLVFGLALAFGIHAFDDTLRTVDQAEAA
A0A2E6T482      IID--D--ADXPD--KAIKPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERS
A0A3C0DQZ7      IID--D--ADVPD--KAIKPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERS
A0A1Z9CBK5      IID--K--ADTPL--NPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A2D6ZI96      IID--K--ADTPL--NPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A358KGZ3      IID--K--ADTPL--RAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A2E9ZQX4      IID--K--ADTPL--RAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A3D5JZU0      IID--K--ADTPL--RAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A2E6HCR0      IID--K--ADNPI--RPVRPNIPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A1Z8WN04      IID--K--ADNPI--RPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A2D7L1N4      IID--K--ADNPI--RPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A2E2R937      IID--K--ADNPI--RPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A520QQY4      IID--K--ADNPI--RPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A2D5MR66      IID--K--ADNPI--RPVRPNITLNIVLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A2E0PDQ1      IID--K--ADNPI--RPVRPNITLNIALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERA
A0A2E2ZZP9      IID--K--ADNPI--RPVRPNITLNIALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERA
A0A4P5YMI6      ITD--A--AELPV--KATRPNIPLNIALGVIVGMIMGVGLAFFIEYLDTSVKTIDDVEAA
A0A7C4LRK7      MVD--V--AEPGL--RPERPKKILNITLGVIAGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A3C1VJ32      VID--R--AEPGK--APVKPNKTLNITLGLIFGLIMGVGLAFFIEYLDTSVKTIDDVERT
A0A7W1VTI1      IFD--P--ATPPHPSRPDFPNLPLNIVLGIIVGLIVGVGLAFFIEYLDTSIKTIDDVERA
A0A7V4IGZ6      IMD--R--AVPGL--RPVKPNKTLNIILGVVIGLVVGVGLAFFIEYLDTSVKTIDDVERA
A0A2N9NTX7      IVD--R--AVAPL--FASSPNKTLNIALGVIVGLVVGIGLAFFIEYLDTSVKTIDDVERS
B9XK55          IVD--T--AEEID--KPVRPNKALNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERT
A0A2A2RGF2      VTD--F--AEAAI--KAAYPKMVLNVALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERA
A0A2G4I5Y6      VTD--F--AEAAI--KAAYPKMPLNVALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERA
A0A6N6PS97      IVN--R--AKPDE--TAVRPNVPLNITLGVIFGLIVGFGLAFFIEYLDTSVKTIDDVERA
A0A3M1I883      VTD--P--AVPAL--KPVRPDLFLNLVLGVVFGLVMGVGLAFFIEYLDTSVKTIDDVERS
A0A1V6JZ45      IVD--P--AEPAL--RPVRPNIPLNIALGIMVGLVMGVGLAFFIEYLDTSVKTIDDVERS
A0A848A4B3      IVD--P--AEPAL--RPVRPNIPLNIALGIMVGLVMGVGLAFFIEYLDTSVKTIDDVERS
A0A7C7Z746      IID--P--AVKSL--KPDRPNIPLNLALGIVFGLVVGVGLAFFIEYLDTSVKTIDDVEAA
A0A520RRW5      IYD--P--AEPNP--DPVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQA
A0A356NPK0      IYD--P--AEPNP--DPVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQA
A0A2D7B5P5      IYD--P--AEPNP--DPVRPKIFLNIALGVVVGLVVGIGXAFFIEYLDTSVKTIDDVEQA
A0A3D3XGB5      IYD--P--AEPNP--DPVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQA
A0A2V6F8A1      ITD--H--AEPGR--KPVSPDFKLNIILGILVGLIVGVGLAFFIEYLDTSVKTIDDVERA
A0A2V5TNH4      ITD--Q--AEPGR--KPVSPSFKLNIALGIIVGLIVGISLAFFIEYLDTSVKTIDDVERA
A0A2V5X5Q6      ITD--N--AEPGR--RPVSPNFKLNIALGIIVGLIVGIGLAFFIEYLDTSVKTIDDVERA
A0A3R5R2M8      VLE--S--AHGPD--IPIAPQTVQYLAAGILGGGALCFFALLGIAMLNNKVKNKYDLPAQ
A0A411SUQ6      VLE--T--AHGSN--LPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAA
A0A2N8HZF2      VLE--T--AHGPN--IPISPKTIKYVAGGTAGGVLLSILAFMGAAMLNNKVNNKHDLPAA
A0A354E720      VLE--A--AHGPN--LPISPKTIKYVAGGTAGGALLSILAFMGVAMLNNKVNNKHDLPSV
A0A7T8XNA1      VLE--T--AHGSN--LPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAA
B2UPB6          VLE--T--AHGSN--LPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAA
A0A1Q6UHJ9      IID--K--ASPGI--RPVRPNIPMNITLGILGALAGGVMVAFIVAFMDDRAKSAYDIESV
A0A2V2BXR0      IID--K--ASPGI--RPVRPNIPMNITLGILGALAGGVMVAFIVAFMDDRAKSAYDIESV
A0A3C1HEJ2      IEQ--R--ATVPE--RPIKPNRKQVMLMGALAGLVSGLAVAFGLAATDSSLKSVEQAENF
A0A522ULD9      VID--P--AEPSN--VPVSPNLFFNVLVGIIAGIVTGISLAFFLEYLDTSIKTVDDVEKY
A0A7W1RNH4      VVD--S--AVAPQ--KPVRPRALLDLAAALVLGAVIGLLLAVAREHLDATVRTREQLQTI
A0A2D8V0G3      VVD--L--AYEPF--NPIKPRKALTLLLGLVGGLGMGFAFAFFANYLDDSVKSQDDIESY
A0A348S017      VVD--K--AFEPI--NPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETH
A0A3C1UUV7      VVD--K--AFEPI--NPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETH
A0A350I3V2      VVD--K--AFEPI--NPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETH
A0A520RGV5      VVD--K--AFEPI--NPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETH
A0A3D3XF90      VVD--K--AFEPI--NPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETH
A0A2D7B522      VVD--K--AFEPI--NPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETH
A0A356NIC2      VVD--K--AFEPI--NPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETH
A0A832MDW4      IVD--P--ASVPV--KPVKPRIVTTLLLGAFGGLAVALGLALFVNYLDDSIKTQDDVETY
A0A1V6JU76      VID--Y--AYAAT--MPVKPRVLLTLFLGAFGGLGLAIGLAFFVNFLDDSIKSQDDVELY
A0A848ABG7      VID--Y--AYAAT--MPVKPRVLLTLFLGAFGGLGLAIGLAFFVNFLDDSIKSQDDVELY
A0A2A2XXW5      VQD--P--AFAPL--KPVSPNKPLIFVGSVVGGLAVALGLALFFNFLDDSIKSQEDVENI
A0A6N6Q6V0      IID--H--ADLPS--RPVKPNKPLIILASTMVGMMFALGFAFFINFLDDSVKSQDDVENF
A0A2V6JLK8      VKQ--V--AEAPS--YPARPRVGLNLTLGMLVGLVIGIGLAFFIEYLDTSVKTMDDVESL
A0A2W5Z1A5      VKQ--V--AEPPT--FPARPRVGLNLALGGLIGLGIGLGLAFFIEYLDTSVKTMEDVETL
A0A2V6EA09      VKQ--V--AEPPN--FPARPRVVLNLALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENL
A0A2V6GQI7      VKQ--V--AEPPN--FPARPRVVLNLALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENL
A0A7W1U7K0      VKQ--V--AEPSS--TAARPRVALNMALGALLGLVLGIGLAFFIEYLDTSVKTMEDVETL
A0A7W0YDK6      IKQ--V--AEPPS--YPARPRVSLNLMLGALVGLVLGIGLAFFIEYLDTSVKTMEDVEKL
A0A7V9EPY1      VKQ--V--AEPAA--SAARPRVALNMALGALVGLVLGIGLAFFIEYLDTSVKTMDDVENL
A0A838TCM2      VKQ--V--AEPAP--TAARPRVALNMALGALVGLVLGIGLAFFIEYLDTSVKTMDDVETL
A0A2N8HDG3      VLE--A--AHGSD--SPIAPNTRKSVLTAAAGGAIVCILGFLGLALLNNKVKNKKDLNAI
A0A3E1ET42      VLQ--V--ATPEP--RPSKPNMMLLFSIGAGLGLVLGLLLAFFLEYLDTSVKSLDDVERY
A0A2A2YDW8      LHE--E--PVVAR--FPSSPKVNIALILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERY
A0A352XLN9      LHE--E--PVVAR--FPSSPKVNIALILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERY
A0A3D0YP62      IHQ--I--PEIND--IAVSPNIPLNLALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERF
A0A3D3DV47      IHQ--I--PEIND--IAVSPNIPLNLALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERF
A0A7Y1UNY2      IHE--A--PKISK--NPVSPKVTLYLTLGALVGLVFGIAIAFFLEYLDTSVKSLEDVERY
A0A2E5XJ49      ILE--E--PKQAK--DAVYPKVSLFLGLGAAVGLIFGVAIAFFLEYLDTSVKSLEDVERY
A0A2E6SBY8      ILE--D--PKQAK--DAVYPKVSLFLGLGAAVGLIFGIAIAFFLEXLDTSVKSLEDVERY
A0A2E5QMS4      ILE--D--PKMSK--NPVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERY
A0A2E7YXQ3      ILE--D--PKMSK--NPVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERY
A0A2E3H787      ILE--D--PKLGK--XPVYPKVTLFLSLGAAVGLIFGVAIAFFLEYLDTSVKTLEDVERY
A0A2E7AGN1      LLE--N--PKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERY
A0A2E7AKY7      LLE--N--PKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERY
A0A3D4CU34      LLE--N--PKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERY
A0A2E8M146      ILE--H--PKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERY
A0A355S8S2      ILE--H--PKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERY
A0A2D6DVN8      ILE--E--AKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERY
A0A3C1W2R2      ILE--E--AKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERY
A0A2E3NAY6      ILE--D--PKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERY
A0A2E3II01      ILE--E--AKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERY
A0A368B8C5      ILE--E--AKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERY
A0A3R7RBB5      ILE--E--AKIGM--DPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERY
A0A2A2QX62      IHE--E--PVVSQ--VPVSPNVTLNLALGTVVGLIFGIAVAFFLEYLDTSVKTLEDVERY
A0A4Q3BWH6      MHE--E--PMISQ--VPVSPNVTLNLTLGAIVGMIFGIGVAFFLEYLDTSVKSLEDVERY
A0A858RHU7      IHE--E--PTLSQ--VPVSPNIKLNLALGAVVGLIFGVGVAFFLEYLDTSVKTLEDVERY
A0A7V7VLV5      VHD--E--PVSSQ--SPVSPNVTLNLMLGAVIGLIFGLGIAFFLEYLDTSVKSLEDVERY
A0A3N5WCF1      VHD--P--PVISN--SPVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKTLEDVERY
A0A4Q3C1K5      MHE--E--PQIAQ--GPVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKSLEDVERY
A0A3D1TI55      VVE--T--AVEPR--SPFSPSWTLNILASIFGGLFLGVALAYFIEYMDTSVKTIDDVERF
A0A3R8IT45      VMPLARAVQPRED--EYVEPRIVLNLAAGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESV
A0A2A2PYE8      IVDKAA--PSPES--KPISPNVPLNLGLGIAGGLGLGLAFAFFVAFIDDRVKSSYDIEGV
A0A2T6CN73      IIDLAQ--ESPEG--RPISPNVPLNLGLGVIGGLGLGLAFAFFVAFIDDRVKSSFDIEGV
A0A2G4G428      IKVLDS--PSVAD--RPTNKNFYLNAIIGLAMGAIFGLGLIILLGTFDDRIKSPKEVEIA
A0A6N6PCD8      IVQ--D--PLVPK--DPSKPKIPLILAVSVALGLMGGLALIILQQAFDTSLRSLDQAEVA
A0A139TUL1      ILE--P--AFGSN--SPVAPKLPLMTLGGMAGGAFLCLLSLMVSNALNTNVKDKNDLVGL
A0A2N8HCB0      ILE--P--AFGSN--APVAPKLFLMTVGGMTGGALVSLLALLAGNALNTKVRDKKDLAGL
A0A2N8HP04      ILE--P--AFGSN--APVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGL
A0A2N8HRJ0      ILE--P--AFGSN--APVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGL
A0A6N2U9Y7      ILE--P--AFGSN--APVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGL
A0A6N6PAZ1      VSN--L--ARVSG--LPTAPIPSKILAGGTVGGFSGGILLVFLLLRLDNRFHTVSQIASD
A0A7V7VK26      VSN--L--ARVPG--SPIAPIPAKVLAGGIVGGFAGSILLVLLLQRLDNRFHTVSQIASE
A0A6I1K459      IIE--P--ANLPS--SPIRPNKRMILIYSLAMGFGLSFGLVWLIAQLDTSIKSVDQAESL
D5ENH7          IVDKAF--APLRH----SSPNILMNLAAGIFGGLVVGAGLVFLVAFLDDRVKSAFDIEGT
A0A0R2XQ77      VIDQAF--PPLRH----SSPNIAMNLAAGFFGGLAVGAGLIFAVAFLDDRVKSVFDIEGT
A0A2E9IN28      IVDEAF--PPSED--NPSSPNVTMNLAAGFFGGIAVGVGLIFVVAFLDDRVKSAFDIEGT
A0A6N4WTJ5      VIDEAL--PPLRH----SSPNIVMNLAAGLFGGVAAGVGLIFLVAFLDDRVKSAFDIEGT
A0A366HAG0      VYQ--P--AEPDT--TPSKPNVKLNLLLGGIIGLMFGFGMAFFLEYLDTSVRTMDDLERT
A0A2U8DZK4      ILS--K--AEPKL--EPERPSWPINITFAILFGVVLGIGTALLIDMFDASFRSVADVERR
A0A2T6DFL8      ILN--T--AEAPR--FPIRPSWPLNLTFAFVFGAVLAVGVAVVLEYFDTSFRNVADVEAR
A0A1D8AWD4      ILN--T--AEPAR--FASRPNWPLNILFACVFGTILGVGAAVLLEYFDTSFRNVADVEGK
A0A4Q1C9S2      ILN--T--AEPAS--YASKPNWPLNILFAFVFGSILGVGAAVLLEYFDTSFRNVADVEGK
A0A178IH18      ILN--T--AEPAR--RAARPSWPLNLTFAFLFGAVLGVGAAVLIEFFDASFRGVADVERR
A0A2T6DT99      ILN--V--AEPAR--RASRPNWSLNLVFAVLFGTILGVGTAVLVEYFDTSFRNVAEVEAR
A0A1G3ZT33      ILN--Q--AEPAR--RPSRPNWPLNIFFALLFGSLLGVGAAVLVEYFDTSFRNVADVEDH
A0A3E1E2T2      ILN--T--AEPAR--RPSRPSWPLNSAFAVLFGSILGVGAAVLLEYFDTSFRNVADVETR
B1ZMW1          ILN--T--AEPPR--YPSRPNWTLSIALALVFGSLLGVGAALLLEYFDTSFRTVGDVETR
A0A3M1I8A3      IVD--P--ATIPT--EFVKPNIPVVLTAGVLGGILLGIGLALFVNYLDDSIKSQDDVELH
A0A4V0XS84      VVD--L--ADAPL--KPIKPSVGLTLLLGILGGLAVAIGLAFFVDYVNDTIKTQEDIEAH
A0A351WE84      VVE--P--AEPAN--KPSSPLVMLNILLSIFLGFGAGIGLAYFIEYLDTSVRTVDDVEQF
A0A7W1MRT6      IVD--L--ANEPD--APIGRGTLFRVLSGLLLGLLFGGGGAVLLDRLNSTIRRRDEIETT
A0A7W1YXK2      VVE--P--ARVPS--RPVRPNKLLVTLLCSLGGLLAGTSLSLFLQAIDSSLKTVDETERA
A0A2D5WGA5      VQIIDD--ADLPE--KPVKPNIPLNIALGMVVGLILGVGLAFFLEYLDTSVKTIDDVEHA
A0A2E7SSH2      VEIIDK--ADIPL--RPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERA
A0A832HNU4      LVE--P--ATPPA--APYKPDRRRILGMGALFSLGIGIGLCLLVHTYDDRVKTHEDIE-M
A0A1V5QDZ6      IVD--P--AVPPS--RPVSPNLFLNILLSVLLGLGAGVGLAYFIEYLDTSVKTVDDIERY
A0A4Y8P964      VVE--T--SAIPK--IPIKPQKTRNILFALVFGSLASCGLALGLAKLDTRIRSKEEIEKE
A0A3D4HF88      IVD--K--ATPPI--YPSHPKILLNLFLGFSGGIMLSLIFVGLLAFFDDRVKTAYDVEGI
A0A1V6J089      IVE--E--ADPPD--RPSSPLVVLNIFLSVVLGLMAGTGLAFFVEYLDVSIKTVDEVEKY
A0A3C1BZR1      IIE--E--AEAPQ--RPSSPLVVLNIFLSVVLGLLAGTGLAFFVEYLDVSIKTVDEVEKY
A0A848WTQ6      IHE--Y--AEPDP--RPAKPMVLLNLILGGIIGLGMGLTLAFFLEYLDTSVKSIEQVEEL
A0A6N6ZHN8      ILE--R--AGLPR--RPVSPNVPFNMLLGLVLGGVLGVGLVVLLAVMDDKVKTAYDIESS
A0A6G6K641      IVE--P--AVASY--APVRPDKRKILLQWSIGGIVLGLGLTLGLHFLDNSIKAVAEAETM
A0A849Y642      IID--Q--AEPAY--APAKPNVPLNISLSLVVGIVLGVAIAFFIEYLDTSVHRVDDVEKF
A0A7C4KLL2      FIQ--P--AIPPA--KPFLPNARRTYGFALLIGLAAGLALAFGSNALDTSFKSVEQAEAY
A0A1H6KPB7      IHT--Q--AREAK--VPSSPNVKMNLILGAVVGVVFGIGVAFLLNYMDTSVKTLEDVERN
A0A2E9ISN4      LRKIQA--PQASE--KPIKPQVIKIIAASLFLGAAFGAGAILGLEYLKPNPINVTHLERE
B9XAX1          VVE--P--AMLPG--ATVKWSLLLVIGGAVVTGLLMSLCMIYLMSLFDSSIRTVDQAEFV
A0A5R8KKM9      IHK-SA--DEPET--APAKPNVKVNLALGAVVGLMFGFGLAFFLEYLDTTVKSIDEVERL
A0A7W8DJ38      VHQ--L--AMVPG--EPISPNAKKVVGSSTAGGFMLGLAIIGLIVMQDRSIRSVDDARQR
A0A7W1ZQ43      MVE--P--ASQPA--TPIARSRLILAGGSFMLSFIGMVALLYLLRSVRGSIQTVDEAEDI
A0A139TS01      MYD--N--PLLPT--APYKPDVTLNLAVGAVAGLLLGMGLALLLEFMDTSVKTMEDVERA
A0A3E1EJT7      IID--R--AYEPG--NPVSPKVFFNLTLGVLAGLVAGFSVAFLIATLDDRIKTISAVETL
A0A848WYP9      ISD--Q--PVVPD--KPSSPKKKVTVILAGMLGGMMGLGLVLVLQLLDRSLKTRRQVEST
A0A7C3I5X9      QVD--P--AVAPA--RPVKPNVPVTLAAGVVGGLAVALGLALFVNFLDDTIKSQDDVETY
A0A349GXM8      PED-----ITTRE--DPVWPDPLKILMAALAGGLGLGFGLAFLAQVVDNKVQTIKDVENI
A0A7V3QFN7      VEILER--ATPSD--DPVRPNKPVNIALGIIFGLLIGVGLAFFIEYLDTSVKTIEDVERS
A0A4P5YP61      VIQ--P--AIAPE--RPSKPQKVKIMAAAVLVGLMGGLMLALLLNQIDSSIKSVDQAEEF
A0A6B2LYM4      IID--R--AVEPV--RPFKPNITMNLAIGLVMGTGVGLGLVFLLAFLDDKVKSAFDIEST
A0A6D1VXB3      VIE--T--SPIPK--VPVKPQKIRNILFALVFGSLTSCGLALGLAKLDTRIRSKEEIEKQ
I0JYY7          VIE--T--SPIPK--VPVKPQKIRNILFALVFGSLTSCGLALGLAKLDTRIRSKEEIEKQ
A0A4Y8P842      VVE--T--SPIPK--KPVKPKKMLNLLLALFGGSIGGIGLALGLAMLDNRFRGKEEIEKF
B3DZK9          VVE--T--ASIPK--KPVKPKKMLNLLLGLFGGSVGGIGLALGLALLDNRFRGKDDIEKF
A0A4R7S1J2      LHQ--L--PSAPG--YQIWPQPSRIISSGVGGGFALAAGVIFLLFFMDRTIKSVDQAEKI
A0A2A2XV69      IWE--R--AEPAE--YPSRPRVLLNMILGVVVGIGFGVGLAFFIEYLDTSVKTLQDLESI
A0A651H7X9      VVD--S--AMVPL--RPASPNVRLNLGLGLLGGLGLGLGVAFFIAILDDRVKSAFDIESV
A0A5E6MPC4      VLE--H--ASVPQ--SPSRPKKGRNLLLGFLGGGLGGLGLAVGLARFDTRLRGKEEVERT
A0A840V0I7      VDS--L--ATLPE--LPVSPKPVLVLAAGMVVGVGGGLMIALILTRLDNKFHTVAQVESE
A0A146G2Q9      IWE--S--AEISL--VPAKPNVVLNMVLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESF
A0A2T6D3Y2      IWE--T--AEISL--VPAKPNVVLNMVLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESF
A0A6N6PKP9      VAT--P--AMLPE--RPVKPKKSLTLIFGALGSLALAASGVLAAHTLDSSCKTVDQAERL
A0A6N6Z250      LLN--L--AAPPA--KAGRPNWALNLSLAGFLGLLLGSAGALLLEKADGSFRQVEELEGR
A0A4V1SB02      VIE--E--PLINA--APVRPNPKKIMSIAGLLALLLGSGLVLLMDRLDSSIRTVDEAENI
A0A6N6QEJ2      VQVIDR--ALQGL--TPVRPNKPLFVAAGAIFGLLLGIGLAFFIEYIDTSVKTIDDVEQS
A0A3C1VB86      VIQ--P--ALVPE--LPASPKIKLIFALALFGGLAVGLGISFVLNSMDTSFRTVDEVEHY
A0A6N6P5E3      IWE--K--AEVSD--FPAKPKVAQNMIVAVAVGLALGVGMAFLIEYLDTSVKTMHDIETA
A0A838I246      VKQ--V--AEPPS--FAARPRVGLNLALGALVGLVLGLGLAFFIEYLDTSVKTMDDVESL
A0A6J4HTK1      VRQ--I--AEPPS--FAARPRVTLNLALGALVGLVVGLGLAFFIEYLDTSVKTMEDVESL
A0A838FVV7      VKQ--I--AEPPS--YAARPRVGLNLALGALVGLVVGLGLAFFIEYLDTSVKTMEDVESL
A0A7C3HWX0      VAMVDK--AEPGL--RPVRPNLMLNLALGSVFGLVMGIGLAFFIEYLDTSVKTIDDVERA
A0A7V4LSC4      VTVVDR--AEPAL--RPVRPNVMLNLVLGSVFGLVMGVGLAFFIEYLDTSVKTIDDVERA
A0A2D5VY59      VEIYDP--AEPND--EPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQA
A0A2D8UZZ4      VEIYDP--AEPND--EPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQA
A0A353DV86      VEIYDP--AEPND--EPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQA
A0A2E5EPT8      VEVIDP--AEPAI--RPAKPKVALNIALGVVLGAVMGIGMAFFIEYLDTSVKTIDDVEHT
A0A5B5WZ91      MYD--N--PLLPS--APYKPDVTLNLAVGAVAGLLLGVGLALLLEFMDTSVKTMEDVERA
A0A2N8HD92      MYD--L--PEYPA--VAYKPSITINLAVGASVGLLLGIGLALFLEFMDTSVKTMEDVERA
A0A2N8HIT2      MYQ--L--PTYPA--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A354EBD3      MYQ--L--PTYPV--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A355VEB2      MYQ--L--PTYPV--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
R6K1U5          MYQ--L--PTYPV--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A2N8IWC2      MYQ--L--PTYPV--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A2N8I441      MYQ--L--PTYPV--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A2N8I3A6      MYQ--L--PTYPV--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A410SCC4      MYQ--L--PTYPV--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A3R5VEW0      MYQ--L--PTYPA--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A7T9B0I0      MYQ--L--PTYPA--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
B2UKW3          MYQ--L--PTYPA--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A411SSG2      MYQ--L--PTYPA--APYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERA
A0A6M1RXR2      VTIVEQ--AQPGL--RPVQPKKGLNIALGVIFGLVVGVGLAFFIEYLDTSVKTIDDVERA
A0A7C3DXS4      VTIVER--AEPGL--RPVQPNKTLNIMLGVIIGLVVGVGLAFFIEYLDTSVKTIDDVERA
A0A7V6YXH8      VVITDH--AFADE--RPVKPKKGLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERT
A0A2V2SDV4      AFITTH--AVPDA--HAVRPNKPFNIALGIIVGLVVGVGLAFFIEYLDTSVKTIDDVERS
A0A6N6PHJ5      VVIIEK--ALAST--KAVKPNKTLNIILGVVIGLIVGVGLAFFIEYLDTSVKTIDDVERT
A0A7Y4QKN3      VKILER--ATPGI--KPVDPNKPFNIFLGVVIGLVVGVGLAFFIEYLDTSVKTIDDVERA
A0A2V5PK75      VEIMDK--AEPGT--KPVKPNKALNIALGIIIGLVVGIGLAFFIEYLDTSVKTIDDVERS
A0A1V6DME1      VEIVDT--AKPGL--RPVRPNKPLNIALGVIIGLVVGVGLAFFIEYLDTSVKTIDDVERA
A0A3D3DIJ3      VEVVDR--AMPGL--RPVRPNKPLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERA
A0A7X7VJR5      VEVVDR--AMPGL--RPVRPNKPLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERA
A0A6I1K583      VRVTDF--AEPAV--KPASPKVVLNIALGAFVGLLLGVGLAFFIEYLDTSVKTIDDVERA
A0A350EWA4      VGVINP--AEEGL--RPVRPNKTLNIALGVIVGLVVGVGLAFFIEYLDTSVKTIDDVERA
A0A832D3W5      VEILER--ATPSD--DPVRPNKPVNIALGIIFGLLIGVGLAFFIEYLDTSVKTIEDVERS
A0A7V2G542      IWH--K--AEPSP--YPSKPKVSMNMALGAIVGLIVGIGLAFFIEYLDTSVKTLEDVESF
A0A7C4KPD7      VKMVDQ--AEPVL--RPVRPKKILNISLGVVAGLVLGIGLAFFVEYLDTSVKTIDDVERA
A0A832MGU4      VVD--K--AEPGI--KPVRPRTTLNIALGVVLGLALGIGLAFFIEYLDTSVKTIDDVERA
A0A1M6RLZ4      FSKVPS--EPAAD--EYVSPNWTLNMALGAVAGLVFGVGIAFALELMDTSVKTLEDVERF
A0A832M6Y9      LIN--R--AEATQ--RPVKPNLVLNIALSAVVGLVLGVSLAFFIEYLDTSVKSLDDVERY
A0A832HP42      VQVVEA--AEPAK--RPVRPNIVLNIVLGAIVGLVMGVGLAFFIEYLDTSVKTIDDVERA
A0A354T7G8      IYA--E--AEPEG--KPAKPNVPLHLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERH
A0A512MBZ2      IYA--K--AEAEG--RPSKPNISLNLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERF
A0A2E8MEZ0      LHE--R--AKKAK--APAYPNVTLNLLLGAGVGLIFGIGIAFLLEHLDTSVKSLEDVERY
A0A7Y2T9S5      VHQ--I--PEING--NPVSPNVPLNLALGAVVGLIFGVGIAFCLEYLDTSVKSLEDVERF
A0A851GRQ2      VHQ--Y--PQIQD--NAVSPNVPLNLALGAVVGLIFGVGIAFALEYLDTSVKSLEDVERF
A0A6B3LBV6      VLD--K--AVAGD--FPVTPNKPLNLILGSVLGLAFGLGIAFALEFMDTSVKTIDDVERY
A0A840UX61      VHE--E--PVEAQ--APVVPNVTLNLALGAIVGLIFGVGIAFLLEYLDTSVKTLEDVERY
A0A4Q2YKS3      VHE--E--PVIAA--SPVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKSLEDVERY
A0A6N6P3T8      VHD--E--PVSAQ--SPVSPNVTLNLILGAVIGLICGLGIAFFLEYLDTSVKTLEDVERY
A0A8A7W668      IHD--E--PVISD--APVSPNVTLNLVLGAVVGLVFGVGIAFFLEYLDTSVKSLEDVERY
A0A2E3EC33      IHEIAE--AADPG--NPARPNIKLHLVLGATVGLVFGIGMAFFLEYLDTSVKSMDEVEHF
A0A2E4GN01      IHEKAE--ASDPD--NPARPNIKLHLVLGAAVGLVFGIGMAFFLEYLDTSVKSLDEVEHF
A0A800JJX7      IHEIAE--AADPG--NPARPNIKLHLVLGAAVGLVFGIGMAFFLEYLDTSVKSLDEVEHF
A0A1Z8XU55      IHEQAE--PSDVD--KPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYY
A0A2E1RQR9      IHEQAE--PSDVD--KPARPNIKXHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYY
A0A2E3ISQ4      IHEEAE--PQDVD--KPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYY
A0A2D6W6F4      IHELAE--PQDVD--KPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYY
A0A2D8Z5A8      IHELAE--PQDVD--KPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYY
                                                                            

A0A2A2XVF1      LHLPALVGIPNRTLKGFSQLKQTLERECAA-LPGRLRQARNIGKPHKKKESSVLGDIQEL
A0A2V5UHJ2      LRLPSLAMV------------PDFVSVNGTNGSYVSRLLKSAQAELPVSA----------
A0A2V5PST3      VDLSTFGVV------------P---------DLASLNRPLISYQPVSSGKPKRIAQLQAQ
A0A2V5PXM3      LGIPVLSAI------------PKFASVAGD-QRKLINAE------DAESG----------
A0A1V5QB01      LGLPFFGLV------------PAASWDPEDLRTHILSNI------DQKSG----------
A0A800JGC6      TGFPILGAI------------PQGQQAVEKTVKKGSRSHVLLFNSDNHSP----------
A0A7Y2T8X5      IGLNCLSAI------------PDGSIFDIDHDWVNVLTA------EPNTP----------
A0A1J4XH17      VGLPLLGVI------------PRMANLNTQEKAKTVVKG------TEKTV----------
A0A7C5LI63      LQLPFLGMI------------PAAQWSPDDLTAHRLDRV------KQQGG----------
A0A7C5P291      LQLPFLGMV------------PAAQWNPDDLTAHRLDRL------KQQGG----------
A0A290QGD9      MGLHLLGII------------PQVRKMPAPEKAQVVANH------ADRQV----------
A0A1D8AS58      IGLPLVGII------------PEIKRMDQPDKAQIVINN------QDKQV----------
I6AQC1          VGLPLLGVI------------PQIKKMDQADKAQVALNN------ADRQV----------
W0ITH7          VGLPLLGVI------------PQIKKMDQADKAQVALNN------ADRQV----------
A0A139SU05      LGTSLLGIV------------PDLASVKDEDKYTLLLKD------THPTA----------
A0A139SPN4      LNTSLLGIV------------PDLNNVKDEDKYTLLLKD------TNPTA----------
A0A1V6E7N1      IGTTLLGIV------------PDLADTPDDDRYRMVLDH------RQSPG----------
A0A2D9MYT1      LKLPFLGYV------------P-------NIKTTSIIERDLQAHLHPQSN----------
A0A258ANJ7      LRVPVLGMI---------ANQRQIATASEQQKGHDFTQGLTPALIAHKAV----------
A0A1Z8ZMT6      FGISILSAI--------QKLPPEEELLEKMESLRDLPVSMKHISPTLAVP------GWKT
A0A2E8MCT7      FGISILSAI--------QKLPPEEELLKEMESIRDLPVSMKHICPTLAVP------GWKT
A0A139TLN4      TDIPVYGVL------------PRKPRKLKNQEIVVNLEE-------PSEL----------
A0A1G3ZFT0      FNIPNLAII------------PYSKEQFKDFQDLKRNVKKPIMLLSQKDP----------
A0A5B5WI95      TRQPIIAEL------------PRMSKKERK-NTSLFIKE------EQSVM----------
A0A2N8I9W1      NRQPVIAEL------------PQMNKKESR-NTGLFIQD------EHSVI----------
A0A4Q5IH27      NRQPVIAEL------------PQMNKKESR-NTGLFIQD------EHSVI----------
A0A2N8IBZ6      NRQPVIAEL------------PQMNKKESR-NTGLFIQD------EHSVI----------
A0A7G6DX28      NRQPVIAEL------------PQMNKKESR-NTGLFIQD------EHSVI----------
R6J100          NRQPVIAEL------------PQMNKKESR-NTGLFIQD------EHSVI----------
A0A139TV24      TTLPVIAEL------------PAMSKKEQK-QVSLMLPD------EHSVM----------
A0A2N8HT11      THLPVVAEL------------PAMTKKEQR-QVARMFTD------EHSVI----------
R7DS70          THLPVVAEL------------PAMTKKEQR-QVARMFTD------EHSVI----------
A0A2N8HNL6      THLPVVAEL------------PAMTKKEQR-QVARMFTD------EHSVI----------
A0A290Q2Z2      LGKPVLGVI------------PHSSEAVPPAKSGIVEDP---------AE----------
A0A2A2RGK2      TGVGVIAAI------------PKLSLNARA-SVLVTNEE------RSGIV----------
A0A2A2XXF7      TGVNVIAAI------------PKLSLSTRA-SVLVTNEE------RSGIV----------
A0A146GCJ0      LGLPALTAV------------PEQRSKSVGEQVAEAWNDKTLGSLPKDLAQKQVLEPLRR
A0A2T6D6H8      LDLPALAAI------------PEKRIETVLNQVGEAIREKKLSKIPQEIAGKGVVEPVRK
A0A6B3L938      TGMACLAAI------------PLGSDFRRSGQKFESVIA-----IEPKTV----------
A0A2A2R5D6      LDLPVLAVI------------P-------D-GVGPLIRE------GADSP----------
A0A2V5URB2      LRLPNLAIV------------PDFYRLPNHRNGQKSLIH-----------------YDKY
A0A2V2DJ66      IGLPLLGVI------------PRIKRLSSAEKAQVAASN------ADRAS----------
R7L5A9          IGLPLLGVI------------PRIKRLNSAEKAQVAASN------ADRAT----------
A0A5B5WU87      TDIPVYGVL------------P-------R-KPRKLKNQEIVVNLEEPSE----------
R7DZW0          TSIPVYGEL------------P-------R-KPRKLKNQEIVVNLEEPSE----------
A0A2N8HID1      TSIPVYGEL------------P-------R-KPRKLKNQEIVVNLEEPSE----------
A0A2N8HS06      TSIPVYGEL------------P-------R-KPRKLKNQEIVVNLEEPSE----------
A0A6N2TNT9      TSIPVYGEL------------P-------R-KPRKLKNQEIVVNLEEPSE----------
A0A4P5QM05      LSLPVLAVI------------P-------T-EIVILLQQ------KRDTA----------
A0A4Q3C001      LQIPVLAVV------------P-------K-GVSALMKE------SNDSQ----------
B4DB23          LQIPVLAVI------------P-------N-NVSILMKN------AGDTS----------
A0A5R8KA81      TDVPVIAAL------------PQSSKFKSP-AHSLVMVK------DPNSP----------
A0A2E6T482      LGAAVLGVI------------P-------Q-NVGSLLEE------GDESP----------
A0A3C0DQZ7      LGAAVLGVI------------P-------Q-NVGSLLEE------GDESP----------
A0A1Z9CBK5      LNAAVLGVI------------P-------Q-NVGSLVDE------GDESP----------
A0A2D6ZI96      LNAAVLGVI------------P-------Q-NVGSLVDE------GDESP----------
A0A358KGZ3      LDAAVLGVI------------P-------Q-NVGSLMDE------GDESP----------
A0A2E9ZQX4      LDAAVLGVI------------P-------Q-NVGSLMDE------GDESP----------
A0A3D5JZU0      LNAAVLGVI------------P-------Q-NVGSLMDE------GDESP----------
A0A2E6HCR0      LNAAVLGVI------------P-------Q-NVGSLVDE------GEESP----------
A0A1Z8WN04      LNTAVLGVI------------P-------Q-NVGSLVDE------GEESP----------
A0A2D7L1N4      LNTAVLGVI------------P-------Q-NVGSLVDE------GEESP----------
A0A2E2R937      LNTAVLGVI------------P-------Q-NVGSLVDE------GEESP----------
A0A520QQY4      LNTAVLGVI------------P-------Q-NVGSLVDE------GEESP----------
A0A2D5MR66      LNTAVLGVI------------P-------Q-NVGSLVDE------GEESP----------
A0A2E0PDQ1      LNTAVLGVI------------P-------Q-NVGSLVDE------GEESP----------
A0A2E2ZZP9      LNTAVLGVI------------P-------Q-NVGSLVDE------GEESP----------
A0A4P5YMI6      LQTSVLGVI------------P-------Q-NVGSLLDE------GVDSP----------
A0A7C4LRK7      LQAPVLGVI------------P-------Q-HVSNLLDE------GPESP----------
A0A3C1VJ32      FQAPVLGVI------------P-------Q-NIGYLLEE------GAESK----------
A0A7W1VTI1      LQAPVLGVI------------P-------Q-NVGTLLFE------GPESP----------
A0A7V4IGZ6      LQSPVLGVI------------P-------Q-NVGLLIKE------GTESP----------
A0A2N9NTX7      LQSPVLGVI------------P-------Q-NVGLLVDE------GVESP----------
B9XK55          LQAPVLGVI------------P-------Q-NVGLLLDE------GAESP----------
A0A2A2RGF2      LSAPVLAVI------------P-------Q-NVGALLDE------GMDSP----------
A0A2G4I5Y6      LQAPVLAVI------------P-------Q-NVGALLDE------GMDSP----------
A0A6N6PS97      LHSAVLGVI------------P-------Q-NVGSLLEE------GADSP----------
A0A3M1I883      LEATVVGVI------------P-------Q-NIGLLIKE------GPDSP----------
A0A1V6JZ45      LSAPVLGVI------------P-------Q-NVGILVNE------GPDSP----------
A0A848A4B3      LSAPVLGVI------------P-------Q-NVGILVNE------GPDSP----------
A0A7C7Z746      LQAPVLGVI------------P-------Q-NVGSLLDE------GPDSP----------
A0A520RRW5      LDAPVLGVI------------P-------Q-NVHSLLME------GPDSP----------
A0A356NPK0      LDAPVLGVI------------P-------Q-NVHSLLME------GPDSP----------
A0A2D7B5P5      LDAPVLGVI------------P-------Q-NVHSLLME------GPDSP----------
A0A3D3XGB5      LDAPVLGVI------------P-------Q-NVHSLLME------GPDSP----------
A0A2V6F8A1      LQAPVLGVI------------P-------Q-NVGSLIQE------GPESP----------
A0A2V5TNH4      LQAPVLGVI------------P-------Q-NVSSLILE------GSESP----------
A0A2V5X5Q6      LQAPVLGVI------------P-------Q-NVSSLILE------GPESP----------
A0A3R5R2M8      VRQPVIAEL------------PKMSKKERK-NNTPLIRN------DHSVI----------
A0A411SUQ6      NRQPVIAEL------------PQMSKKESK-NTKLFIQD------EHSVI----------
A0A2N8HZF2      NRQPVIAEL------------PQMNKKESR-NTGLFIQD------EHSVI----------
A0A354E720      NRQPVIAEL------------PQMSKKESR-NTKLFIQD------EHSVI----------
A0A7T8XNA1      NRQPVIAEL------------PQMSKKESK-NTKLFIQD------EHSVI----------
B2UPB6          NRQPVIAEL------------PQMSKKESK-NTKLFIQD------EHSVI----------
A0A1Q6UHJ9      VGLPLLGVI------------PRIRRLNSSQKAQVAVSN------ADRAT----------
A0A2V2BXR0      VGLPLLGVI------------PRIRRLNSSQKAQVAVSN------ADRAT----------
A0A3C1HEJ2      LKVPLLGAI------------PQMKELQSSDSSQVIMAD------PRLVA----------
A0A522ULD9      LGLPVLGAI------------P-------Q-RVKPLHEE------GPDSP----------
A0A7W1RNH4      TEVPVLGLI------------PRIRVRSTDGAFKRFAVHLKRKVKRERAPVPLVGLTPTS
A0A2D8V0G3      LKLNFLGYI------------P-------NIKSQSLVERDLQAHLHPQSN----------
A0A348S017      LRLNFLGYI------------P-------NIKTNSLVERDMQAHLHPQSN----------
A0A3C1UUV7      LRLNFLGYI------------P-------NIKTNSLVERDMQAHLHPQSN----------
A0A350I3V2      LRLNFLGYI------------P-------NIKTNSLVERDMQAHLHPQSN----------
A0A520RGV5      LRLNFLGYI------------P-------NIKTNSLVERDMQAHLHPQSN----------
A0A3D3XF90      LRLNFLGYI------------P-------NIKTNSLVERDMQAHLHPQSN----------
A0A2D7B522      LRLNFLGYX------------P-------NIKTNSLVERDMQAHLHPQSN----------
A0A356NIC2      LRLNFLGYI------------P-------NIKTNSLVERDMQAHLHPQSN----------
A0A832MDW4      LHLPFLGYV------------P-------NIKSNSVVERDLQSHLHPQSN----------
A0A1V6JU76      LHLPFLGYI------------P-------NIKTNSVVESGLQAHLHPQSN----------
A0A848ABG7      LHLPFLGYI------------P-------NIKTNSVVESGLQAHLHPQSN----------
A0A2A2XXW5      LHLPFLGYI------------P-------NIKSISIVERDLQSHLHPTSS----------
A0A6N6Q6V0      LHLQFLGYI------------P-------NIKSASVVERDLQAHLHPTSS----------
A0A2V6JLK8      LGVPVLAII------------P-------K-NINLLHKA------EGDTP----------
A0A2W5Z1A5      LGVPVLAII------------P-------K-NVTLLHHE------IGDSP----------
A0A2V6EA09      LGLPVLAII------------P-------K-NIKLLHRE------AGDTP----------
A0A2V6GQI7      LGLPVLAII------------P-------K-NIKLLHRE------AGDTP----------
A0A7W1U7K0      LGVPVLAII------------P-------R-NIKILHRE------AGDIP----------
A0A7W0YDK6      LGVPVLAVI------------P-------Q-NIRLLHRE------TKDTP----------
A0A7V9EPY1      LGVPVLAII------------P-------Q-NIGLLANE------GGDTP----------
A0A838TCM2      LGVPVLAII------------P-------Q-NIGLLARE------GGDSP----------
A0A2N8HDG3      TSLPVVAEL------------PAMTKKEQR-QVARMFTD---------------------
A0A3E1ET42      LGVPVLAVI------------P-------K-DVGILHKQ------SGLSP----------
A0A2A2YDW8      LQVPVLAVI------------P-------K-DIGVLHKQ------SGMSP----------
A0A352XLN9      LQVPVLAVI------------P-------K-DIGVLHKQ------SGMSP----------
A0A3D0YP62      LQVPVLAVI------------P-------K-DVGVLHRQ------SGMSP----------
A0A3D3DV47      LQVPVLAVI------------P-------K-DVGVLHRQ------SGMSP----------
A0A7Y1UNY2      LQVPVLAVI------------P-------K-DVGVLHKQ------SGMSP----------
A0A2E5XJ49      LQVPVLAVI------------P-------K-DVGVLHKQ------SGMSP----------
A0A2E6SBY8      LQVPVLAVI------------P-------K-DVGVLHKQ------SGMSP----------
A0A2E5QMS4      LQVPVLAVI------------P-------K-DVGTLHKQ------SGMSP----------
A0A2E7YXQ3      LQVPVLAVI------------P-------K-DVGILHKQ------SGMSP----------
A0A2E3H787      LQIPVLAVV------------P-------T-DVNVLHKQ------SGMSP----------
A0A2E7AGN1      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A2E7AKY7      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A3D4CU34      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A2E8M146      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A355S8S2      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A2D6DVN8      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A3C1W2R2      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A2E3NAY6      LQVPVLAVV------------P-------T-DVGVLHKQ------SGMSP----------
A0A2E3II01      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A368B8C5      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A3R7RBB5      LQVPVLAVI------------P-------T-DVGVLHKQ------SGMSP----------
A0A2A2QX62      LQVPVLAVI------------P-------K-DVGVLYKQ------SGMSP----------
A0A4Q3BWH6      LQVPVLAVI------------P-------K-DVGVLYKQ------SGMSP----------
A0A858RHU7      LQVPVLAVI------------P-------K-DVGVLYKQ------SGMSP----------
A0A7V7VLV5      LQVPVLAVI------------P-------K-DIGILHKQ------SGMSP----------
A0A3N5WCF1      LQVPVLAVI------------P-------K-DVGILHKQ------SGMSP----------
A0A4Q3C1K5      LQVPVLAVI------------P-------K-DVGVLHKQ------SGMSP----------
A0A3D1TI55      LGLPVLGII------------P-------Q-RVRPLVEE------GPDSP----------
A0A3R8IT45      VGLPLLGVI------------PQIKKMDQA-DKAQVVSN------NADRQ----------
A0A2A2PYE8      VGLPLIGII------------PQIKRMDQP-DKAQIVIN------NADRQ----------
A0A2T6CN73      VGLPLIGII------------PEIKKLEQV-EKAQIVAT------NTDRL----------
A0A2G4G428      LGIPILGTI------------PQITKSVGP-ERALLAMH------EKDVV----------
A0A6N6PCD8      LDLASLAAV------------P-------EIDSKKLLKAEESPLVLIDDP----------
A0A139TUL1      VSLPLAGEL------------PLLSGKERK-KLPLVVIN---------------------
A0A2N8HCB0      TDLPLAGAL------------PLLSGKERA-KLPLVVMN---------------------
A0A2N8HP04      TDLPLAGEL------------PLLSGKERK-KLPMVVTN---------------------
A0A2N8HRJ0      TDLPLAGEL------------PLLSGKERK-KLSLVVTN---------------------
A0A6N2U9Y7      TDLPLAGEL------------PLLSGKERK-KLPLVVTN---------------------
A0A6N6PAZ1      TNVTVLGAI------------ADIKLHHLE-VAEQVFRK------RNPDS----------
A0A7V7VK26      TGITVLGAI------------ANIKLAHLD-VAEQMFRK------RHPES----------
A0A6I1K459      LGLPVLGAV------------PKNKLVKDG-KSRLFMSD------DPQSL----------
D5ENH7          IGLPLLGVV------------PRIKKLDSNSKAQAVASN---------------------
A0A0R2XQ77      IGLSMLGVV------------PRIKKLDSSSKAQAVASN---------------------
A0A2E9IN28      IGLPMLGVV------------PRIKKLDSNTKAQAVASN---------------------
A0A6N4WTJ5      IGLPMLGVV------------PRIKKLDSNSKAQAVASN---------------------
A0A366HAG0      LSVPVLAVV------------P-------K-GVGTLMHA------TGITP----------
A0A2U8DZK4      LQRPVLGVI------------PSSLTARKPAEEPLDPAE---------------------
A0A2T6DFL8      LGLPVLGVI------------PFAQDPLARG--GDDPAE---------------------
A0A1D8AWD4      LSLPVLGVI------------PHMAEAGELH--DPSSPE---------------------
A0A4Q1C9S2      LGLPVLGVI------------PHLPEPPALH--DATAPE---------------------
A0A178IH18      LQRPVLGVI------------PASATARRPNEDSGDPAD---------------------
A0A2T6DT99      LQRPVLGVI------------PNAPDPLKKDAAGEDPAE---------------------
A0A1G3ZT33      LKLPVLSVI------------PLSRTPARLD--PDNPAE---------------------
A0A3E1E2T2      LKLPVLGVI------------PFHRDPLDEE--GD-PAE---------------------
B1ZMW1          LKLPVLGVI------------PRQTDPLGGD--ED-PAE---------------------
A0A3M1I8A3      LQMPFLGYV------------P-------SIKSAKEVERYLQCHLHPQSN----------
A0A4V0XS84      LQVPFLGYV------------P-------SIKRESVVERDLEAHSNPTSI----------
A0A351WE84      LGLPVLGVI------------P-------Q-KIRPLIHE------GPESP----------
A0A7W1MRT6      LHIPGLSII------------P---------HMAPARKLTAFGRHLRLPG----------
A0A7W1YXK2      LGLTVVAAV---------PLLSDLNSLGAHRELPVLH--------DPDSP----------
A0A2D5WGA5      LGAAVLGVI------------P-------Q-NVGSLLDE------GDESP----------
A0A2E7SSH2      LDAAVLGVI------------P-------Q-NVGSLMDE------GDESP----------
A0A832HNU4      YGVPLLSNV------------PRITPKPQAEDMKILQTH-------PHSM----------
A0A1V5QDZ6      LGLSVLGII------------P-------Q-KVRPLTEE------GPDSP----------
A0A4Y8P964      FGLPVLGSV------------PDVEFLQGE-GIDEIPKDIPFALTTHAAP----------
A0A3D4HF88      LNLPLIGVV------------AKLQELSAK-EKAIAVAS------NADRR----------
A0A1V6J089      LGLPVLAVI------------P-------Q-QSRPLTEA------GQSSG----------
A0A3C1BZR1      LGLPVLAVI------------P-------Q-QSRPLTEA------GQSSG----------
A0A848WTQ6      LDTNVLAVV------------P-------K-DVGLLVNG------TANLA----------
A0A6N6ZHN8      LGLPLIGLI------------PRISRIDAL-EKARIVAD------NLDRP----------
A0A6G6K641      TGLPVLTAIIAKKTSARKNPLP---------DLEIVHQK--------NSP----------
A0A849Y642      LRIPVLGVV------------P-------Q-DVKPLIQL------DDVSP----------
A0A7C4KLL2      LQLPVFTAI------------PKLKEVRLG-ETRFVASE------GSDSR----------
A0A1H6KPB7      LNLPVLGVI------------P-------Q-DIGLLHLM------NGSSP----------
A0A2E9ISN4      YHIDLLGQI------------R---------RWDLYLPI------DKFNP----------
B9XAX1          LGLPVLAAI------------PVAKKGRNG-TPAHIVAD------DPGSI----------
A0A5R8KKM9      LGVPVLAVI------------P-------K-NVGALHRT------TGLNP----------
A0A7W8DJ38      LRVPVLGTI------------A-------NLRPSVLAETQKAQEQNHSGL----------
A0A7W1ZQ43      LRLPVWAAI------------PATAKGKNK-KFPHITAE------SPASL----------
A0A139TS01      LQVPVLGII------------P-------K-NVPILHSA------GSLGP----------
A0A3E1EJT7      VDLPLLGVI------------PEVKRMDQP-DKAQIVSN------GSDPA----------
A0A848WYP9      LGLSVLAEI------------PQAFDENWELRESLFVSN------SPASL----------
A0A7C3I5X9      LRLPFLGYV------------P-------NIKSNSLVERFQTSHLHAQSN----------
A0A349GXM8      LGVRFLGGI------------PYWAHSQLESSIRPIVTE------EHSTG----------
A0A7V3QFN7      LQAPVLGVI------------P-------Q-NVKLLINE------GADSG----------
A0A4P5YP61      LQLPVLSAI------------PQITAFG-N-NRGLVVVD------DAKSI----------
A0A6B2LYM4      LGVPLVGIV------------PHIFSIDSQ-EKARIAAD------EHDKH----------
A0A6D1VXB3      LGIPVLGSI------------PDIELIKGE-GIDEIPKDIPFALTTYSSP----------
I0JYY7          LGIPVLGSI------------PDIELIKGE-GIDEIPKDIPFALTTYSSP----------
A0A4Y8P842      LKIPVLGVI------------PDIEKLKKS-HPETYEGEIPYALMTYALP----------
B3DZK9          LKIPVLGVI------------PDIEKLKKH-QPETYEGDIPYALMTYALP----------
A0A4R7S1J2      LRLPVLATI------------NKAKYS--D-EAGAILKH------AEHSP----------
A0A2A2XV69      LKIPVLAVI------------P-------K-EISLLING------NDDNP----------
A0A651H7X9      VGLPLIGLI------------PRLRKMEVH-EKAQIVLN------NEDRQ----------
A0A5E6MPC4      LGLPVLGQV------------PDTEKLKAK-GIDEIPADLPMAFAAHVAP----------
A0A840V0I7      TSKTVLGSI------------SQMKEGVLE-GIVSKQEK------KTGIP----------
A0A146G2Q9      LKVPVLAVI------------P-------K-GISLLVNE------AKDNA----------
A0A2T6D3Y2      LKVPVLAVI------------P-------K-GISLLVNE------TKENA----------
A0A6N6PKP9      LGLSSLAAI------------PRQARS--V-VAGSVLVK------KPQSA----------
A0A6N6Z250      LEVPVLGVV------------A-------R-EARLIGPK------DFDSP----------
A0A4V1SB02      LELGVLAAV------------PDGDSSKIP-KGGTVMTD------DANSS----------
A0A6N6QEJ2      LGAPVLGVI------------P-------Q-NVGALINE------GADSP----------
A0A3C1VB86      LALPVLGAI------------PKLPKTEGK-GNDLAAAQ------DSNSP----------
A0A6N6P5E3      LGYQVLAII------------P-------K-DVAVLKDA------PSDCP----------
A0A838I246      LGVPVLAII------------P-------K-NIKLLHKE------PGDTP----------
A0A6J4HTK1      LGVPVLAII------------P-------K-NIKLLHKE------PGDTP----------
A0A838FVV7      LGVPVLAII------------P-------K-NIKLLHKE------PGDTP----------
A0A7C3HWX0      LQAPVLGVI------------P-------Q-NVGLLLEQ------GPDSP----------
A0A7V4LSC4      LQAPVLGVI------------P-------Q-NVGLLLEQ------GPDSP----------
A0A2D5VY59      LGAPVLGVI------------P-------Q-NVQSLLLE------GPDSP----------
A0A2D8UZZ4      LGAPVLGVI------------P-------Q-NVQSLLLE------GPDSP----------
A0A353DV86      LGAPVLGVI------------P-------Q-NVQSLLLE------GPDSP----------
A0A2E5EPT8      LQAPVLAVI------------P-------Q-NVGVLMNE------DPDTP----------
A0A5B5WZ91      LQVPVLGII------------P-------K-NVPILHSA------GSLGP----------
A0A2N8HD92      LQVPVLGII------------P-------K-NVPILHSS------DVLGP----------
A0A2N8HIT2      LQVPVLGII------------P-------K-NVPILHSS------DVMGP----------
A0A354EBD3      LQVPVLGII------------P-------K-NVPILHSS------GVMGP----------
A0A355VEB2      LQVPVLGII------------P-------K-NVPILHSS------GVMGP----------
R6K1U5          LQVPVLGII------------P-------K-NVPILHSS------DAMGP----------
A0A2N8IWC2      LQVPVLGII------------P-------K-NVPILHSS------DAMGP----------
A0A2N8I441      LQVPVLGII------------P-------K-NVPILHSS------DAMGP----------
A0A2N8I3A6      LQVPVLGII------------P-------K-NVPILHSS------DAMGP----------
A0A410SCC4      LQVPVLGII------------P-------K-NVPILHSS------DAMGP----------
A0A3R5VEW0      LQVPVLGII------------P-------K-NVPILHSS------DVMGP----------
A0A7T9B0I0      LQVPVLGII------------P-------K-NVPILHSS------DVMGP----------
B2UKW3          LQVPVLGII------------P-------K-NVPILHSS------DVMGP----------
A0A411SSG2      LQVPVLGII------------P-------K-NVPILHSS------DVMGP----------
A0A6M1RXR2      LGAPVLGVI------------P-------Q-NVGLLLEE------GAESP----------
A0A7C3DXS4      LGAPVLGVI------------P-------Q-NVGLLLEE------GAESP----------
A0A7V6YXH8      LQAPVLGVI------------P-------Q-NVGFLLEE------GAESP----------
A0A2V2SDV4      LNSPVLGVI------------P-------Q-NVGAILDE------GAESP----------
A0A6N6PHJ5      LQSPVLGVI------------P-------Q-NVGLLIEE------GAESP----------
A0A7Y4QKN3      LQSPVLGVI------------P-------Q-NVGYLIEE------GVESP----------
A0A2V5PK75      LQSPVLGVI------------P-------Q-NVGLILDE------GVDSP----------
A0A1V6DME1      LQSPVLGVI------------P-------Q-NVGSLLQE------GAESP----------
A0A3D3DIJ3      LQCPVLGVI------------P-------Q-NVGLLVDE------GTESP----------
A0A7X7VJR5      LQCPVLGVI------------P-------Q-NVGLLVDE------GTESP----------
A0A6I1K583      LSAPVLAVI------------P-------Q-NVGALLDE------GMDSP----------
A0A350EWA4      LQAHVLGVI------------P-------Q-NVGSLLDE------GPDSP----------
A0A832D3W5      LQAPVLGVI------------P-------Q-NVKLLINE------GADSG----------
A0A7V2G542      LGVPVLAVI------------P-------K-NIQLLHKV------SSDSP----------
A0A7C4KPD7      LQAPVLGVI------------P-------Q-NVGNLLEE------GPESP----------
A0A832MGU4      LQAPVLGVI------------P-------Q-NVGNLLDE------GPESP----------
A0A1M6RLZ4      LQVPVLAVI------------P-------R-DVGVLHKQ------SGASP----------
A0A832M6Y9      LNTTVVGVV------------P-------E-GVNTLNLE------GPDSP----------
A0A832HP42      LQSPVLGVI------------P-------Q-NIGNILKE------GPDSP----------
A0A354T7G8      LGVPVLAVV------------P-------K-GVGVLHRS------SGFNP----------
A0A512MBZ2      LGVPVLAVV------------P-------K-NVGVLHRT------SGFNP----------
A0A2E8MEZ0      LQVPVLAVI------------P-------K-DVGVLHKQ------SGMSP----------
A0A7Y2T9S5      LKVPVLAVI------------P-------R-DVGVLHKQ------TGMSP----------
A0A851GRQ2      LKVPVLAVI------------P-------K-DVGVLHKQ------AGSSP----------
A0A6B3LBV6      LNVPVLAVI------------P-------K-DVGVLHRE------GGMSP----------
A0A840UX61      LQVPVLAVI------------P-------K-DVGVLYKQ------SGMSP----------
A0A4Q2YKS3      LQVPVLAVI------------P-------K-DVGVLHKQ------SGMSP----------
A0A6N6P3T8      LQVPVLAVI------------P-------K-DIGILHKQ------SGMSP----------
A0A8A7W668      LQVPVLAVI------------P-------K-DVGVLHKQ------NGMSP----------
A0A2E3EC33      LELPVLAVI------------P-------Q-AVGVLXRQ------SGLSP----------
A0A2E4GN01      LELPVLAVI------------P-------Q-DVGILHRQ------SGLSP----------
A0A800JJX7      LELPVLAVI------------P-------Q-DIGILHRQ------SGLSP----------
A0A1Z8XU55      LDLPVLAVI------------P-------K-DVGVIHKQ------SGLSP----------
A0A2E1RQR9      LDLPVLAVI------------P-------K-DVGVIHKQ------SGLSP----------
A0A2E3ISQ4      LDLPVLAVI------------P-------K-DINVLHKE------SGLSP----------
A0A2D6W6F4      LDLPVLAVI------------P-------K-DINVLHKE------SGLSP----------
A0A2D8Z5A8      LDLPVLAVI------------P-------K-DINVLHKE------SGLSP----------
                                                                            

A0A2A2XVF1      IRPAPIARTDSEKYPIATIEEPESGLAEAYRTLRVSISML---GPEEERRVLLFVSAIPE
A0A2V5UHJ2      ---RKAAKAKHADSSVLLDHHSLSVVAEAYRSFRSALLLS---QAGGPPHTILVTSAARG
A0A2V5PST3      QKTSNGKDLIVSYHPLSIF-------SESYRTIRTALLLS---EPEATRKVILLTSPSPG
A0A2V5PXM3      ---E----------------------AEAFRTLRTAISML---GRKEERRVFLFTSAVPS
A0A1V5QB01      ---M----------------------VEAYRNVRSALLFS---VAGSQSKFIAMTSAVPK
A0A800JGC6      ---T----------------------AESIRNLRAGLSFL---GDKEDRRTFMFTSAVPG
A0A7Y2T8X5      ---S----------------------AEAIRNLRASVTLL---GKAERHQTILITSSVPG
A0A1J4XH17      --------------------------LESFRAIDSLLRLN---KASKPARVITVTSTLPS
A0A7C5LI63      ---V----------------------AEAYRVVRSAIIFS---IPREKLRSLLLTSAVPR
A0A7C5P291      ---V----------------------AEAYRVVRSAIIFS---TPRDKLRSILVTSAVPR
A0A290QGD9      --------------------------SEAFLTLHSSLRLK---DDARAAKCILVTSTIPG
A0A1D8AS58      --------------------------VESFLTLHSSLRLK---DESKAAQAILVTSTIPG
I6AQC1          --------------------------AEAFLTLHSSLRLR---NDSKNAQTFLTTSTVPG
W0ITH7          --------------------------AEAFLTLHSSLRLR---NDSKNAQTFLTTSTVPG
A0A139SU05      --------------------------VEAFMGIYGAAKTH---SLVDYPKSMLVTSTIPG
A0A139SPN4      --------------------------VEAFTGIYSAAKTH---SLVDYPKAMLVTSTIPG
A0A1V6E7N1      --------------------------LEAFLSIYSSVKIH---SKLDFPKSILVTSTIPG
A0A2D9MYT1      ---S----------------------AEAFRTVRAAISLS---VRAGDLQILSVTSTVPS
A0A258ANJ7      --------------------------AESFREFRAIIAR----MARCPHTCHMVVSAVPD
A0A1Z8ZMT6      DFVH----------------------SEMFRVLRASISLL---GDANQRKITMITSSIPG
A0A2E8MCT7      DFVH----------------------SEMFRVLRASISLL---GDTNQRKITMITSSVPG
A0A139TLN4      --------------------------SESFPLLAERLVSLAD-ENGPGGFSILLTSSCPG
A0A1G3ZFT0      ----------------------RNLSIESLRSLRTSLQVN---LSCANNNIISILGASPG
A0A5B5WI95      --------------------------AECFHILRNNVDSLLP-RPDEGGHVIMLTSTTPG
A0A2N8I9W1      --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
A0A4Q5IH27      --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
A0A2N8IBZ6      --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
A0A7G6DX28      --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
R6J100          --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
A0A139TV24      --------------------------AEYFHIMCHNVDSMLP-FSEHQGHVILLASTTPG
A0A2N8HT11      --------------------------SEYFQILCHNADSMLP-VTRNQGHVILLTSTMQG
R7DS70          --------------------------SEYFQILCHNADSMLP-VTRNQGHVILLTSTMQG
A0A2N8HNL6      --------------------------SEYFQILCHNADSMLP-VTRNQGHVILLTSTMQG
A0A290Q2Z2      --------------------------LEPFRVLHTNLNLAL--KGVTPGRSLVMLSAGPG
A0A2A2RGK2      --------------------------AESFRSLRASLTLH---RINEDARTFLFTSSMPS
A0A2A2XXF7      --------------------------AESFRSLRASLTLH---RLNESARTFLFTSSMPS
A0A146GCJ0      SLNRKEREAQLKKHPLIFVEDPSSMQAEAIRTLRTSISLL---GKQDDRKTFLFASAIPQ
A0A2T6D6H8      FLNAREATAQAKRHPLVFIDDPASLQAEAIRTLRTSLSLL---GKQETRRTFLFASSIPE
A0A6B3L938      ---H----------------------AESIRNLRASIRLL---GRKERNQVICLTSALPG
A0A2A2R5D6      ---H----------------------AEGYRILRAKIDLN---PKSGAGNTLTVVSGGPG
A0A2V5URB2      NKVKFDNKLCLPSKKSSLSDRRISVVTESYRKLRAAIFLS---RPEAPPKTILFTSGTAS
A0A2V2DJ66      --------------------------TEAFRTLYSTLKIN---NVSKDAKVILATSTTPS
R7L5A9          --------------------------TEAFRSLHSTLKVN---NFSKNAKVILFTSTTPS
A0A5B5WU87      ---L----------------------SESFPLLAERLVSLAE-ENGPGCFSILLTSSCPG
R7DZW0          ---L----------------------SECFPLLAERMVALSD-GNEGNPLSVLITSTCSG
A0A2N8HID1      ---L----------------------SECFPLLAERMVALSD-GNEGNPLSVLITSTCSG
A0A2N8HS06      ---L----------------------SECFPLLAERMVALSD-GNGGNPLSVLITSTCSG
A0A6N2TNT9      ---L----------------------SECFPLLAERMVALSD-GNGGNPLSVLITSTCSG
A0A4P5QM05      ---D----------------------AEAYRILKGNIELN---LPDHGANTYTLVSGGPG
A0A4Q3C001      ---H----------------------AEAYRILRANVEFN---KPGRDANTFTLISGGPG
B4DB23          ---D----------------------AEAYRILRAAVEFN---KPYRDANTFTLISGGPG
A0A5R8KA81      ---I----------------------AESFRILRSSLELM---EDHDKDEVVLFTSSIPS
A0A2E6T482      ---H----------------------AEAYRVLRTNILFAG--RKSEDQTTFSVVSGGAG
A0A3C0DQZ7      ---H----------------------AEAYRVLRTNILFAG--RKSEDQTTFSVVSGGAG
A0A1Z9CBK5      ---H----------------------AEAYRVLRTNILFAG--RTSEXXTTFSVVSGGAG
A0A2D6ZI96      ---H----------------------AEAYRVLRTNILFAG--RTSEXXTTFSVVSGGAG
A0A358KGZ3      ---H----------------------AEAYRVLRTNILFAG--RKSEDQTTFTVVSGGAG
A0A2E9ZQX4      ---H----------------------AEAYRVLRTNILFAG--RKSEDQTTFTVVSGGAG
A0A3D5JZU0      ---H----------------------AEAYRVLRTNILFAG--RKSEDQTTFSVVSGGAG
A0A2E6HCR0      ---H----------------------AEAYRVLRTNILFAA--RKSEDQTTFTVVSGGAG
A0A1Z8WN04      ---H----------------------AEAYRVLRTNILFAG--RQSEDQTTFTVVSGGAG
A0A2D7L1N4      ---H----------------------AEAYRVLRTNILFAG--RQSEDQTTFTVVSGGAG
A0A2E2R937      ---H----------------------AEAYRVLRTNILFAG--RQSEDQTTFTVVSGGAG
A0A520QQY4      ---H----------------------AEAYRVLRTNILFAG--RQSEDQTTFTVVSGGAG
A0A2D5MR66      ---H----------------------AEAYRVLRTNILFAG--RQSEDQTTFTVVSGGAG
A0A2E0PDQ1      ---H----------------------AEAYRVLRTNILFAG--RQSEDQTTFTVVSGGAG
A0A2E2ZZP9      ---H----------------------AEAYRVLRTNILFAG--RQSEDQTTFTVVSGGAG
A0A4P5YMI6      ---H----------------------AEAYRVLRTNLMFA---RKDPKANSLIVVSSGAG
A0A7C4LRK7      ---H----------------------AEAYRVLRTNLLFS---RKDDKWNTLTIVSAGAG
A0A3C1VJ32      ---H----------------------AEAYRVLRTNLLFS---RKDEKLNTIVIVSAGAG
A0A7W1VTI1      ---N----------------------AEAYRVLRTNILFS---RKDPSWNTITVVSAGVG
A0A7V4IGZ6      ---H----------------------AEAYRVLRTNLLFS---RKDEKLNSLCVVSAGAG
A0A2N9NTX7      ---H----------------------AEAYRVLRTNLLFS---RKDEKLNTVAVVSAGAG
B9XK55          ---H----------------------AEAYRVLRTNLMFS---RKDDKLNTMAVVSAGAG
A0A2A2RGF2      ---H----------------------AEAYRVLRTNVLFT---RKDDQANAITVVSGGAG
A0A2G4I5Y6      ---H----------------------AEAYRVLRTNVLFT---RKDDAANAITVVSGGAG
A0A6N6PS97      ---H----------------------AEAYRVLRTNMLFG---RTDPKANTITVVSGGAG
A0A3M1I883      ---H----------------------AEAYRVLRTNVLFS---RKNPNDNTITVVSGGAG
A0A1V6JZ45      ---H----------------------GEAYRVLRTNILFS---RKEPGANTLTVVSGGAG
A0A848A4B3      ---H----------------------GEAYRVLRTNILFS---RKEPGANTLTVVSGGAG
A0A7C7Z746      ---H----------------------AEAYRVLRTNMTFS---RKDPTKNSLTVVSGGAG
A0A520RRW5      ---H----------------------AEAYRVLRTNILFS---RKNEKANTLTVVSGGAG
A0A356NPK0      ---H----------------------AEAYRVLRTNILFS---RKSEKATTLTVVSGGAG
A0A2D7B5P5      ---H----------------------AEAYRVLRTNILFS---RKXEKAXTLTVVSGGAG
A0A3D3XGB5      ---H----------------------AEAYRVLRTNILFS---RKNEKANTLTVVSGGAG
A0A2V6F8A1      ---H----------------------AEAYRVLRTNVLFS---RKREDANSITVVSGGAG
A0A2V5TNH4      ---H----------------------AEAYRVLRTNVLFS---RKREDANSLTVVSGGAG
A0A2V5X5Q6      ---H----------------------AEAYRVLRTNVLFS---RKREDANSLTVVSGGAG
A0A3R5R2M8      --------------------------AECFHILRNNVDSLLP-RPDAGGYVILLTSTCPA
A0A411SUQ6      --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
A0A2N8HZF2      --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
A0A354E720      --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
A0A7T8XNA1      --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
B2UPB6          --------------------------AECFHILRNNVDSMLP-RPEQGGHVILVTSTLPG
A0A1Q6UHJ9      --------------------------TEAFRSVHSMLKVN---NIAKDSKVLLFTSTTPS
A0A2V2BXR0      --------------------------TEAFRSVHSMLKVN---NIAKDSKVLLFTSTTPS
A0A3C1HEJ2      ---G----------------------AEAFRSLRTTLSML---GPVNERRTFLFTSAVPD
A0A522ULD9      ---H----------------------AEAYRVLRANIQFA----NKGNGGAFSFISGGAG
A0A7W1RNH4      RRSELSKSAAAIARALDLDVESRSGIIEAFGQLQTNIQYA---RPDQRVKSIVVTSALPG
A0A2D8V0G3      ---A----------------------AEGFRTVRAAVSLV---HKSDKFKVLSMTSTIPS
A0A348S017      ---A----------------------AEGFRTVRAAISLV---HKADKFKVLAFTSTIPS
A0A3C1UUV7      ---A----------------------AEGFRTVRAAISLV---HKADKFKVLAFTSTIPS
A0A350I3V2      ---A----------------------AEGFRTVRAAISLV---HKADKFKVLAFTSTIPS
A0A520RGV5      ---A----------------------AEGFRTVRAAISLV---HKADKFKVLAFTSTIPS
A0A3D3XF90      ---A----------------------AEGFRTVRAAISLV---HKADKFKVLAFTSTIPS
A0A2D7B522      ---A----------------------AEGFRTVRAAISLV---HKADKFKVLAFTSTIPS
A0A356NIC2      ---A----------------------AEGFRTVRAAISLV---HKADKFKVLAFTSTIPS
A0A832MDW4      ---A----------------------SESFRTVRAAIALG---SKAGKMRVLTVTSTIPS
A0A1V6JU76      ---A----------------------AESFRTVRAAIALG---AKAEKMRVFTVTSTIPS
A0A848ABG7      ---A----------------------AESFRTVRAAIALG---AKAEKMRVFTVTSTIPS
A0A2A2XXW5      ---P----------------------AEGFRTLRAAISLA---KNADKLRVMAFTSTIPS
A0A6N6Q6V0      ---A----------------------AEGFRTLRAAISLA---RNSEKLRNVAVSSTIPS
A0A2V6JLK8      ---D----------------------AEAYRILRTNIEFN---RANPEANTISLVSGGPG
A0A2W5Z1A5      ---D----------------------AEAYRILRTNIEFN---RRNPEANTISIASGGPG
A0A2V6EA09      ---D----------------------AEAYRILRTNIEFN---RKNPEANTISLVSGGPG
A0A2V6GQI7      ---D----------------------AEAYRILRTNIEFN---RKNPEANTISLVSGGPG
A0A7W1U7K0      ---D----------------------AEAYRILRTNIEFN---RKSADANTLSLVSGGPG
A0A7W0YDK6      ---D----------------------AEAYRILRTNIEFN---RKGSDANTISLVSGGPG
A0A7V9EPY1      ---D----------------------AEAYRILRTNIEFN---RKGPDANTISLVSGGPG
A0A838TCM2      ---D----------------------AEAYRILRTNIEFN---RKSPDTNTITLVSGGPG
A0A2N8HDG3      ---------------------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQG
A0A3E1ET42      ---D----------------------AEAYRILRTNIEFN---RRSADANAITIVSGGAG
A0A2A2YDW8      ---D----------------------AEAYRILRTNIEFN---RKNPEDNSITVVSGAAG
A0A352XLN9      ---D----------------------AEAYRILRTNIEFN---RKNPEDNSITVVSGAAG
A0A3D0YP62      ---D----------------------AEAYRILRTNIEFN---RKNPEDNSITVVSGGAG
A0A3D3DV47      ---D----------------------AEAYRILRTNIEFN---RKNPEDNSITVVSGGAG
A0A7Y1UNY2      ---D----------------------AEAYRILRTNIEFN---RKNPEDNSITIVSGGAG
A0A2E5XJ49      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITIVSGGAG
A0A2E6SBY8      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITIVSGGAG
A0A2E5QMS4      ---D----------------------AEAYRILRTNIEFN---RNNPEDNAITIVSGGAG
A0A2E7YXQ3      ---D----------------------AEAYRILRTNIEFN---RNNPEDNAITIVSGGAG
A0A2E3H787      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITVVSGGAG
A0A2E7AGN1      ---D----------------------AEAYRILRTNIEFN---RSNPEDNSITIVSGGAG
A0A2E7AKY7      ---D----------------------AEAYRILRTNIEFN---RSNPEDNSITIVSGGAG
A0A3D4CU34      ---D----------------------AEAYRILRTNIEFN---RSNPEDNSITIVSGGAG
A0A2E8M146      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITIVSGGAG
A0A355S8S2      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITIVSGGAG
A0A2D6DVN8      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITIISGGAG
A0A3C1W2R2      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITIISGGAG
A0A2E3NAY6      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITIVSGGAG
A0A2E3II01      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITIISGGAG
A0A368B8C5      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITIISGGAG
A0A3R7RBB5      ---D----------------------AEAYRILRTNIEFN---RNNPEDNSITIISGGAG
A0A2A2QX62      ---D----------------------AEAYRILRTNIEFN---RKNPEDNSITVVSGGAG
A0A4Q3BWH6      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A858RHU7      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A7V7VLV5      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A3N5WCF1      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A4Q3C1K5      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A3D1TI55      ---H----------------------AEAYRVLRTNLQFA---AKDPGANAITIVSGGVG
A0A3R8IT45      ---V----------------------SEAFLTLHSSLRLR---NDSKNAQTFLTTSTVPG
A0A2A2PYE8      ---V----------------------SEAFLTLHSSLRLK---DESKNAKCILVTSTIPG
A0A2T6CN73      ---A----------------------SEAFLTLHSSLRLK---DESKNAKCILTTSTIPG
A0A2G4G428      ---A----------------------VEAVRTIYSSMRVN---PASMSSHVFLITSTRPS
A0A6N6PCD8      ---S-------------------SRQAEAFRCLRTSLSLL----PEGSPKVILFTSSIPG
A0A139TUL1      ---------------------SRSFMEECFHILRNNTELLLLPNPEKASRVVFLTSTRTG
A0A2N8HCB0      ---------------------GRSLMEECFHILRNNAELMLLPNPEEASRVLFMTSTRAG
A0A2N8HP04      ---------------------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAG
A0A2N8HRJ0      ---------------------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAG
A0A6N2U9Y7      ---------------------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAG
A0A6N6PAZ1      ---QLAVPEHWDKRLVFRPGTSATSYAEMYRVTRASITLL---GDEMQRKITLFTSSLPG
A0A7V7VK26      ---QLTSPENWDKRLVFRAGLSTTSYAEMYRVMRASITLL---GDEMQRKITLFTSSLPG
A0A6I1K459      ---C----------------------AEAFRSMRASLALL---GREEDRKVVFFTSAVPS
D5ENH7          ---------------------VDRHVTETFRSIHSAMKLN---DESKNAKIIVTTSTVPS
A0A0R2XQ77      ---------------------IDRHVTESFRSIHSALRLS---DESRHAKVLVTTSTVPG
A0A2E9IN28      ---------------------VDRHVTETFRTIHSALKLN---DESKNAKIILTTSTVPS
A0A6N4WTJ5      ---------------------VDRHVTETFRSIHSALKLN---DDSKNAKVIVTTSTVPG
A0A366HAG0      ---D----------------------AEAYRILRTNLEFN---RRDPNANCISVASGSPG
A0A2U8DZK4      --------------------------DEPFRVLQTNITLALRNKPSHGAQTLVMLSAGPG
A0A2T6DFL8      --------------------------LEPYRVLYTNLNLAL--KPGQAH-ALVFSSAGPG
A0A1D8AWD4      --------------------------GEPYRVLQTNLNLAL--TAGKTS-VLVVLSSGPG
A0A4Q1C9S2      --------------------------GEPYRVLQTNLNLAL--PARQSS-VLVVLSSGPG
A0A178IH18      --------------------------AEPFRVLQTNISLAR--KDAAPGRTLVMLSAGPG
A0A2T6DT99      --------------------------LEPFRVLHTNLNLAL--KSDARGRTLILLSAGPG
A0A1G3ZT33      --------------------------SEPFRVLQTNLNLAL--PPGQPG-SLVVVSAGPG
A0A3E1E2T2      --------------------------TEPFRVLHTNLNLAL--KPGEAA-SLVLFSAGPG
B1ZMW1          --------------------------AEPYRVLQTNLNLAL--KPGQPA-SLVIFSAGPG
A0A3M1I8A3      ---A----------------------SESIRSIRAAVALG---DHGEKLRVLTVTSTIPS
A0A4V0XS84      ---S----------------------SEGFRTLRAAISLT---QQPENLRTIVVTSTIPS
A0A351WE84      ---H----------------------GEPYRVLRTNMQFS---NKGIHGGAFAVISGGVG
A0A7W1MRT6      ---SKQRRDRSGGDSLVTVSDFGSVSAEAFRTLRTNLLFS---QSIQTLRTIVITSPSPQ
A0A7W1YXK2      ---A----------------------AEAFRSLRTVLSL----KEPGGLQVILCTSAAPG
A0A2D5WGA5      ---H----------------------AEAYRVLRTNILFAG--RKDESQTTFSVVSGGAG
A0A2E7SSH2      ---H----------------------AEAYRVLRTNILFAG--RQSEDQTTFSVVSGGAG
A0A832HNU4      ---G----------------------AEAFRNLRASLCLS---PSAKDAKVILITSAAPA
A0A1V5QDZ6      ---H----------------------AEAYRVLKTNLQFA---NKGTLGGAFALVSGGVG
A0A4Y8P964      ---E-------------------SLISNAYRQIRTLLHYA---IPNRKPQLIALTSTYPS
A0A3D4HF88      ---V----------------------TEAFRSVHSALNLN---EISKNAQIILMTSTVPS
A0A1V6J089      ---Q----------------------GEAYRSLRTSMALL---GREDNKKIFAVISGGVG
A0A3C1BZR1      ---Q----------------------GEAYRALRTSLALL---AREGKQKIFTVISGGVG
A0A848WTQ6      ---D----------------------AEAYRILRTNLEFN---RKNPNANVITGVSGSPG
A0A6N6ZHN8      ---T----------------------VEAFRSIHSTLKLH---EESKNAKVIVTTSTVSS
A0A6G6K641      ---V----------------------SESFRTLRSAIMLL---GRFDERRVFMFTSALPA
A0A849Y642      ---F----------------------AEFYRVLRANIEFA---RKDAQANSITFCSGGAG
A0A7C4KLL2      ---G----------------------AEAFRTLRTSVLML---GRQEERRVFLFTSAFPS
A0A1H6KPB7      ---D----------------------AEAYRILRTNIELK---RKDTNVVTLALVSGNAG
A0A2E9ISN4      ---E--------SDIFVAAKGTNQIATETYRRIRLNLLKQ---FGQDENISFTVTSSQSG
B9XAX1          ---C----------------------SEAFRTLRTTTGIL---GHEEGKRITLFTSADPN
A0A5R8KKM9      ---D----------------------AEAYRILRTNIEFN---RKRPDANVISVVSGGSS
A0A7W8DJ38      ---T-------------PVLLAHKAVAENFREFRAIIARM---AKSSHTCHM-VVSAVPD
A0A7W1ZQ43      ---C----------------------SEGFRTLRTTSSIV---DIKNEKRTMLFTSAAPA
A0A139TS01      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A3E1EJT7      ---I----------------------VEAFLSLYSNLRIN---DESRNARLILVTSTLPS
A0A848WYP9      ---V----------------------SEGFRALRTSL-------SALSPRSVMITSASPA
A0A7C3I5X9      ---A----------------------AESFRTIRAAITLG---SRGDRFRLLAVTSSMPA
A0A349GXM8      ---A----------------------IEAYRALRTSVLAE---LAKKHEKILMITSADSR
A0A7V3QFN7      ---Y----------------------AEAYRILRTNLLFS---RKDERFNTICVVSAGAG
A0A4P5YP61      ---G----------------------AEAIRTLRTSLSML---GKAENRRVYLFTSAIPA
A0A6B2LYM4      ---A----------------------VEAFRSIHSTLKLN---EESRNAKVILSTSTIPS
A0A6D1VXB3      ---E-------------------SFVSNAFRQIRTLLHYA---IPNRKPQLIAITSTYPS
I0JYY7          ---E-------------------SFVSNAFRQIRTLLHYA---IPNRKPQLIAITSTYPS
A0A4Y8P842      ---E-------------------SEISNGFRSIRTLLHYT---IPGRRPQVITITSTQES
B3DZK9          ---E-------------------SEVSNGFRSIRTLLHYT---IAGRRPQVITVTSTLES
A0A4R7S1J2      ---V----------------------AESFRSLRVMANLL---GKEEDRRVFVVTSALPS
A0A2A2XV69      ---D----------------------AEAYRIMRTNIEFN---RKNPASNSITIVSGGPG
A0A651H7X9      ---A----------------------VEAFRTLHSSLKLH---DESKNAQALLITSTTPG
A0A5E6MPC4      ---D-------------------SAVSNSFRQIRTLLHYS---LPDRRPQVMLITSCQMG
A0A840V0I7      ---SPSYEDEWDPVLAFRRHLSETSFAEMYRVLRASITLL---GDEKKRKVTAFTSSLPG
A0A146G2Q9      ---D----------------------AEAYRILRTNIEFN---RKNPDANTITMISGGAG
A0A2T6D3Y2      ---D----------------------AEAYRILRTNIEFN---RKNPDANTITMISGGAG
A0A6N6PKP9      ---L----------------------AESFRTLRTSLGIT---GKDAGGHAVLFASAVPG
A0A6N6Z250      ---G----------------------AEVFRVIQTNLQIA---GGSARGEVLLVQSAGPG
A0A4V1SB02      ---Q----------------------AEAYRTLRASLSLL---GEESQRRVLLVTSAVPA
A0A6N6QEJ2      ---H----------------------AEAYRVLRTNILFS---RKDPGCRTMTVVSGGAG
A0A3C1VB86      ---N----------------------AEVFRTLRATLSML---GRENDRKTYLFTSSLPG
A0A6N6P5E3      ---D----------------------AEGYRILRTNIEFN---RKNPNNNTLTLVSGGPG
A0A838I246      ---D----------------------AEAYRILRTNIEFN---RKSPEANAISLVSGGPG
A0A6J4HTK1      ---D----------------------AEAYRILRTNIEFN---RKSPDANTLSLVSGGPG
A0A838FVV7      ---D----------------------AEAYRILRTNIEFN---RKNPEANAISMVSGGPG
A0A7C3HWX0      ---H----------------------AESYRVLRTNVLFS---RKRPDANSLTVVSGGAG
A0A7V4LSC4      ---H----------------------AEAYRVLRTNVLFS---RKRPDANSLTVVSGGAG
A0A2D5VY59      ---H----------------------AEAYRVLRTNILFS---KKDPKFNALTVVSGGAG
A0A2D8UZZ4      ---H----------------------AEAYRVLRTNILFS---KKDPKFNALTVVSGGAG
A0A353DV86      ---H----------------------AEAYRVLRTNILFS---KKDPKFNALTVVSGGAG
A0A2E5EPT8      ---H----------------------AEPYRVLRTNILFT---NKKPNANTITVVSGGAG
A0A5B5WZ91      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A2N8HD92      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A2N8HIT2      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A354EBD3      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A355VEB2      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
R6K1U5          ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A2N8IWC2      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A2N8I441      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A2N8I3A6      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A410SCC4      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A3R5VEW0      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A7T9B0I0      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
B2UKW3          ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A411SSG2      ---D----------------------AEAYRILRTNIEFN---KKGLEEISLTFVSGSAG
A0A6M1RXR2      ---H----------------------AEAYRVLRTNILFS---RKDERLNTLVVVSAGAG
A0A7C3DXS4      ---H----------------------AEAYRVLRTNLLFS---RKDERLNTLVVVSAGAG
A0A7V6YXH8      ---H----------------------AEAYRVLRTNLLFS---RKDDKLNTIAIVSAGAG
A0A2V2SDV4      ---H----------------------AEAYRVLRTNLLFS---RKDDKLNTVAIVSAGAG
A0A6N6PHJ5      ---H----------------------AEAYRVLRTNLLFA---RKDDKLNTTAVVSAGAG
A0A7Y4QKN3      ---H----------------------AEAYRVLRTNLLFA---RKDDKLNTAAVVSAGAG
A0A2V5PK75      ---H----------------------AEAYRVLRTNLLFS---RKDDKLNSVAVVSAGAG
A0A1V6DME1      ---H----------------------AEAYRVLRTNLLFS---RKDDKLNSIAVVSAGAG
A0A3D3DIJ3      ---H----------------------AEAYRVLRTNLLFS---RKDDKLNTIAIVSAGAG
A0A7X7VJR5      ---H----------------------AEAYRVLRTNLLFS---RKDDKLNTIAIVSAGAG
A0A6I1K583      ---H----------------------AEAYRVLRTNVLFT---RKDEHANAITVVSGGAG
A0A350EWA4      ---H----------------------AEAYRVLRTNILFS---RKSEDQNTITVVSGGAG
A0A832D3W5      ---Y----------------------AEAYRILRTNLLFS---RKDERFNTICVVSAGAG
A0A7V2G542      ---D----------------------AEAYRILRTNIEFN---RKSADANAITLVSGGPG
A0A7C4KPD7      ---H----------------------AEAYRVLRTNLLFS---RKDQGWNTLTVVSAGAG
A0A832MGU4      ---H----------------------AEAYRVLRTNFLFS---RKKQDGNTITIVSGGAG
A0A1M6RLZ4      ---D----------------------AEAYRILRTNIEFN---RKNPDDNSITVVSGGAG
A0A832M6Y9      ---N----------------------AEAYRILRAKIDLK---ARPDGAHTLTIVSGGPG
A0A832HP42      ---H----------------------AEAYRVLRTNILFS---RKNPSANALTAVSGGAG
A0A354T7G8      ---D----------------------AEAYRILRTNIEFN---RKSPDANCFSVVSGGAG
A0A512MBZ2      ---D----------------------AEAYRILRTNIEFN---RRNPEANCITVTSGGAG
A0A2E8MEZ0      ---D----------------------AEAYRILRTNIEFN---RKNPEDNSITVVSGGAG
A0A7Y2T9S5      ---D----------------------SEAYRILRTNIEFN---RKNPEDNSITVVSGGAG
A0A851GRQ2      ---D----------------------AEAYRILRTNIEFN---RKNPEDNSITVVSGGAG
A0A6B3LBV6      ---D----------------------AEAYRILRTNIEFN---RRSADANSITMVSGGAG
A0A840UX61      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A4Q2YKS3      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A6N6P3T8      ---D----------------------SEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A8A7W668      ---D----------------------AEAYRILRTNIEFN---RKNPEDNAITVVSGGAG
A0A2E3EC33      ---D----------------------AEAYRILRTNIEFN---RKTADANSMTIVSGGAG
A0A2E4GN01      ---D----------------------AEAYRILRTNIEFN---RKTSDANSMTIVSGGAG
A0A800JJX7      ---D----------------------AEAYRILRTNIEFN---RKTSDANSMTIVSGGAG
A0A1Z8XU55      ---D----------------------AEAYRILRTNIEFN---RKNADANSITLVSGGAG
A0A2E1RQR9      ---D----------------------AEAYRILRTNIEFN---RKNADANSITLVSGGAG
A0A2E3ISQ4      ---D----------------------AEAYRILRTNIEFN---RKNADANSITLVSGGAG
A0A2D6W6F4      ---D----------------------AEAYRILRTNIEFN---RKNADANAITLVSGGAG
A0A2D8Z5A8      ---D----------------------AEAYRILRTNIEFN---RKNADANAITLVSGGAG
                                           :                           .    

A0A2A2XVF1      EGKTYTSLNTAVVFAQQGLKTLLIDADLRRPSLHKALLTVDTLPN-------GLTDYFS-
A0A2V5UHJ2      EGKTTTLVNSAIVFAQLGIRVLIIDADLRRPRCHALL--RMENLA-------GLSDLLA-
A0A2V5PST3      EGKTATTLNLGIALAQDSFKVLIIDADLRRGSCHSRL--GIGNHR-------GLSNLLA-
A0A2V5PXM3      EGKTFCSLNFAISLAQQGLRTLIIDCDLRRPMVENTLQNNNQRGF-------GLTDYLT-
A0A1V5QB01      EGKTTTCLNLAVSLAQAGARILMVDSDMRRGELHKFF--GLEGGR-------GLSDLLA-
A0A800JGC6      EGKSFASANVAYSFASQKEKTLLVDLDLRKPVQHNIL--ETKRSP-------GFSDFIS-
A0A7Y2T8X5      EGKTTVATELAAAFALNEQKTLLIDFDLRKPRVHKLFP-QLEREP-------GMSDVLS-
A0A1J4XH17      EGKSFFTTNLGLTFAANDEKVLIIDADLRMPSIGSSL--QLDKKK-------GILQYCE-
A0A7C5LI63      EGKTTTCVNLAIGFAQIEERTLLLDADLRRGEIHKYF--GLERDK-------GLSDVLL-
A0A7C5P291      EGKTTTTVNLAIGFSQVEDRVLLIDGDLRRGEIHKFF--NAEKEK-------GLADVLL-
A0A290QGD9      EGKSFTTTNLALTFAAHGEKVVVIDCDLRRPNIHKSF--RIANQR-------GVIDLCG-
A0A1D8AS58      EGKSFTTTNLALTFAAHGEKVVVIDCDLRKPNIHKSF--RLENIK-------GVIDVCA-
I6AQC1          EGKSFTTTNLALTFAAHGDRVVVLDCDLRKPNIHKSF--RRENLK-------GVIDVCA-
W0ITH7          EGKSFTTTNLALTFAAHGDRVVVVDCDLRKPNIHKSF--RRENLK-------GVIDVCA-
A0A139SU05      EGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRF--DLANTS-------GIIAFYE-
A0A139SPN4      EGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRF--DLANTS-------GLIPFYE-
A0A1V6E7N1      EGKTLVSANLAASFARHGRRTLLIDCDLRRPMMHRHF--KQSNQA-------GIITWFE-
A0A2D9MYT1      EGKSLVASNHAIVTAQTGAKTLLVDCDLRRPSVHKAF--QIQSPK-------GLSSYLLG
A0A258ANJ7      EGKTFVSTHLAVSLASQGFRTLLIDMDLRHSQLAQVF--GIPNTR------KGVVDLLL-
A0A1Z8ZMT6      EGKTFCAANLALAYAKQGTRTLLIDFDLRKPAVHKIFNEERAARP-------GIVNVLN-
A0A2E8MCT7      EGKTFCAANLALAYAKQGTRTLLVDFDLRKPAVHKIFNEERAARP-------GIVNVLN-
A0A139TLN4      EGKTYLAVNLALSLAVAGKKVLLMDMDLRKGTLSSLL--GGEGKP-------GTGDLDRV
A0A1G3ZFT0      VGKTFVSTNLAYLLATADKRILLVDADLRKGTVHKYF--NLDPSP-------GFAELIQ-
A0A5B5WI95      EGKTFTSANLAATFAKAGRKVLLIDGDLRKFSLTRQM--GGHGRR-------GLTSILLN
A0A2N8I9W1      EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ
A0A4Q5IH27      EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ
A0A2N8IBZ6      EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ
A0A7G6DX28      EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQ
R6J100          EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQ
A0A139TV24      EGKTFISANLAQAFSKIGKRVLLIDGDLRKTSLSSQL--GGKGRK-------GLSTILLN
A0A2N8HT11      EGKTFISANLAMSFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLR
R7DS70          EGKTFISANLAMSFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLR
A0A2N8HNL6      EGKTFISANLAISFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLR
A0A290Q2Z2      EGKSTTVLRLARSMGAAGERVLLVDSDLRRPTQHQLA--ALPKEP-------GLADLLQ-
A0A2A2RGK2      EGKTFCSSNFAVTLAQQGFNTLFIDADLRKPGGSIVFF-GENRKP-------GLSEVLM-
A0A2A2XXF7      EGKTFCSSNFAVTLAQQGFNTLFIDADLRKPGGSIVFY-GENRKP-------GLSELLM-
A0A146GCJ0      EGKSFTSLNFAHALAQKGLRTVVIDADLRRPRLKDDLLPDAGDID-------GLTDYLS-
A0A2T6D6H8      EGKTFTSLNFAHSLAQQGLRTVIIDADLRKPRLKADLLPEEGDIS-------GLTNYLS-
A0A6B3L938      EGKTTTATELAAGFALAGERVLLVDFDLRKPRVHAEFP-DLKGKP-------GTVELLT-
A0A2A2R5D6      EGKSTTLFNLAYVCAQSGQSVLLVDADLRRPTVHTIL--GIENEA-------GISEAMR-
A0A2V5URB2      EGKTITVANTAIMFARLGNRVLLMDADLRRPTCHKAL--KVQGAT-------GLADYLA-
A0A2V2DJ66      EGKSFVISNLAFTCALNGEKCIIIDADLRLPALAKVL--GISASK-------GLVSYIE-
R7L5A9          EGKSFIVTNLAFTYALHGEKTIIIDADLRLPAMAKVL--GITAKD-------GLIGHIE-
A0A5B5WU87      EGKTYLAVNLALSLAVAGKKVLLMDMDLRKGTLSSLL--GGQGKP-------GIGNLDRS
R7DZW0          EGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQA
A0A2N8HID1      EGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQA
A0A2N8HS06      EGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQA
A0A6N2TNT9      EGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQA
A0A4P5QM05      EGKSTTLSNLAYIYAKGGANVLVVDADLRRPSQHRFF--NVDNSI-------GLVDYLH-
A0A4Q3C001      EGKSTTLNNLAYTCAKGGYNVLVVDADLRRPTQHRIF--EVDNNY-------GLTDYLT-
B4DB23          EGKSTTLNNLAYTCAKGGYNVLVVDADLRRASQHHFF--DVDNSF-------GLTDYLL-
A0A5R8KA81      EGKSFCSANYAISSANLGKRTLLIDADLRRPMVNELFF-KGRVSV-------GLADVLQ-
A0A2E6T482      EGKTTTMFNLAVVFAQQGDRCLIVDSDLRRPSMHRYL--QVSNNI-------GLTNYLL-
A0A3C0DQZ7      EGKTTTMFNLAVVFAQQGDRCLIVDSDLRRPSMHRYL--QVSNNI-------GLTNYLL-
A0A1Z9CBK5      EGKTTTMFNLAVIFAQMGDRILVVDSDLRRPSMHRYF--KVSNNI-------GLTNLLL-
A0A2D6ZI96      EGKTTTMFNLAVIFAQMGDRILVVDSDLRRPSMHRYF--KVSNNI-------GLTNLLL-
A0A358KGZ3      EGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLL-
A0A2E9ZQX4      EGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLL-
A0A3D5JZU0      EGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLL-
A0A2E6HCR0      EGKTTTMFNLAVIFAQLGDRILVVDSDLRRPSMHRYF--KVTNSI-------GLTNLLL-
A0A1Z8WN04      EGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLL-
A0A2D7L1N4      EGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLL-
A0A2E2R937      EGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLL-
A0A520QQY4      EGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLL-
A0A2D5MR66      EGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLL-
A0A2E0PDQ1      EGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLL-
A0A2E2ZZP9      EGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLL-
A0A4P5YMI6      EGKTTTVLNLAVIFAHNGHKVLLVDTDIRRPSLHKRL--NVSNSI-------GVTNVLL-
A0A7C4LRK7      EGKSTTLFNLAVVFAQNAARVLIVDSDLRRPSLHRIL--KVSNSI-------GLTNYLL-
A0A3C1VJ32      EGKSTTTINLSTVFAQAGNRVLIVDSDLRRPTLHKLF--KVANNL-------GLTNYLL-
A0A7W1VTI1      EGKSTTLMNLATIFAQNGERVLLVDSDLRRPSLHKLV--KVSNSV-------GLTNYLL-
A0A7V4IGZ6      EGKSTTVFNLATIFAQAGQRVIIIDSDLRRPTLHKMV--GVSNAV-------GLTNYLL-
A0A2N9NTX7      EGKSTTVFNLACVFAQGSQRVLIVDSDLRRPTLHRML--RVSNSI-------GLTNYLL-
B9XK55          EGKSTTVYNMATVFAQSGHRVVMVDSDLRRPTLHKLV--NVSNTI-------GLTNYLL-
A0A2A2RGF2      EGKSTTVLNLATIFAQNGDKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLL-
A0A2G4I5Y6      EGKSTTVLNLATIFAQNGDKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLL-
A0A6N6PS97      EGKSTTIFNLAVVFAQNGSRVLLVDSDLRRPSLHKIL--NLSNSI-------GLTNYLL-
A0A3M1I883      EGKSTTIMNLATVFAQNGERVLLVDSDLRRPSLHKFI--GVSNSI-------GLTNYLM-
A0A1V6JZ45      EGKSTTILNLATVFAQNGQRVLVVDSDLRRPSLHKFL--AVSNSI-------GLTNYLM-
A0A848A4B3      EGKSTTILNLATVFAQNGQRVLVVDSDLRRPSLHKFL--AVSNSI-------GLTNYLM-
A0A7C7Z746      EGKSTTLFNLAVVFAQEGQKVLIVDSDLRRPSIHKMM--HVTNSI-------GLTNYLL-
A0A520RRW5      EGKSTTIFNLATVFAQNGSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLL-
A0A356NPK0      EGKSTTIFNLATVFAQNDSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLL-
A0A2D7B5P5      EGKSTTIFNLATVFAQNXSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLL-
A0A3D3XGB5      EGKSTTIFNLATVFAQNGSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLL-
A0A2V6F8A1      EGKSTTIFNLGVVFAQNGQRVLLVDSDLRRPSLHKLL--NVSNAV-------GLTNYLL-
A0A2V5TNH4      EGKSTTIFNLAVVFAQNGQRALLVDSDLRRPSLHKLL--NVSNSV-------GLTSYLL-
A0A2V5X5Q6      EGKSTTIFNLAVVFAQNGQRALLVDSDLRRPSLHKLL--NVSNSV-------GLTNYLL-
A0A3R5R2M8      EGKTFASANLAAAFAKAGRKVLLIDGDLRKRSLSRQL--GGYGRR-------GLTSILLN
A0A411SUQ6      EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ
A0A2N8HZF2      EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQ
A0A354E720      EGKTFTSANLAAAFAYAGKKVLLIDGDLRKSSLTRRL--GGSGRK-------GLTSILLR
A0A7T8XNA1      EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ
B2UPB6          EGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ
A0A1Q6UHJ9      EGKSFVVTNLALMCAMHGEKTIIIDADLRLPAMAKVL--GIESRD-------GIVGYVE-
A0A2V2BXR0      EGKSFVVTNLALMCAMHGEKTIIIDADLRLPAMAKVL--GIESRD-------GIVGYVE-
A0A3C1HEJ2      EGKTFCTINFAYSLAQQGMRTLLIDCDLRCPTVEEYLLGRNTESP-------GVSDYLS-
A0A522ULD9      EGKSTTLFNLAYICAQQGDKVLIVDSDLRRPTQHTIL--GLSNRL-------GLTNVLM-
A0A7W1RNH4      EGKTTTAVNLALTLAQHGTSVLLIDADLRCGSVASAF--DINIAP-------GLSELLE-
A0A2D8V0G3      EGKSLVASNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GLSAYLTG
A0A348S017      EGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTD
A0A3C1UUV7      EGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTD
A0A350I3V2      EGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTD
A0A520RGV5      EGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTD
A0A3D3XF90      EGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTD
A0A2D7B522      EGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTD
A0A356NIC2      EGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTD
A0A832MDW4      EGKSLVASNLAIVTAQTGLKTLLIDSDMRRPSVHKAF--QLHSPV-------GLAAYLME
A0A1V6JU76      EGKSLVASNLAVVVAQTGLRTVLVDADLRRPSLHKAF--QLHSPM-------GLTAYLTE
A0A848ABG7      EGKSLVASNLAVVVAQTGLRTVLVDADLRRPSLHKAF--QLHSPM-------GLTAYLTE
A0A2A2XXW5      EGKSLVASNFAIVTSQTGLKTLLVDADLRRPSVHKAF--QLQSPV-------GLSAYLSG
A0A6N6Q6V0      EGKSLVASNFAIVTAQTGLRTLLVDADLRRPSVHKAF--QLQSPV-------GLAAYLAE
A0A2V6JLK8      EGKSTTIANLAFICAQGGYSTLIVDADLRRPVQHLLF--DLSNEI-------GLTNYLT-
A0A2W5Z1A5      EGKSTTVTNLGYICAQGGYSTLIVDADLRRPVQHMHF--DLDNKI-------GLSNYLT-
A0A2V6EA09      EGKSTTIANLAFVCAQGGYSTLIVDADLRRPIQHEFF--GVSNTA-------GLTSYLT-
A0A2V6GQI7      EGKSTTIANLAFVCAQGGYSTLIVDADLRRPIQHEFF--GVSNTA-------GLTSYLT-
A0A7W1U7K0      EGKSTTLANLAFISAQGGYSTLIVDADLRRPVQHELF--DLPNNI-------GLTNYLT-
A0A7W0YDK6      EGKSTTLANLAYICAQGGYSTLIVDADLRRPVQHTLF--EKDGKR-------GLTNYLT-
A0A7V9EPY1      EGKSTTLANLAFICAQGGYATLIVDADLRRPVQHTLF--EIEAKA-------GLTNYLT-
A0A838TCM2      EGKSTTLANLAYICAQGGYSTLVVDADLRRPVQQSLF--NLEAKN-------GLTDYLT-
A0A2N8HDG3      EGKTFISANLALAFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLR
A0A3E1ET42      EGKSTTLVNLAYICAQGGYNTLMIDGDLRRPKLHTFF--DINNSV-------GLTNYLT-
A0A2A2YDW8      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLSNYLT-
A0A352XLN9      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLSNYLT-
A0A3D0YP62      EGKSTTLCNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A3D3DV47      EGKSTTLCNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A7Y1UNY2      EGKSTTLVNLSYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A2E5XJ49      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A2E6SBY8      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A2E5QMS4      EGKSTTLVNLAYVCAQGGYTTLMIDSDLRRPTLHTFF--DINNSV-------GLTNYLT-
A0A2E7YXQ3      EGKSTTLVNLAYVCAQGGYTTLMIDSDLRRPTLHTFF--DINNSV-------GLTNYLT-
A0A2E3H787      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPQLHTFF--DINNSV-------GLTNYLT-
A0A2E7AGN1      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLT-
A0A2E7AKY7      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLT-
A0A3D4CU34      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLT-
A0A2E8M146      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLT-
A0A355S8S2      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLT-
A0A2D6DVN8      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLT-
A0A3C1W2R2      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLT-
A0A2E3NAY6      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLT-
A0A2E3II01      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLT-
A0A368B8C5      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLT-
A0A3R7RBB5      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLT-
A0A2A2QX62      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--EINNSV-------GLTNYLT-
A0A4Q3BWH6      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A858RHU7      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A7V7VLV5      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNFLT-
A0A3N5WCF1      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A4Q3C1K5      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A3D1TI55      EGKSTTLFNLAYVCAQLGDKVLLVDSDLRRPALHKIL--GMSNDF-------GLTNVLM-
A0A3R8IT45      EGKSFTTTNLALTFAAHGDKVVIVDCDLRKPNIHKSF--RRENLK-------GVIDVCA-
A0A2A2PYE8      EGKSFTTTNLALTFAAHGERVVVIDCDLRKPNIHKSF--RLENLK-------GVIDICA-
A0A2T6CN73      EGKSLTTTNLALTFAAHGEKVIVVDCDLRKPNIHKSF--RIENIR-------GVIDVCS-
A0A2G4G428      EGKTFVATNLALGFSQHGERVLVIDADLRLPNVGPSL--GLTGTE-------GISRWFN-
A0A6N6PCD8      EGKSFCSANYATSLAQQNLRILIIDADLRKPGLGKSF--PTKHGV------IGLSDVLS-
A0A139TUL1      EGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFC--VGKNSR-------GLAHLLMN
A0A2N8HCB0      EGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMN
A0A2N8HP04      EGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMN
A0A2N8HRJ0      EGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMN
A0A6N2U9Y7      EGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMN
A0A6N6PAZ1      EGKTLTSANFAIAAAGQGRKTLLIDMDLRKPSIHKLF--GIPRAG----ENGGLTEFLA-
A0A7V7VK26      EGKTLTSTNFAIAAAGQGRKTLLIDMDLRKPSVHKLF--GIPRVL----EHGGLTECLA-
A0A6I1K459      EGKSFCCVNYAVAYAQQGRRTLVIDFDLRKPTLAESF--GLKEDL------AGVSDVLL-
D5ENH7          EGKSFVSSNLALTFANHGEKTLLLDADLRLPNVAASM--QLENER-------GVLDHVE-
A0A0R2XQ77      EGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSL--QLQNDF-------GLLDHIE-
A0A2E9IN28      EGKSFVSSNLSLTFANHGEKTLLIDCDLRLPNVARSL--QLENDF-------GVLDHID-
A0A6N4WTJ5      EGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSL--QLENEF-------GVLDHIE-
A0A366HAG0      EGKSTTMVNLATICAQGGYNTLIIDADMRRPRQHTFF--NVPHTF-------GLSNYLS-
A0A2U8DZK4      EGKSTTLLRLARAMGAAGERVLLIDADLRRPTQHRLF--NVAKTP-------GLADLLQ-
A0A2T6DFL8      EGKSTTLHRLTRLMGEMGDRVLLIDADLRRPTQHRIA--ERPRSP-------GLSDLLT-
A0A1D8AWD4      EGKSTTLRQLALCMAAAGEKVLLIDSDVRRPTQHKLA--GLSRDP-------GLTDIVL-
A0A4Q1C9S2      EGKSTTLRQLALCMAAAGEKVLLIDSDVRRPTQHKLA--TLPREP-------GLTDIVL-
A0A178IH18      EGKSTTLLRLARAMGEAGARVLLIDSDLRRPTQHQLT--GAAKEP-------GLADLLQ-
A0A2T6DT99      EGKSTTLLRLARAMAKAGERVLLIDSDLRRPTQHQLA--GLRKEP-------GLAEVLQ-
A0A1G3ZT33      EGKSTTVHHLVRVMAAAGERVLLVDSDVRRPAQHRLM--DQTREP-------GLIDLLL-
A0A3E1E2T2      EGKSTTLHRLVRVMAAGGERVILIDSDVRRPTQHHLA--DRPREP-------GLSEFLL-
B1ZMW1          EGKSTTLFRLARLAAAAGERVVLIDSDFRRPAQHRLA--ERPREP-------GLSDWLM-
A0A3M1I8A3      EGKSIIAANLAIAMAQTGYRTLLVDADMRRPRLHKAF--QLHNPV-------GLPAYLHG
A0A4V0XS84      EGKSLVASNYAIVSAQSGLRTLLVDADLRRPSVHKAF--GIENNI-------GLSAYLMD
A0A351WE84      EGKSTTLFNLAYTCAQLGYKTIVVDSDLRRPVQHSIL--SMSNRI-------GLTNVLM-
A0A7W1MRT6      DGKTTTAANLAVTFAQQGMRVLLIDCDLRKARMHNIF--SVPREP-------GFSQLLA-
A0A7W1YXK2      EGKTFCSLNCALALAQQGHRTLLVDADLRRPAIAKAL--GLNPHQ------AGLTEFLS-
A0A2D5WGA5      EGKTTTMFNLAVVFAQQGDRVLIVDSDLRRPSMHRYL--KVTNNT-------GLTNYLL-
A0A2E7SSH2      EGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVTNNI-------GLTNLLL-
A0A832HNU4      EGKSFVALNLALVFAANNERTLLIDADLRHPSQHRAF--KEPPNK-------GLSVFLS-
A0A1V5QDZ6      EGKSTTLFNLAYVCAQLGDKVLIVDSDLRRPVQHRIL--GVSNRF-------GLTNVLM-
A0A4Y8P964      EGKSSTVVNLATVLGQQG-TVLIIDGDLRRPMLHKVL--GLRPRP-------GLSEILT-
A0A3D4HF88      EGKSFVSTNLAYTYASHGERVVLIDCDLRMPNVAKSM--NLSNEK-------GLQQCLK-
A0A1V6J089      EGKSTTLFNLAYVCAEQGSKVLVIDSDLRRPVQHKMV--GLANRA-------GLVNVLT-
A0A3C1BZR1      EGKSTTLFNLAYVCAEQGSKVLIIDSDLRRPVQHKMV--GLANRT-------GMVNVLT-
A0A848WTQ6      EGKSTTITNLAYVCAEGGYTTLLIDADMRRPSLHRNF--EVSNNP-------GLSNFLAS
A0A6N6ZHN8      EGKSFASTNLAITFAIHGERTLVVDCDLRMPNVAKSL--DLSEHK-------GVIDYIN-
A0A6G6K641      EGKTFCASNFAVSLAQQGLKTVLVDCDLRKPAISEVFL-GKAAPI-------GVSDVLA-
A0A849Y642      EGKSTTLVNTAYIYAQHGQTVLVVDSDVRRPSLHRIF--GVDNKR-------GLTDVIL-
A0A7C4KLL2      EGKTFNSVNFAISLAQQGLKVLLIDADLRKPSVENFITGQTGKLA-------GLTDILV-
A0A1H6KPB7      EGKTTTLCNLAYVFAQGGFSTLMIDADLRRSKLAEYN--DVECEY-------GLSNFLT-
A0A2E9ISN4      DGKTFNVANIALPFAWVGKRVLLIDADLRLGNLTRRL---LGREL-----RHGLADWLA-
B9XAX1          EGKTFFSLNHAICQAQGGKLTLLIDLDLRRPSVGESFS-HPPGTP-------GVTNYLL-
A0A5R8KKM9      EGKSTTMVNLATVCAQGGYNTLIIDGDLRRPRMHTFF--DVTNDV-------GLTTYLS-
A0A7W8DJ38      EGKTFVSTHLAVSLASQGFRTLLIDMDLRRSQLADVF--GIPSTR------KGVIDLLL-
A0A7W1ZQ43      EGKTFCSLNYAICQAQEGKRTLLIDLDLRKPSVGANF--DLPPET------PGVTDYFV-
A0A139TS01      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEA-------GLTSYLL-
A0A3E1EJT7      EGKSFITTNLGLTFASQGQRTVIVDCDLRKPNVERSF--RLQTTA-------GVISYCL-
A0A848WYP9      DGKSFCAANLALLQAQYGYRTLLVDADFRKPSLAKALLTP------------GMGDPGS-
A0A7C3I5X9      EGKSTIAANLAIVIAQTGLRTLLVDADLRRPSVHHGF--EAEGAA-------GLVAYLT-
A0A349GXM8      EGKTLTALNLSIMVVQMGKRVLLVDMDLRRGRIHRSL--GLDREP-------GVTDVLR-
A0A7V3QFN7      EGKSTTAINLAATFALAGDRVLLVDSDFRRPSLHKLL--GVSNKI-------GLTDLLF-
A0A4P5YP61      EGKTFCSLNYAVSLAQQGSKTLLIDGDLRRPAVEKAISGKDKKAV-------GVTDYIL-
A0A6B2LYM4      EGKTFISTNLSITFAAHGERTIVVDADLRMPNVSKEL--NIDGKR-------GIIQLIA-
A0A6D1VXB3      EGKSSTIVNLATVLGQQG-TVLIIDGDLRKPSLHKSL--GLRPRP-------GLSEILT-
I0JYY7          EGKSSTIVNLATVLGQQG-TVLIIDGDLRKPSLHKSL--GLRPRP-------GLSEILT-
A0A4Y8P842      EGKSGTTVNLATVLGQQG-TVLIIDADLRRPAIHKNL--GLRPRP-------GLSEILT-
B3DZK9          EGKSGTTVNLATVLGQQG-TVLVIDADLRRPSIHKIL--GLRPRP-------GLSEILT-
A0A4R7S1J2      EGKTFCSCNYALSLAQQGLKTLLIDADLRRP--------KVSASVYGEDRKPGLTEYLL-
A0A2A2XV69      EGKSTTLNNLAYTFAKGGYTTLVVDADLRRPSQHRIF--GIDNKN-------GLSDLLT-
A0A651H7X9      EGKSFTATNLALTYAQHGEKTLLIDCDLRKPNIHQGL--QLENDT-------GLIDFVR-
A0A5E6MPC4      EGKTSTTVNTATVLGQQG-TVLLIDADLRRPNLHKIL--GLRPHP-------GLSELLT-
A0A840V0I7      EGKTTTSVNFALAAAGQGKKVLLIDADLRKPAVHKTL--GLKRDH----NGKGVTEILA-
A0A146G2Q9      EGKSTTMSNLASIFASGGYSTLIVDADLRRPSQHRIF--GVENEV-------GLTDFLT-
A0A2T6D3Y2      EGKSTTMSNLASIFASGGYSTLIVDADLRRPSQHRIF--GVENEV-------GLTDFLT-
A0A6N6PKP9      EGKSFCAINCAVAFAQQGLRTLLIDADLRLPTVERIIL-QTQGAP-------GLSDLLL-
A0A6N6Z250      EGKSTVLRNLAACAALGGERVLVIDSDLRRPTQHDLL--SAERQP-------GLVDYLA-
A0A4V1SB02      EGKTFTATNLAAALATQGLSTLLIDADLRRPALSATM---LERDVRQNEEFRGLTDVLS-
A0A6N6QEJ2      EGKSTTIFNLATIFAQQGSRVLIVDSDLRRPSLHKIL--NVSNTV-------GLTNFLL-
A0A3C1VB86      EGKTFTSVNYAVSLAQQGLRTLLVDIDLRRPMIEKFFLGKTSRLP-------GVTDYFL-
A0A6N6P5E3      EGKSTTMNNLAFTFARGGYRTLIVDADLRRPSQHRFF--GIENEK-------GLTDFLT-
A0A838I246      EGKSTTLANLAFTSAQGGYTTLIVDADLRRPVQHAMF--DVSNKI-------GLTNYLT-
A0A6J4HTK1      EGKSTTLANLAFTSAQGGYSTLIVDADLRRPVQHSIF--DLSNKV-------GLTNYLT-
A0A838FVV7      EGKSTTLANLAFTSAQGGYTTLIVDADLRRPVQHTMF--DVSNKI-------GLTNYLT-
A0A7C3HWX0      EGKSTTIFNLATVFAQQGQRVLVVDSDLRRPSLHKFL--KVSNSL-------GLTNYLL-
A0A7V4LSC4      EGKSTTIINLATVFAQQGQRVLMVDSDLRRPSLHKFL--KVSNSL-------GLTNYLL-
A0A2D5VY59      EGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLL-
A0A2D8UZZ4      EGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLL-
A0A353DV86      EGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLL-
A0A2E5EPT8      EGKSTTVLNLATIFAQNGNRVLLVDSDLRRPSLHKRL--DIENSP-------GLTDYLL-
A0A5B5WZ91      EGKTTTLCNLAYICAQGGYATLMIDGDLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A2N8HD92      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A2N8HIT2      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A354EBD3      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEL-------GLTSYLL-
A0A355VEB2      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEL-------GLTSYLL-
R6K1U5          EGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A2N8IWC2      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A2N8I441      EGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A2N8I3A6      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A410SCC4      EGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A3R5VEW0      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A7T9B0I0      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
B2UKW3          EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLL-
A0A411SSG2      EGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDNEA-------GLTSYLL-
A0A6M1RXR2      EGKTTTVLNLATVFAQSNQRVLIVDSDLRRPALHKRL--KVSNAI-------GLTNYLL-
A0A7C3DXS4      EGKTTTVLNLATVFAQSNQRVLIVDSDLRRPAIHKRL--KVSNAI-------GLTNYLL-
A0A7V6YXH8      EGKSTTVVNLATVFAQSGNRVVVVDSDLRRPTLHKIL--QVSNSI-------GLTNYLL-
A0A2V2SDV4      EGKSTTVFNLAAVFAQGGQRVLIVDSDLRRPTLHKML--RVSNHI-------GLTNYLL-
A0A6N6PHJ5      EGKSTTVLNLATVFAQSGQRVVIVDSDLRRPTLHKLL--KVTNNL-------GLTNYLL-
A0A7Y4QKN3      EGKSTTVVNLATVFAQSGQRVLVVDSDLRRPTLHKLL--HLTNNI-------GLTNYLL-
A0A2V5PK75      EGKSTTVFNLACVFAQSRQRVLIVDSDLRRPTLHKML--RVPNDL-------GLTNYLL-
A0A1V6DME1      EGKTTTVFNLATVFAQGNQRVIIVDSDLRRPTLHKRF--GVSNSI-------GLTNYLL-
A0A3D3DIJ3      EGKSTTVFNLAAVFAQSGQRTIIVDSDLRRPTLHKML--RVTNAI-------GLTNYLL-
A0A7X7VJR5      EGKSTTVFNLAAVFAQSGQRTIIVDSDLRRPTLHKML--RVTNAI-------GLTNYLL-
A0A6I1K583      EGKSTTVLNLATIFAQNGNKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLL-
A0A350EWA4      EGKSTTLFNLACIFAQNGARVLIVDSDLRRPSIHKIL--RVSNSV-------GLTNYLL-
A0A832D3W5      EGKSTTAINLAATFALAGDRVLLVDSDFRRPSLHKLL--GVSNKI-------GLTDLLF-
A0A7V2G542      EGKSTTLCNLAVTCAQGGYNVLVVDADLRRPVQHSLF--GIPNSV-------GLTNYLT-
A0A7C4KPD7      EGKSTTLFNLAVVFAQNGNRVLLVDSDLRRPSLHKRL--GVSNSI-------GLTNFLL-
A0A832MGU4      EGKSTTLFNLAVTFAQNGSRVLMVDSDLRRPSLHKML--RVSNAI-------GLTDYLL-
A0A1M6RLZ4      EGKSTTLVNLAYICAQGGYSTLMIDADLRRPKLHTFF--DINNTV-------GLTNYLT-
A0A832M6Y9      EGKTTTLFNLAYVCAYSGINTLVIDTDFRRHSINAIL--GISNDQ-------GLADFLL-
A0A832HP42      EGKSTTIFNLAAVFAQNGQRVLIVDSDLRRPSLHKFL--GVSNSI-------GLTNYLL-
A0A354T7G8      EGKSTTMVNLAYVCAQGGYNVLLIDADLRRPSLHHHF--DVSHAT-------GLTNYLT-
A0A512MBZ2      EGKSTTLCNLATVCAQGGYSVLLIDADLRRPSLHRLF--DVSNAN-------GLTNYLT-
A0A2E8MEZ0      EGKSTTLVNLAYVCSQGGYTTLMVDADLRRPRLHSFF--DINNSV-------GLTNYLT-
A0A7Y2T9S5      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A851GRQ2      EGKSTTMVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A6B3LBV6      EGKSTTLVNLAYVCAQGGYNTLIIDGDLRRPTLHGHF--DTSNSV-------GLTNYLT-
A0A840UX61      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A4Q2YKS3      EGKSTTLVNLAYICAQGGYTTLMIDGDLRRPRLHTFF--DINNAV-------GLTNYLT-
A0A6N6P3T8      EGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLT-
A0A8A7W668      EGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNFLT-
A0A2E3EC33      EGKSTTLVNLAYVCAQGGYNTLMIDADLRRPQLHTFF--NXNNSV-------GLTNYLT-
A0A2E4GN01      EGKSTTLVNLAYVCAQGGYNTLMIDGDXRRPQLHTFF--NINNSV-------GLTNYLT-
A0A800JJX7      EGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLT-
A0A1Z8XU55      EGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLT-
A0A2E1RQR9      EGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLT-
A0A2E3ISQ4      EGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLT-
A0A2D6W6F4      EGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLT-
A0A2D8Z5A8      EGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLT-
                 **:                 :.:* * *                       *       

A0A2A2XVF1      GNSRLASVII-PTEI------E----NLALLPAGRRA-PNPAELLSSADIPKLFA-QLLK
A0A2V5UHJ2      GQIELQSAIR-PTSA------E----NLSFISAGALP-PNPAELLGSKKMHDLLE-QLRE
A0A2V5PST3      GNVSIEEVVQ-RTSI------A----GLSVLTRGACP-PNPTELLRMRKMKEILT-GLGG
A0A2V5PXM3      GQKDFKAVVH-ASGS------E----NFFYIPAGSHA-PNPAELLARTGIDGLID-EALL
A0A1V5QB01      GQAKPEAVIQ-RTGL------P----NLDLVATGPFP-PNPAELVLRPEFKAFMD-HARR
A0A800JGC6      NQLSFEEVVK-PTQN------E----NLFFISSGSRS-GNPSELMTTQNIKKLLS-SIPD
A0A7Y2T8X5      GQIDLEKVVQ-KTGV------E----GLHLITAGTKA-PNPSELFQENELREIIS-KLSK
A0A1J4XH17      EGATLDDIVN-KNVY------S----NFDVITAGGKA-TNPTQIFLSPRFQQLLE-EAKS
A0A7C5LI63      GEATPEEVVR-HTNI------P----KLDVITSGAYP-ANPAEMLLSWRLKELMD-WARQ
A0A7C5P291      GEATPEEVIK-QTDV------P----KLDVITVGSYP-ANPAELLLGWRLKELLD-WARP
A0A290QGD9      GDTRVEDVVV-KGPH------P----NLDIIPAGGRA-KNPTHVLNSAGFEHMIA-DLRT
A0A1D8AS58      GTHTIDQVVI-KGVH------P----NLDVIPAGGRA-KNPTQILNSRNFEHLLA-DLRK
I6AQC1          GSATIDDVVM-RDVH------P----NLDVIATGGRA-KNPTQILNSKNFEIMIA-ELRK
W0ITH7          GSATIDDVVM-RDVH------P----NLDVIATGGRA-KNPTQILNSKNFEIMIA-ELRK
A0A139SU05      ADGDLDCDLPNDSTLGIVKLSE----NLSLLRSGGRS-RRPTELLESPFFGDLLQ-KLGH
A0A139SPN4      SGASLDTDLSTDPTLGIVKLNE----NLSLLRSGGRS-RRPTELLESDLFGDLLK-KLGR
A0A1V6E7N1      KGADLSVEPQKNPDLGIISLGE----NLSLLCSGGRS-KTPSSLLETPAFTQLLE-RLKQ
A0A2D9MYT1      KVDTIDSIVH-QTEV------A----NLDIICCGAVP-NNPSELAGSQRMIDFVE-EVRX
A0A258ANJ7      EEVSFAEVCL-SGGI------A----HLAIMPAGKRV-ANPAELLSTCGVERLKEMAFSA
A0A1Z8ZMT6      GTAAANQAITVYPGL------D----TLSVIYSGPKS-PNPGELLEPGRLRALIG-MFAA
A0A2E8MCT7      GTAAANQAITVYPGL------D----TLSVIYSGPKS-PNPGELLEPGRLRDLVE-MFSS
A0A139TLN4      GEGGWRSLLEKSSVS------D----HLDYLFAGTLP-DHPSRLLLHDRVRELMK-ELKE
A0A1G3ZFT0      GSVNIEEALK-LTSH------H----NLTILPRGNYP-VDPAELLSSERCKELIS-LFSK
A0A5B5WI95      QVDDPFHIIR---QA------GENNTPFDFLGTGPAA-PNPVTLLSQPLLAQILE-CFRK
A0A2N8I9W1      QSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKK
A0A4Q5IH27      QSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKK
A0A2N8IBZ6      QSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKK
A0A7G6DX28      QSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKK
R6J100          QSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKK
A0A139TV24      KVSDLSSVIH---PL------PDHP-GVDILYGGPHV-PNPVSLLSRPEIEQLIQ-SFKR
A0A2N8HT11      KVEDPFSVIR---TL------PEHP-GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKE
R7DS70          KVEDPFSVIR---TL------PEHP-GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKE
A0A2N8HNL6      KVEDPFSVIR---TL------PEHP-GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKE
A0A290Q2Z2      GKATLEKVTQ-RGVS------P----GLDFIPCGAVG-GFTLSLLYIDRLKALLA-ELRG
A0A2A2RGK2      RTCTMKNAIV-PTHI------D----NLQIMTAGGRA-PNPSELLTYENIDRVLK-EALS
A0A2A2XXF7      RSCAMKNAVM-PSHI------D----GLSILTAGGRA-PNPSELLTYENLERVMS-EALS
A0A146GCJ0      GGAPLDQVVR-KTDQ------D----NLFLLPAGHRA-PNPSELLGGSEFREMLA-KLLL
A0A2T6D6H8      GTATLTEVVK-KTPY------E----NLFLLPGGHRA-PNPAELLNEDDFQKMLD-ELLK
A0A6B3L938      GQAEFSQAVH-ATGT------E----NLYVMVSGKKA-PSPSELLLPEDIQSLFD-HAAE
A0A2A2R5D6      GLGEAHQYIR-ATSV------P----NMHVITAGDMP-ASEMGAFSGLKLREILN-DLKL
A0A2V5URB2      GQEELDKVIK-LTSI------P----NLWILNGGSVP-PSPTELIGSKKMQDTLA-LLKE
A0A2V2DJ66      EGDSLDDVII-KDYF------Q----NLDVLVCERRA-KNPSQMLNSEEFVSMIE-SFRE
R7L5A9          EGKPLEDAII-HDYF------P----NLDVLVCEKRA-KNPTQTLNSEEFAAMIE-KFRD
A0A5B5WU87      GEGGWRSLVEKSSVS------D----HLDYLFAGTLP-DHPSRLLLHDRVRVLME-ELKE
R7DZW0          GEGGWRSLVEQSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKE
A0A2N8HID1      GEGGWRSLVEQSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKE
A0A2N8HS06      GEGGWRSLVEQSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKE
A0A6N2TNT9      GEGGWRSLVEQSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKE
A0A4P5QM05      GRKTLDEITH-PSRL------E----NLAIIPSGSLA-MEDVGILNGPRMTELIL-QLKK
A0A4Q3C001      GKASIDEITR-TTKI------D----NLSFIPSGQLP-SDAIGILNSQRMTDMMQ-KVKH
B4DB23          GRAEIDEIIK-TTKI------D----NLSFIPSGLLP-GDSVGILNSQRMTDLIA-KVKS
A0A5R8KA81      GKVTLEEALH-VSNT------E----NLFILSAGTEI-RNPAELLASPALAEFFD-SLKG
A0A2E6T482      GQVXIDEVIQ-TTQI------P----SLHFIPSGKLP-SSSMGILSSSKMREFVS-EMKS
A0A3C0DQZ7      GQVTIDEVIQ-TTQI------P----SLHFIPSGKLP-SSSMGILSSSKMREFVS-EMKS
A0A1Z9CBK5      GQNTLDEVIQ-TSDS------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKS
A0A2D6ZI96      GQNTLDEVIQ-TSDS------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKS
A0A358KGZ3      GQNTLDEVIQ-TSES------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKS
A0A2E9ZQX4      GQNTLDEVIQ-TSES------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKS
A0A3D5JZU0      GQNTLDEVIQ-TSES------T----NLHFIPSGKLP-SSSMGVLNSAKMKQFVA-EMKS
A0A2E6HCR0      GQNTLDEVIQ-TTDI------P----NMHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKS
A0A1Z8WN04      GQNTVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKS
A0A2D7L1N4      GQNTVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKS
A0A2E2R937      GQNTVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKS
A0A520QQY4      GQNTVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKS
A0A2D5MR66      GQNTVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKGFVA-DMKS
A0A2E0PDQ1      GQNTVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKG
A0A2E2ZZP9      GQNTVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKG
A0A4P5YMI6      KQCPVEEAIQ-TTPI------P----NLHFLPSGRLQ-SSSLGILNSPQMREFID-EMKR
A0A7C4LRK7      KQNTLEEVIQ-TTSI------P----TLDFMPSGKLP-SSALGILNSAAMRDMIT-ELKN
A0A3C1VJ32      KQNTVVEVVQ-TTSV------P----NLDFMASGKLP-SSSMGILGSAQMKELIA-ELKQ
A0A7W1VTI1      RQNTLEEVIQ-TTPL------A----TLDFLPSGKLP-SSSMGILSSEQMKSLIQ-ELKQ
A0A7V4IGZ6      KQNALEEVVQ-RTTI------P----TLDFVASGKLP-SSSMGILSSAQMKDLIS-ELKQ
A0A2N9NTX7      KQNTLEEVIQ-TTNL------P----SMDFLASGKLP-SSSLGILSSSQMRDLIN-ELKQ
B9XK55          KQNTLEEVIQ-TTRL------P----NLDFMASGKLP-SSSLGILSSAQMKDLIT-ELKQ
A0A2A2RGF2      GQNKLEEVVQ-HSTL------A----NLHFLPSGRLP-SSALGILNSPQMKDFIK-EAKQ
A0A2G4I5Y6      GQNTLEEVIQ-HSPL------A----NLHFLPSGRLP-SSALGILNSPQMKDFIK-EAKR
A0A6N6PS97      KQNTLEEVVQ-RTPV------P----TLDFLPSGKLP-SSSLGVLSSAQMREFIA-IAKE
A0A3M1I883      KQNTLEEVIQ-TTSL------P----TLDFLPSGKLP-SSALGIINSPRMKELVD-EVRN
A0A1V6JZ45      KQNTLEEVIQ-TTKL------P----MMDFLASGKLP-SSSLGILNSTRMKEFIK-DVQR
A0A848A4B3      KQNTLEEVIQ-TTKL------P----MMDFLASGKLP-SSSLGILNSTRMKEFIK-DVQR
A0A7C7Z746      GQNTLEEVIQ-TSIN------P----FMDFMPSGKLP-SSSMGILNSPQMKELIK-SVKA
A0A520RRW5      ATKSLEEVVQ-TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARK
A0A356NPK0      ATKSLEEVVQ-TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARK
A0A2D7B5P5      ATKSLEEVVQ-TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARK
A0A3D3XGB5      ATKSLEEVVQ-TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARK
A0A2V6F8A1      RQNTLEQVIQ-TTSI------P----TLDFLPSGKLP-SSSLGILNSVQMKDFIK-EAKK
A0A2V5TNH4      RQNTLEEVIQ-TTSI------P----TLDFLPSGKLP-SSSLGILNSAQMKDFIK-EAKR
A0A2V5X5Q6      RQNTLEEVIQ-TTSI------P----TLDFLPSGKLP-SSSLGILNSTQMKDFIK-EAKR
A0A3R5R2M8      RLQTAALPIR---RI------EETGISFDFLGAGPAV-PNPVSLLSQPILGQMLE-HLKK
A0A411SUQ6      QTTDTTGIIR---PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKK
A0A2N8HZF2      QNPDTTGIIR---PL------GGNSRGMDILYTGPMV-PNPVILLSHPLLGHILG-ILKK
A0A354E720      QNPDTAGVIR---PV------GEDTRGMDVLYTGPTV-PNPVTLLSHPLLGQILS-ILKK
A0A7T8XNA1      QTTDTTGIIR---PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKK
B2UPB6          QTTDTTGIIR---PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKK
A0A1Q6UHJ9      DGRPLEDCVI-KDYY------P----NLDVLPCEKRS-QNPTQALSSEEFISMIA-KFRE
A0A2V2BXR0      DGRPLEDCVI-KDYY------P----NLDVLPCEKRS-QNPTQALSSEEFISMIA-KFRE
A0A3C1HEJ2      GKKDFSDIIQ-KSQT------E----NFCFIGAGTKS-PNPSELLAQPGFKQLLT-EALS
A0A522ULD9      RDVPIEETIK-PTAI------P----NLHFLPSGKLP-KTSIGLLDSQRMRELVK-DLKA
A0A7W1RNH4      GKAQLDATLH-RLEV------G-GMGRLSVIPSGLVP-ANPGGVLLSNELRDLLE-QAER
A0A2D8V0G3      QITDPSEITQ-TTEV------P----NLDLICCGAVP-NNPSELVGSKRMGELLD-SLRD
A0A348S017      QVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRG
A0A3C1UUV7      QVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRG
A0A350I3V2      QVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRG
A0A520RGV5      QVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRG
A0A3D3XF90      QVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRG
A0A2D7B522      QVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRG
A0A356NIC2      QVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRG
A0A832MDW4      KAQSIDELIH-TTDV------P----NLDVVCCGATP-SQPSELLGSRRMMQFMQ-EVSK
A0A1V6JU76      QTNRVDDVIQ-TTEV------T----NLDVACCGQIR-SQPSELLGSQRMVQFMQ-ELSK
A0A848ABG7      QTNRVDDVIQ-TTEV------T----NLDVACCGQIR-SQPSELLGSQRMVQFMQ-ELSK
A0A2A2XXW5      RTDNFSEFVH-TTEV------P----NLDVICCGAVP-PNPSELIGSNRMVRFLE-EASR
A0A6N6Q6V0      RVKSVDEIVH-TSDV------P----NLDIVCAGAAP-SNPSELISSKRMHQFLE-EVSS
A0A2V6JLK8      TDMDLDQAIL-PTNV------E----NLSILPSGILP-SDAVGILNSQRMSDTIA-QLKM
A0A2W5Z1A5      SNMRIEEVIR-PTSV------E----NLSLLPSGVIP-SDAVGILNSQKMSDLIA-ELKT
A0A2V6EA09      TEMPLEKVIL-PTAV------E----NLSILPSGVLP-ADAVGILNSQRMSDTIA-ELKS
A0A2V6GQI7      TEMPLEKVIL-PTAV------E----NLSILPSGVLP-ADAVGILNSQRMSDTIA-ELKS
A0A7W1U7K0      TEIRLEDVIF-PTQV------E----NLSLLPSGILP-ADAVGILNSQRMTDLVA-ELKT
A0A7W0YDK6      SKIALDDVIV-PTGK------P----NLSLLPSGQLP-DDAVGILNSQRMSDMVE-ELKK
A0A7V9EPY1      TEIPLEEVLL-PTKV------E----NLTLLPSGLLP-SDAVGILNSQRMSDLIV-ELKS
A0A838TCM2      TDIPLDDVIH-PTTV------E----NLSLLPSGVLP-SDAVGILNSQRMSDLIA-ELKT
A0A2N8HDG3      KVEDPFSVIRTLPEH------A----GVDILYAGPHV-PNPVTLLSLPELGTLIQ-MFKE
A0A3E1ET42      TALMLEDVIL-QTPI------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKN
A0A2A2YDW8      TELMLEDVIL-QTPV------E----NLFFMPSGILP-ADAAGILNSRRMSELIA-DVKQ
A0A352XLN9      TELMLEDVIL-QTPV------E----NLFFMPSGILP-ADAAGILNSRRMSELIA-DVKQ
A0A3D0YP62      TDLLLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A3D3DV47      TDLLLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A7Y1UNY2      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A2E5XJ49      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELIE-DVKQ
A0A2E6SBY8      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELIE-DVKQ
A0A2E5QMS4      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELVQ-DVKQ
A0A2E7YXQ3      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELVQ-DVKQ
A0A2E3H787      TDLMLEDVIL-QTPV------D----NLYXLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A2E7AGN1      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A2E7AKY7      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A3D4CU34      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A2E8M146      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A355S8S2      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A2D6DVN8      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A3C1W2R2      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A2E3NAY6      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A2E3II01      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A368B8C5      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A3R7RBB5      TDLMLEDVIL-QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQ
A0A2A2QX62      TELMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A4Q3BWH6      TELMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A858RHU7      TELMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A7V7VLV5      TDLMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A3N5WCF1      TELMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A4Q3C1K5      TELMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A3D1TI55      RDVPIEETIK-STSV------P----NLHFLPSGKLP-RTSVGILNSQRMRELIK-TLKS
A0A3R8IT45      GSATIDDVVM-RDVA------P----NLDVIATGGRA-KSPTQILNSKNFEIMIA-ELRK
A0A2A2PYE8      GKATIADVAI-RNVH------P----NLDVIPAGGRA-KNPTQILNSKGFELMIS-DLRK
A0A2T6CN73      GKATLDEVIV-RNQQ------P----NLDVLPTGGRA-KNPTHILNSKAFETMIA-DLRK
A0A2G4G428      DESTIDESIV-KNVA------P----NLDVLPVGMSC-RNPTQVISSAKFIEMLT-DMRS
A0A6N6PCD8      GKAVFEEACH-STKV------P----NLTFMPAGNRN-TSPLELLADERFAKLIR-EARE
A0A139TUL1      PLASPDSVLQSGENF------P----GFDMVPAGPVP-PNPAALLTQGRFEDLIR-YWRT
A0A2N8HCB0      PQVSPDSVLQSGRKF------P----GFDLVTAGPVP-PNPVALLTQDRFEELLR-YWRA
A0A2N8HP04      PQVSPDSVLQSGKRF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRA
A0A2N8HRJ0      PQVSPDSVLQSGKRF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRA
A0A6N2U9Y7      PQVSPDSVLQSGKRF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRA
A0A6N6PAZ1      NLASFEDVIRHDSGQ------P----NLHLILGGKTA-PNPGELLETGRLHQLLE-QACK
A0A7V7VK26      NLASFEDVIYRDSGQ------P----NLHLILGGKAA-PNPGELLETGRLHQLLE-QACN
A0A6I1K459      GKATLDQSVQ-KTRF------E----NLFLLTAGRTV-PNPAELLSGQWARQLIR-EAAG
D5ENH7          KGMPIEDVTI-REVY------P----NLDVIPTGGKS-KNPTQVLVSAPFEAMLA-DLRD
A0A0R2XQ77      KGVALDEVIL-KEVY------P----NLDVLPSGGKS-KNPTQVLNSARFEAMIA-DLRD
A0A2E9IN28      KGVDLDEVII-KEVY------P----NLDVLPTGGKS-KNPTQVLNSARFEAMFA-DLRD
A0A6N4WTJ5      KDVSLDEVII-KEVY------P----NLDVLPTGGKS-KNPTQVLNSSKFEAMLA-DLRD
A0A366HAG0      SNVPLEEVVV-QTQV------D----HLYFMPSGVMP-ADSAGLLNSQKFVDLLT-DVKS
A0A2U8DZK4      SKVTLDQCRS-RNIA------P----GLDFIPSGTIS-GFTLSLFYADRLKEILA-DLRT
A0A2T6DFL8      AQKTLDEVIQ-KSIS------P----GLDFIASGAAG-NFTLSLIYANRLRELMT-TLRG
A0A1D8AWD4      NKVPWTAAVV-RDKS------G----LIDFIPAGAAANNVTLGLLYATKLKALVE-EFRG
A0A4Q1C9S2      NKVGWEAAVQ-RDKS------G----LIDFIPAGALANNITLGLLYANKLRELVA-HCRS
A0A178IH18      GKATLDDVTR-RSIA------P----NLDFIPCGSVG-GFTLSLLYADRLKALLA-GLGK
A0A2T6DT99      GKATLQSVTQ-REIQ------P----NFDFIPCGSVG-SFSLTLLYVDRLKALIQ-ELRG
A0A1G3ZT33      NKATLESVVR-RDVV------P----GLDFIASGTPG-GFTLSLLYANRLRELIA-QCKG
A0A3E1E2T2      NRKTLDEVIQ-KGLA------P----NLDFIPSGHAP-GFTLGLLHLNRLKDLIA-TLSG
B1ZMW1          NRQPLETIVQ-RELA------P----NLDFIPSGGVP-GFTLGLLQVNRLKELIA-TLRG
A0A3M1I8A3      KTDQFEELVT-ATEV------P----NLDMISCAGGS-SQSTELVASRRMVQFLD-EARK
A0A4V0XS84      QVTDPTEIIN-TSKV------P----NLDVVCCGSIP-MIPSELIGSKRMEKFLL-DMRE
A0A351WE84      KDSTLEECVK-PTIV------P----NLSFLPSGRLP-RSMMGIIDSQRMRELVK-DLKS
A0A7W1MRT6      HQSTVADVVR-ETAV------E----NLFVIPAGLLP-ANPSELLGSVVARETIE-SLAK
A0A7W1YXK2      RRRTLAGLIQ-SGGA------D----NLDVLTAGPAM-RNPAEQFNAATIARLLQDPQVA
A0A2D5WGA5      GQNTIEEVIQ-TTEL------P----SLHFIPSGKLP-SSSMGILSSAKMKEFVT-EMKS
A0A2E7SSH2      GQNTLDEVIQ-TSDS------P----NLHFIPSGKLP-SSSMGVLNSSKMKEFVA-EMKS
A0A832HNU4      DSASLEEVTY-HTDM------P----NLDVVFAGRIP-PNPPELLGTDRLRQLLE-TARG
A0A1V5QDZ6      RDVPIEETIK-TTSV------P----NLHFLPSGKLP-RTSLGLLDSQRMRELVK-NLKA
A0A4Y8P964      GQVNVEEAIQ-STAI------P----NVWAIGGGRAA-IHPADLLGSESMQYLTQ-LVRQ
A0A3D4HF88      DGSRPEDVVH-KDVY------P----NLDVMGSGGHS-QKSTQILNDKRFIALLE-DLRG
A0A1V6J089      GELKPEDVIQ-ETGV------P----NLWMLTSGRLR-RGTIGIMNNTRLRNLLD-HLKE
A0A3C1BZR1      GDLKAEDVIQ-ETGV------P----NLWMMTSGRLR-RGSLGIMNNARLRALMD-SLKE
A0A848WTQ6      SDFRIEDVVL-RTSN------Q----NLWFLPSGGLP-TDPAGLLNTQRMIDMIS-EMKR
A0A6N6ZHN8      GNDDLDGLII-HDYM------P----GLDVLVSGGRS-KSPTQALSSQRFENLMH-ELRM
A0A6G6K641      GQCALDEVLQ-STPV------A----DLDVLPAGSRS-PNPSELLSGKSLPRLIR-DLLE
A0A849Y642      GGVPVEEVIQ-ATPV------P----NIHFIPSGKYQ-SDALGILAMGRMRELIG-SLKQ
A0A7C4KLL2      GSKSLGEVIHTLEKV------K----NLHWLPAGKPA-PNPAELLAQPSFKEIIQ-TALQ
A0A1H6KPB7      SDLALQDVIL-QTHV------D----NLYILPAGPTP-SDASGVLNSYRMRELLD-EVRR
A0A2E9ISN4      DDSCDANIHIVKLKH------E----PISILPAGVFD-DSLPEKVNAARLRGLVH-SLQQ
B9XAX1          GKESLSTLVL-KTPY------P----NLYILTAGPKV-ANPAEELGGDAIKQLLL-EASN
A0A5R8KKM9      SPMELEEVVL-ETPI------E----NLFLMPSGLMP-ADSSGMLNSPRFRQLLD-DVKS
A0A7W8DJ38      EEVSFSEVCL-SGGI------A----HLAILPAGKRV-ANPAELLSTCGVERLKEMAFAA
A0A7W1ZQ43      SDTRLNRLVQ-PTNY------P----NLFVLCSGPRI-PNPAEALANGSVQDMLA-EAGS
A0A139TS01      EDYPLEEVIF-QTPV------E----NLYVMPAGPVP-FDPSGALNSRKFSELLQ-EVKQ
A0A3E1EJT7      QGSALDDIIV-KNVH------P----YLDIISTGGRA-KNPIQLFNSKEFETLVV-ELSK
A0A848WYP9      ASLSTQNICQ-KTPF------P----NLSLITCGQFI-PNSGETMSGEHFAAMLW-EAYR
A0A7C3I5X9      GKVATLEEVAQRTEV------P----HLDVVCCGSTP-SQPSELLSSRRMTEFIQ-EAGR
A0A349GXM8      HGKSLREVIQ-PARI------E----NLFVAPSGGDI-DDSAELLQTVDVRGFFV-DVQD
A0A7V3QFN7      REKKLDDVIV-HTKL------E----TLDFIPSGRIS-TSALGLLNSNQMKSLIS-ELKR
A0A4P5YP61      GQKTLKEIVQ-QTGI------E----NFSFIPAGTTA-PNPAELLGQHGIDGLVA-EALL
A0A6B2LYM4      DKGDLDSYIY-KDFL------P----NLDLLPAGGNT-KKPTQILGSEEFANLIH-ELRL
A0A6D1VXB3      GQVNIEEALQ-LSTI------P----NVWAISGGRAA-IHPTDLLGSESMHSLIQ-LVRQ
I0JYY7          GQVNIEEALQ-LSTI------P----NVWAISGGRAA-IHPTDLLGSESMHSLIQ-LVRQ
A0A4Y8P842      GQAQVEEAVQ-ATSL------P----NVWAIVGGRAA-IHPADLLGAESFGQLCR-YLRE
B3DZK9          GQAQVEEAVQ-PTSL------P----NVWAIVGGRAA-LHPADLLGAESFSQLCR-SLRE
A0A4R7S1J2      GQATFTDVIH-SSPI------PAHSGTFRVIPAGFRS-PNPAELLASNAFPQLLE-LALK
A0A2A2XV69      KQLSLEQVVH-KTKV------E----NLFFMPSGLLP-RDAVGILNSQRMMEVIQ-ETKS
A0A651H7X9      GNANFDALAK-RSPH------E----NLDVILTGGRA-KQPSQILNSADFERFIA-EARQ
A0A5E6MPC4      NQASLGNAVQ-ATAL------P----NVWAIGAGRTP-CHPADLLGAAAMAYLCQ-WARG
A0A840V0I7      GQTTLEEAAFPLPGV------E----NLHVVLSGVRA-PNPGELLSGIRLEKLLA-QATQ
A0A146G2Q9      TDVHLEEVVN-QTKI------D----NLFLMTSGRLP-ADAVGILNSQRMVDLIE-EVKH
A0A2T6D3Y2      TDVHLEEVVN-QTKI------D----NLFLMTSGRLP-ADAVGILNSQRMVDLIE-EVKH
A0A6N6PKP9      GHTHLGKAIH-LTGI------K----NLSVMPAGKRV-PNLAELFGRSELPAFLQ-CVAG
A0A6N6Z250      GQRELDAVVR-PTEI------P----GLDVITAGDGP-LHSLTLLHRAALEQLLT-QLRG
A0A4V1SB02      GLCTPDEAIR-ATAV------Q----HLSLMPSGRRA-PNPAELLAQGGVEKLIQ-QLLA
A0A6N6QEJ2      RTAKLEEVVQ-TTPQ------P----GLDFLPSGKLP-SSSVGILNSVQMKEFIE-EVKN
A0A3C1VB86      GRKKFDELCQPHQDV------P----KLSWMAAGSSV-PNPSELLMSADFQKLLS-EGLA
A0A6N6P5E3      QNIPFEPLVH-STEV------E----NLFFMPSGRLP-IDAVGILNSQRMVDLVA-STKA
A0A838I246      TNMLLEDVIL-PTSV------E----NLSLLPSGILP-SDAVGILNSQRMSDMIA-ELKT
A0A6J4HTK1      TDMRLEDVIV-PTTV------E----NLSLLPSGILP-SDSVGILNSQRMSDMIA-ELKT
A0A838FVV7      TDMKLEDVIF-PTTV------E----NLSLLPSGILP-SDAVGILNSQRMSDMIA-ELKT
A0A7C3HWX0      KQATLEEVIQ-TTKN------P----LLDFLPSGKLP-SSSLGILNSQRMKDFIQ-DVKK
A0A7V4LSC4      KQASLEEVIQ-TTKN------P----LLDFLPSGKLP-SSSLGILNSQRMKDFIK-EVKS
A0A2D5VY59      GQKSVEEVIQ-TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKT
A0A2D8UZZ4      GQKSVEEVIQ-TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKT
A0A353DV86      GQKSVEEVIQ-TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKT
A0A2E5EPT8      GQGKLEDVIQ-KTDQ------A----DLDLLPSGKLP-SSAMGILNSQQMRDFVK-EVQS
A0A5B5WZ91      EDYPLEDVIF-QTPV------E----NLYVMPAGPIP-FDPSGALNSRKFSELLQ-EVKQ
A0A2N8HD92      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGTLNSRKFSELLQ-EVKQ
A0A2N8HIT2      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A354EBD3      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A355VEB2      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
R6K1U5          EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A2N8IWC2      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A2N8I441      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A2N8I3A6      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A410SCC4      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A3R5VEW0      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A7T9B0I0      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
B2UKW3          EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A411SSG2      EDYPLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQ
A0A6M1RXR2      RQNKLEEVIQ-TTQL------P----TLDFMPSGKLP-SSSLGILSSQAMRELIQ-ELKQ
A0A7C3DXS4      RQNKLEEVIQ-TTQL------P----TLDFMPSGKLP-SSSLGILSSAAMRDLIN-ELKQ
A0A7V6YXH8      RQNTLEEVIQ-TTSL------P----TLDFMPSGKLP-SSSMGVLSSAQMKDLIQ-ELKQ
A0A2V2SDV4      KQNTVEEVIQ-TTSL------P----TLDFMASGKLP-SSSLGILNSPQMKELIG-QLKQ
A0A6N6PHJ5      KQNTLDEVIQ-TTSV------P----TLDFLASGKLP-SSSLGILSSSAMKDLIG-ELKA
A0A7Y4QKN3      KQNTIDEVVQ-TTSV------P----TLHFMASGKLP-SSSLGILSSTQMKDLIG-ELKM
A0A2V5PK75      KQNSLEDVIR-TTPL------P----TLDFLASGKLP-SSSLGILSSAQMKELIN-ELKQ
A0A1V6DME1      KQNKLEEVIQ-TSPL------A----TLDFLPSGKLP-SSSLGILNSAQMKDLIA-QLKQ
A0A3D3DIJ3      RQNTLEEVIQ-TTSL------P----TLDFLSSGKLP-SSSLGILSSTQMKDLIG-ELKQ
A0A7X7VJR5      RQNTLEEVIQ-TTSL------P----TLDFLSSGKLP-SSSLGILSSTQMKDLIG-ELKQ
A0A6I1K583      GQNKLEEVIQ-TTSL------P----NLNFLPSGRLP-SSALGILNSPQMKEFIK-EAKR
A0A350EWA4      GQQPIEEVVQ-TSSL------P----SLDVMPSGKLP-SSSMGILSSVRMKQLVK-ELKS
A0A832D3W5      REKKLDDVIV-HTKL------E----TLDFIPSGRIS-TSALGLLNSNQMKSLIS-ELKR
A0A7V2G542      SELRLEEVIR-PSGI------E----NLSIMPSGILP-SDAVGILNSQRMSDMIV-DLKN
A0A7C4KPD7      KQNSLAEVIQ-TTSL------P----TLDFMPSGKLP-SSAMGILNSPSMKEMIS-ELKR
A0A832MGU4      KQNTLAEVIQ-TTPH------P----NLDFLPSGKLA-SSALGILSSQAMRELID-ELKR
A0A1M6RLZ4      TDLMLEDVIL-QTPI------D----NLFFMPSGILP-ADAAGILNSRRMSDLVQ-DVKQ
A0A832M6Y9      GYSPLHECIR-ATDI------P----NLHVITAGKLP-PQCMGALSPAKMSEIVQ-TLKP
A0A832HP42      KQNTLEEVIQ-TTSH------P----NLDFLPSGKLP-SSALGILNSARMKEFID-DVKR
A0A354T7G8      TDISLEDVVI-RTQV------E----NLFFLPSGLLP-ADSAGLLNSQRMVDLIA-DVKS
A0A512MBZ2      MNIRLEDVVV-RTPI------D----NLYFLPSGLLP-ADSAGILNSQRMSELIA-DVKS
A0A2E8MEZ0      TDLALEDVIL-QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELLQ-DVKQ
A0A7Y2T9S5      TDLLLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A851GRQ2      TDLLLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIK-DVKQ
A0A6B3LBV6      TNMPLEEVIL-QTPI------E----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKS
A0A840UX61      TDLMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A4Q2YKS3      TELALEDVIL-QTPV------D----NLYFMPSGILP-SDAAGILNSRRMSELIQ-DVKQ
A0A6N6P3T8      TELMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A8A7W668      TELMLEDVIL-QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQ
A0A2E3EC33      TDLALEDVIL-QTAY------E----NLYFMPSGILP-SDAAGILNSRRMSELIA-DVKS
A0A2E4GN01      TDXALEDVIL-QTAY------E----NLYFMPSGILP-SDAAGILNSRRMSELXA-DVKS
A0A800JJX7      TDLVLEDVIL-QTAY------E----NLYFMPSGILP-SDAAGILNSRRMSELIA-DVKS
A0A1Z8XU55      TDLQLEDVIL-QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKS
A0A2E1RQR9      TDLQLEDVIL-QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKS
A0A2E3ISQ4      TDLKLEDVIL-QTAY------E----NLYFMPSGILP-ADAAGILNSKRMSELIA-DVKS
A0A2D6W6F4      TDLXLEDVIL-QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-XVKS
A0A2D8Z5A8      TDLKLEDVIL-QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKS
                                           .                                

A0A2A2XVF1      RYDRIVIDSAPVNAVSDTLILAPH-ADKTILVIHAGKTPRKAIQRSVHLLR-KAQA--KV
A0A2V5UHJ2      QFEFIFVDSSPLMAVSDAVFLSTM-VDGTLLVIN-RRTPKPLLRKARARLT-TPHS--KI
A0A2V5PST3      SFDFILIDSSPAIAVSDPVILSNV-ADGVILVFHAQKTTAASARKTKERFD-AIRA--PI
A0A2V5PXM3      HFERVIIDSAPVHAVSDTLLILDR-VQTLCLVVRSRKTPRNSVLRAVQMLN-EAGA--PL
A0A1V5QB01      QYDRILFDCPPVMAVSEAAILTSL-AEGVVMVVWAGHTSRKLVQLAAKLIQ-ERGA--RI
A0A800JGC6      DFQRVVFDTPPLIPVRDSLPVSKL-VDSTVILYRMGTTHRKAISRILKLLN-ENNA--DP
A0A7Y2T8X5      YYDRVIIDSAPVLPVSDTRLLVNH-VHSVVLVVRALKAPAGAILRAKELLM-VAKA--PL
A0A1J4XH17      RYSKIIIDTPPLGVVSDIMNILPY-TDGLIFVVKFNSVKRKTAKAHLSRLL-ESNV--PV
A0A7C5LI63      HYDRIIVDSPPIMGIADAAILGAA-CDGSLFVIWAGRTSRRYVRVAKMTAV-SRGA--KL
A0A7C5P291      RYSRVILDCPPVMGIADSAILGAA-VDGVLFVIWAGRTSRRYVRVAKTTAV-SRGA--KI
A0A290QGD9      RYDRVFIDTPPIAAVSDALIILPL-VDGSIFTVFFNKVRRRAAQYAARRLI-DSHV--PN
A0A1D8AS58      RYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFFNRVRRKAAQFSARKLL-EANV--PC
I6AQC1          RYDRIFIDTPPLAAVSDALIILPL-VSGSIFTIFFNKVRRKAAQHAARKLL-ESNV--PV
W0ITH7          RYDRIFIDTPPLAAVSDALIILPL-VSGSIFTIFFNKVRRKAAQHAARKLL-ESNV--PV
A0A139SU05      YYDLIIIDSPPLGAVTDGLLIAER-VDEVAYVCRFNRAHRKHIQLYMRALR-NAKT--EV
A0A139SPN4      YYDLIVIDSPPLGAVTDGLLIAER-VDEVAYVCRFNRAHRKHIQLYMRALR-NAKT--EI
A0A1V6E7N1      QYELVVVDSPPLGAVTDSLLLAER-TDEIVYVCRFNKALRKHIQLYTKLLL-SGKN--EV
A0A2D9MYT1      KYEKIVFDCPPVSAVSDPLIIAAN-TDGTVFVNKFNKIRREHARKTVQRVQ-DAGI--NI
A0A258ANJ7      GFDRIVIDTAPLIPVNDTLELGTL-ADSTFLVVRCNRTPADIILEAIRKLH-QTGI--PI
A0A1Z8ZMT6      NFDHIVIDSAPLLPVPDTRILAPL-VDNLALVIRADHTPVKSIQGALEMLK-DDGV--SS
A0A2E8MCT7      NFDHIVIDSAPLLPVPDTRILAPL-VDNLALVIRAEHTPVKSIQRAFDMLE-DDGV--FS
A0A139TLN4      HYDFIFMDCVPYASLADARIAARL-ADATLYVMRAGCVKKRDLSSLQKTWK-SGEL--KR
A0A1G3ZFT0      QFDIILIDTAPVLLVTDAVLISAT-SATNYLVLGSNVHQASHLEMAIKRLS-SAGV--TV
A0A5B5WI95      KYDAVIIDTPPYGILADTAILAAL-SDISLYLIRSGMIDKRYFNQIQKLAD-SGKL--PN
A0A2N8I9W1      QYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PN
A0A4Q5IH27      QYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PN
A0A2N8IBZ6      QYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PN
A0A7G6DX28      QYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PN
R6J100          QYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PN
A0A139TV24      SYDAVIIDAPPYGILADTAIFAKL-ADISLYVIRSNKIDKRYIATIQQLAN-EGKL--PN
A0A2N8HT11      RYDAVIIDSPPYGILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQL--PN
R7DS70          RYDAVIIDSPPYGILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQL--PN
A0A2N8HNL6      RYDAVIIDSPPYGILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQL--PN
A0A290Q2Z2      RYDRVIFDAPPIIGVSDASVLASV-ADDVLLLVQHRRNPHSMVVRAQQIIE-GLHK--QI
A0A2A2RGK2      KYDRVVVDSAPLLAVSDTLLIAPH-IDLCTLVVRAFTTPKKMVMRAIKSLE-ETKT--TP
A0A2A2XXF7      KYDRIVVDSAPLLAVSDTLLVAPH-VDLCTLVVRAFGTPRKMVARAIKSLE-ETKT--HP
A0A146GCJ0      TYDRVVVDSAPVNAVSDALLIASC-VDTACLVVRAGKTPKKASLRAVKQLQ-KSGA--KL
A0A2T6D6H8      SYDRIVVDTAPVNAVSDVLLIANC-IQTTCLVVHAGRTPKKAVLRAVRQLQ-KTGA--RL
A0A6B3L938      HFDRVIVDTPPVLPVSDTRLIAQH-AQKSILVVRALKTPVGAVLRARDLLQ-DAKI--SL
A0A2A2R5D6      RYDIVLLDAPPVLGISDGAVLAHE-VDFTLLVIQHRRYPRDISMRAKRAVE-EVKG--NL
A0A2V5URB2      SYDFIFIDSPPIMPVSDAVVLSTL-TDGMIFVVRGQNTPKHIVREAISQLG-NNRS--KI
A0A2V2DJ66      KYDKVFIDSPPIGAVSDAISLLPE-VDGVLYVIKFNTAKRKVVRRCVRRMM-ESNV--PI
R7L5A9          TYDRIFIDSPPIGAVSDAITLLPT-VDGVIYVVKFNTVKRKTIRAYIRRMM-ESNV--PI
A0A5B5WU87      HYDFIFMDCVPYASLADARIVARL-ADATLYVMRAGCVRKRDLPCLQKTWK-NGKL--KR
R7DZW0          QYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGEL--KR
A0A2N8HID1      QYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGEL--KR
A0A2N8HS06      QYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGEL--KR
A0A6N2TNT9      QYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGEL--KR
A0A4P5QM05      RYDVVFFDSPPILGVSDASILVSE-VDNTIMVVQYRRFPRNMLQRVKSTVA-HVGG--NL
A0A4Q3C001      QYDLVFFDSPPILGVSDGSVLASE-VDMTIMVVQHRRFPRAMLQRVKQAVI-QVGG--TL
B4DB23          QYDLVFFDSPPILGVSDGSVLASE-VDVTIMVVQHRRFPRVMLQRVKQAVL-NVGG--RL
A0A5R8KA81      KFDRVVLDTAPIHAVSDTLHMVSF-CKFVCLVARCSKTPRKAVIRAAQMLE-EAGK--AP
A0A2E6T482      RYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGG--DL
A0A3C0DQZ7      RYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGG--DL
A0A1Z9CBK5      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQXMTQRAKDMVV-KVGG--NL
A0A2D6ZI96      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQXMTQRAKDMVV-KVGG--NL
A0A358KGZ3      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--DL
A0A2E9ZQX4      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--XX
A0A3D5JZU0      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--DL
A0A2E6HCR0      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--DL
A0A1Z8WN04      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NL
A0A2D7L1N4      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NL
A0A2E2R937      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NL
A0A520QQY4      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NL
A0A2D5MR66      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NL
A0A2E0PDQ1      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVT-KVGG--NL
A0A2E2ZZP9      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVT-KVGG--NL
A0A4P5YMI6      RYDFVFFDSPPIMGVSDASILVSQ-MDLAMLVVQFRKYPQAMSVRAKQTIE-KVGG--NL
A0A7C4LRK7      RYEYVFFDSPPIMGISDASILASE-VDMTLQVIQYRRYPQPMTIRAKQMIE-KVGG--NL
A0A3C1VJ32      RYDFIFFDSPPILGVSDASILASE-VDLVMQVIQYRRYPQPMTIRAKQMIE-KVGG--NF
A0A7W1VTI1      RYDYVFFDSPPIMGVSDASILASE-VDMAVQVIQYRRYPQPMTIRAKQMIQ-KVGG--NL
A0A7V4IGZ6      RYDFVFFDSPPIMGVSDASILASE-VDMTMQVIQYRRYPQPMNIRAKQMIE-KVGG--NL
A0A2N9NTX7      RYDFVFFDSPPIMGVSDASILASE-VDMTLQVIQYRRYPQPMNIRAKQLIE-KVGG--NL
B9XK55          RYDYVFFDSPPIMGVSDASILASE-VDMTLQVIQYRRYPQPMNIRAKQLIE-KVGG--NL
A0A2A2RGF2      RYDFVFFDAPPIMGVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGG--RL
A0A2G4I5Y6      RYDFVFFDAPPIMGVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGG--RL
A0A6N6PS97      RYDFVFFDSPPIMGVSDASILCSE-VDIALLVIQYRKYPEVMTVRAKQMVD-KVGG--NL
A0A3M1I883      RYDFVFFDSPPIMGVSDASILCSM-VDIALLVVQYRKYPQAMTLRAKQMVQ-KVGN--NL
A0A1V6JZ45      RYDFVFFDSPPIMGVSDASILASE-VDLSVLVVQYRKYPQAMTLRAKQMVE-KVGG--TM
A0A848A4B3      RYDFVFFDSPPIMGVSDASILASE-VDLSVLVVQYRKYPQAMTLRAKQMVE-KVGG--TM
A0A7C7Z746      RYDFVLFDSPPIMGVSDASILASE-VDLAIQVIQYRKYPQAMTIRAKQMVE-KVGG--NL
A0A520RRW5      RYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGG--NL
A0A356NPK0      RYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGG--NL
A0A2D7B5P5      RYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGG--NL
A0A3D3XGB5      RYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGG--NL
A0A2V6F8A1      RYDFVFFDSPPIMGVSDASILASE-VDLALLVIQYRKYPQAMTLRAKQMVE-KVGG--TM
A0A2V5TNH4      RYDFVFFDSPPIMGVSDASILASE-VDLSLLVIQYRKYPQAMTIRAKQMVE-KVGG--AL
A0A2V5X5Q6      RYDFVFFDSPPIMGVSDASILASE-VDLSVLVIQYRKYPQAMTIRAKQMVE-KVGG--AM
A0A3R5R2M8      QYDTVIIDAPPYGILADTAILASW-SDISLYLTRSGMIDKRYFPQVQKLAD-TGKL--PN
A0A411SUQ6      QYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PN
A0A2N8HZF2      QYDAVIIDAPPYGILADTAILASL-SDITLYTVRSGKIDKRYLLQIQQLAD-QGKL--PN
A0A354E720      QYDAVIIDAPPYGILADTAILASL-SDITLYTVRSGKIDKRYLTQIQQLAD-QGKL--PN
A0A7T8XNA1      QYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PN
B2UPB6          QYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PN
A0A1Q6UHJ9      QYDKVFIDSPPVGAVSDAIALLPY-VDGVIYIVKFNSVSRKAIQKNVRRLM-VSNV--PV
A0A2V2BXR0      QYDKVFIDSPPVGAVSDAIALLPY-VDGVIYIVKFNSVSRKAIQKNVRRLM-VSNV--PV
A0A3C1HEJ2      HFDQVVIDSAPVHPVSDTLLLAHR-AKTVCVVVRANKTPRKAALTAVQKLQ-KSRA--NI
A0A522ULD9      RYDYVFFDSPPIIGVTDASILASE-VDGVMLVVQYRKFPKVISMRAKRMIE-NTGS--HI
A0A7W1RNH4      EYDIIIIDSPPLNVVADAAILSGV-TQGVVLVARSGVTAKAAITYAAEQLR-LVRA--PL
A0A2D8V0G3      RYDRIFVDCPPVSAVSDPLMVGAR-TDGMVFVSKFNKIRREHARKTVQRIQ-DAGI--YI
A0A348S017      KYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YI
A0A3C1UUV7      KYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YI
A0A350I3V2      KYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YI
A0A520RGV5      KYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YI
A0A3D3XF90      KYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YI
A0A2D7B522      KYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YI
A0A356NIC2      KYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YI
A0A832MDW4      RYDRIIMDCPPISAVSDPLVLSAM-ADGVVYVTKFNKIRREHARKSIQRLL-DAGI--HI
A0A1V6JU76      RYDRVILDCPPVSAVSDPLILSAM-ADAVVFVTKFNKVRRDHARRTIQRIQ-DAGI--HI
A0A848ABG7      RYDRVILDCPPVSAVSDPLILSAM-ADAVVFVTKFNKVRRDHARRTIQRIQ-DAGI--HI
A0A2A2XXW5      RYDRVILDCPPVSAVSDPLIVGAM-ADGMVFVTKFNKIRREHALRSVQRIQ-DSGI--HL
A0A6N6Q6V0      RYDRVILDCPPVSAVADPLVVGAM-CDGVIFVTKFNKIRRDHALRSVQRIQ-DAGI--NL
A0A2V6JLK8      RYDIVFFDSPPILGVSDASVIASE-VDQTVIVVQHRRFPRAMLTRVKQAIL-GVGG--TV
A0A2W5Z1A5      RYDIIFFDSPPMLGVSDASVLASE-VDQTIIVVQHRRFPRAMLTRVKQAIT-GSGG--TV
A0A2V6EA09      RYDLIFFDSPPMLGVSDASVLASE-VDETIIVVQHRRFPRAMLTRVKQAIL-SVGG--TL
A0A2V6GQI7      RYDLIFFDSPPMLGVSDASVLASE-VDETIIVVQHRRFPRAMLTRVKQAIL-SVGG--TL
A0A7W1U7K0      RYDLILFDSPPMLGVSDASVLASE-VDQSIIVVQHRRFPRAMLTRVKQAIS-SVGG--TV
A0A7W0YDK6      RFDMIFFDSPPLLGVSDASVLASE-VDLTIMVVQHRRFPRAMLTRVKQAIV-GVGG--HL
A0A7V9EPY1      RYDMILFDSPPMLGVSDASVIASE-VDQTIIIVQHRRFPRAMLTRVKQAII-GVGG--NV
A0A838TCM2      RFDMVLFDSPPILGVSDASVLASE-VDQTIIIVQHRRFPRAMLTRVKQAIV-GVGG--SV
A0A2N8HDG3      RYDAVIIDSPPYGILADTAILAGH-ADISLYVVRSNRIDKRHISTVQQLAD-SGQL--PN
A0A3E1ET42      RFDLVLIDSPPILGVSDASVLASE-VDLTIIVIQHRKLPRSMLLRVKQAIE-NVGG--NL
A0A2A2YDW8      RFDLVLVDSPPILGVSDASVLASE-VDLTIIVVQHRKLPRNMLLRVKQAVE-NVGG--HV
A0A352XLN9      RFDLVLVDSPPILGVSDASVLASE-VDLTIIVVQHRKLPRNMLLRVKQAVE-NVGG--HV
A0A3D0YP62      RFDLVLVDSPPILGVSDASVLASE-VDLTIVVVQHRKLPRNMLVRVKQAVE-NVGG--HV
A0A3D3DV47      RFDLVLVDSPPILGVSDASVLASE-VDLTIVVVQHRKLPRNMLVRVKQAVE-NVGG--HV
A0A7Y1UNY2      RFDLILVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAIE-NVGG--QV
A0A2E5XJ49      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--QV
A0A2E6SBY8      RFDLILVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRXMLLRVKQAVE-NVGG--QV
A0A2E5QMS4      RFDLILVDSPPILGVSDASVLASE-VDLTIVVVQHRKLPRNMLMRVKAAVE-NVGG--QV
A0A2E7YXQ3      RFDLILVDSPPILGVSDASVLASE-VDLTIVVVQHRKLPRNMLMRVKAAVE-NVGG--QV
A0A2E3H787      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVXQAVE-NVGG--QV
A0A2E7AGN1      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--YV
A0A2E7AKY7      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--YV
A0A3D4CU34      RFDLVLVDSPPILGVSDASVLASE-ADLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--YV
A0A2E8M146      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKQAVE-NVGG--HV
A0A355S8S2      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKQAVE-NVGG--HV
A0A2D6DVN8      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HV
A0A3C1W2R2      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HV
A0A2E3NAY6      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMXVRVKEAVE-NVGG--HV
A0A2E3II01      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HV
A0A368B8C5      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HV
A0A3R7RBB5      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HV
A0A2A2QX62      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--HV
A0A4Q3BWH6      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--HV
A0A858RHU7      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--HV
A0A7V7VLV5      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--NV
A0A3N5WCF1      RFDLVLVDSPPILGVSDASVLASE-VDLTMLVVQHRKLPRNMLLRVKQAVE-NVGG--HV
A0A4Q3C1K5      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--NV
A0A3D1TI55      RYDYIFFDSPPIVGVSDASVLASE-VDLALLVVQYRKYPKVMSNRAKKMVE-NVGG--RL
A0A3R8IT45      RYDRIFIDTPPLAAVSDALIILPL-ANGAIFTIFFNKVRRKAAQHAARKLL-ESNV--PV
A0A2A2PYE8      QYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFFNKVRRKAAQFSAKKLL-EANV--PN
A0A2T6CN73      RYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFFNKVRRKAAQFAAKRLL-DSNV--PN
A0A2G4G428      RYDRIFIDSPPIGAVSDALNLIPN-VDGVIYVVRYNFVSTRNVAECITRLR-EVGV--PI
A0A6N6PCD8      KFDRVILDSAPINAVSDALLIVKH-ADATAFVVRARKTPTRTVLRALHLLE-GADQ--TP
A0A139TUL1      RYDRIIVDGCPYEAVADASLMARH-ADLVLYLIRCGMIEKQYVPSIQEVAA-RGEF--RS
A0A2N8HCB0      RYDRIILDGCPYEAVVDASLMARH-ADLVLYVIRCGMIEKQYVPAIQGLAD-KGEF--RA
A0A2N8HP04      RYDRIILDGCPYEAVADASLMARH-ADLVLYVIRCGMIEKQYVPVIQGLAD-KGEF--RS
A0A2N8HRJ0      RYDRIILDGCPYEAVADASLMARH-ADLVLYVIRCGMIEKQYVPVIQGLAD-KGEF--RS
A0A6N2U9Y7      RYDRIILDGCPYEAVADASLMARH-ADLVLYVIRCGMIEKQYVPVIQGLAD-KGEF--RS
A0A6N6PAZ1      DYDVVVLDTAPILAVPDTRIIAPL-AHNFCLVARAEYSPKGAVHRTIQILA-EDGT--HI
A0A7V7VK26      DYDVVVLDTAPILAVPDTRIIAPL-AHNLCLVARAEHSPKGAIRRTLQILA-EDGN--HL
A0A6I1K459      KFDHVVLDNAPVNAVSDALLIVKE-AQTVCLVANARKTSYRVVQRALEMLR-RAGA--KP
D5ENH7          RYDRIVIDSPPLAAVSDALNLLPL-VDGVVYVIKFNTVKRKTAVANVRRLW-ESNT--PV
A0A0R2XQ77      RYDRIVIDSPPLAAVSDVLNLLPL-ADGVLYVIKFNTVKRKTAVVNVRRLW-ESNT--PI
A0A2E9IN28      RYDRIVVDSPPLAAVSDALNLLPL-VDGILYVIKFNTVKRKTAVVNVRRLW-ESNT--PV
A0A6N4WTJ5      RYDRIVIDSPPLAAVSDALNLLPL-ADGVIYVIKFNTVKRKTAVVNVRRMW-ESNT--PV
A0A366HAG0      RFDLVLIDSPPIIGVSDASVLAAE-ADMTIIVVQHRKLPRQMLQRVKQTIE-QVGG--KV
A0A2U8DZK4      QYDRIVFDAPPIIGVSDSAVITSL-IDHVLLLIQYRRNPLSMVLRAQQTIL-GLDK--EI
A0A2T6DFL8      RYDRIVFDSPPIIGVSDTSVLMTV-VDGVVLLIQHRRNPQSMVLRAQQIVG-GVKA--SI
A0A1D8AWD4      RYDKVLFDSPPIIGVSDASVLASL-ADGIVLLIQHRRNPESMVQRAKQIID-GLKV--PV
A0A4Q1C9S2      RYDKVLFDSPPIIGVSDASVLGSL-ADGIVLLIQHRRNPESMVQRAKQIIDQQVKV--PV
A0A178IH18      SYDRIMFDAPPIIGVSDASVITSL-VDDVLLLVQYRRNPQSMVVRAQQIIA-GLHK--EI
A0A2T6DT99      QYDRIVFDAPPIIGVSDASVLASV-MDDVLLLVQHRRNPQSMVMRAQQIIE-GLGK--TI
A0A1G3ZT33      RYGRIVFDSPPVIGVSDASVLSSV-VDGVVLLIQHRRNPQSMVLRAKQIIE-GLKT--PL
A0A3E1E2T2      RYDKIVFDSPPIIGVSDASVLASA-VDGTVLLIQHRRNPQSMVVRAQQIVE-SLKA--PL
B1ZMW1          RYDKILFDSPPIIGVSDASVLASV-MDGAVLLIQHRRNPQSMVLRAQQIVE-AIKT--PL
A0A3M1I8A3      RYDRVILDTPPVSAVSDPLVVASL-SDGCVFVAKFNKVRREHARKTLRRLL-DAGV--HI
A0A4V0XS84      RYDRVVFDCPPVAAVSDALVLGTL-ADGVIFVVKFNKIHRDHARKSIQRIQ-SAGI--NI
A0A351WE84      RYDYVFFDSPPIIGITDASILASE-VDGVLLVVQYRKYPRVISSRAKRMVE-NVGG--KL
A0A7W1MRT6      EYAIVIIDTPPVHVAADALILGSM-ANGVLMVLRAGRSERDAAKEALQRLL-NVGA--HV
A0A7W1YXK2      NYDRVVFDSAPLHAVSDGLILVRH-ADVVCLVVRAAVTPVRVVQRAAALLT-GAGA--EE
A0A2D5WGA5      RYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGG--DL
A0A2E7SSH2      RYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--NL
A0A832HNU4      RYQRIILDTAPVTVVSDPLILLPH-ADGIVFVVQFSRLRRGVVGRALQKLR-EANV--PL
A0A1V5QDZ6      RYDYVFFDSPPIMGVTDASILASE-VDGVLLVVQYRKYPKIITSRAKRMIE-NVGG--NV
A0A4Y8P964      YFGYVLIDTPPMHGMPDAAIIGTL-TDGLIYVIQNGRTEKKDFLQNLQILA-SVNT--KI
A0A3D4HF88      SYDRVFIDSPPVAAVSDALNVLPH-VDGVLYVINYNTVKRKTVKASVRRLF-ESNV--PV
A0A1V6J089      QYDYILLDSPPILGVTDAAILASE-VDGVLLVVQYRKYPKIISLRAKRMIE-NAGG--QV
A0A3C1BZR1      KYDFVLLDSPPILGVTDAAILASE-ADGVLLVVQYRKYPKIISLRAKRMIE-NAGG--RL
A0A848WTQ6      RFDFVFIDAPPILGVSDASVISRE-ADLTMVVVQHRKLPQKTLLRVKQAIE-NAGG--NM
A0A6N6ZHN8      RYDKVIIDCPPLAPVSDALNVVPQ-ADGVLYVIRFKMVKRKTASINIRRLR-ESNV--PV
A0A6G6K641      RYDKVVIDSAPIMAVSDTLVVAPH-VDTICLVVRSHKTPAYAVMRASVALR-KTDK--IP
A0A849Y642      RYDMVFFDSPPVLGISDAPILARE-VDLAVLVIQYRRYPRQLALRAQASLE-KAGV--RL
A0A7C4KLL2      HYDRVVLDTAPIHAVSDTLLICNL-AETTVLVVNSTKTPRKPVLRSIQLLR-NAGG--NP
A0A1H6KPB7      RFDIVLIDSPPVLGVSDASLIVSK-ADATIMVVQPRKLPMKALVREKMVIE-NAGG--HL
A0A2E9ISN4      DYDVIIIDTAPVSIFSESLAFCQ--ATGGVLVMMDSLTSQASVQNCLNELR-GI----RT
B9XAX1          QFDRIVIDTPPINAVSDTFILLPL-AQIICLVVRAGKTPKHAIMRAVELMA-RANV--PP
A0A5R8KKM9      RFDIVLIDSPPILGVSDASVLAAE-ADLTLLVVQHRKLPRHMLQRVKHSVD-AVGG--DV
A0A7W8DJ38      GFDRIVIDTAPLIPVNDTLELGAL-ADSTFLVVRCNRTPTDIVQEAIRKLY-QTGI--PL
A0A7W1ZQ43      HFDRIIVDTAPINAVSDTFLILPF-VDQVCLVVKSGGTPQRAIKRAVDLMV-RANV--EP
A0A139TS01      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A3E1EJT7      RYDRVLFDTPPLGAVSDALNILPL-MDGAIYTIHFNRVRRKAAQQCTRRLL-AVNV--PV
A0A848WYP9      SFDCVIIDSSPAGVVSDALSYARY-ADAVMVVVRSGVTQTGDAQRVVQELR-RMRA--PL
A0A7C3I5X9      QYDRVVIDCPPVSAVSDPLIVASQ-VDGVVLVAKFNKVRREMARKSVQRLL-DAGV--QP
A0A349GXM8      DYDYIFVDTSPVLRVTDTVILASQGIGQVLYVARVNFTPKPMIRYSLDMLK-DA----NI
A0A7V3QFN7      RYDYVFFDSPPIIGVSDAAILASE-VDMTIQVIQYRRYPQPMYLRAKQIIE-KVGG--NL
A0A4P5YP61      NYDRVVIDSAPVHAVSDTLLMLKR-VQTVCLVARANKTPRKATLRAVQMLR-QAEA--PL
A0A6B2LYM4      RYDRVIIDTPPIATVSDAMNILPL-VDGVLMVIRFNMVKRKTASVNIRRLR-ESNV--PI
A0A6D1VXB3      YFCYILIDTPPMHGMPDAAIIGSV-TDGLIYVIQAGRIERKDFLQNLQILA-TVNA--RI
I0JYY7          YFCYILIDTPPMHGMPDAAIIGSV-TDGLIYVIQAGRIERKDFLQNLQILA-TVNA--RI
A0A4Y8P842      YFAYILIDTPPMRGIPDASIVSMQ-TEGVLYVIEDGKDDRKEVQNNVEAFS-RINT--RI
B3DZK9          YFTYILIDTPPMRGMPDAPIVSMQ-SEGVLYVIEDGRDDRKEVQNNIEAFS-RINS--RV
A0A4R7S1J2      HFDRVVIDTAPIVAVSDTLVIVPH-VQTVLLVIHWKKTPSTVIQRALNLLG-ESGK--SP
A0A2A2XV69      RFDIVFFDSPPILGVSDASVLSSE-LDLTIIVVQHRRFPKEMIQRVKQAIE-NVGG--NI
A0A651H7X9      RYQRIIIDTPPLAAVSDSLILLPL-VDGALFTIQFNRVKRKAAQTVVRRLS-ETSV--PV
A0A5E6MPC4      HFTYVILDCPPLVGMPDAAVVATL-TDGVLLVIRDGAVDRSDARRVVETLS-VVNT--RI
A0A840V0I7      YFDVVVLDTAPVLAVPDTRIIAPQ-VDNLCLVIRANYTPKGAVRRVLEVLE-EGGT--PP
A0A146G2Q9      RFDIVFFDSPPILGVSDASVLSSA-VDLTIIVVQHRRFPRAMLQRVKQAVL-NVGG--NI
A0A2T6D3Y2      RFDIVFFDSPPILGVSDASVLSSA-VDLTIIVVQHRRFPRAMLQRVKQAVH-NVGG--NI
A0A6N6PKP9      GYDRVVIDSAPVLTVSDTLLLAPH-ADTACLVVRAGVTPGHAVVRAVEKLR-ESGA--KI
A0A6N6Z250      RYDRILLDSPPILGVSDASLLQPL-ADAVVLVVQYGRFPQPAVERAARSVR-QHGS--LV
A0A4V1SB02      KYDRIVFDSAPVNAVSDTLSIAPL-ANAVCIVLRYGKTPRRAILRAVGLLR-KSNA--RM
A0A6N6QEJ2      RYDFVFFDSPPIMGVSDASILVSE-VEMAILVVQYRKYPQQMTLRAKQMVE-KIGGAERL
A0A3C1VB86      HYDRIVIDTAPILPVSDTLLLAGK-VQTVVLVVQACKTSRKAVERSVQLLK-NASA--PT
A0A6N6P5E3      AYDIVFFDSPPILGVSDASVIASS-VDLTLVVVQHRRFPRAMLIRVKQALA-NVGA--NV
A0A838I246      RYDIVFLDSPPMLGVSDASVLASE-VDQTIIVVQHRRFPRAMLTRVKQAIL-GVGG--NV
A0A6J4HTK1      RYDIIFFDSPPMLGVSDASVLASE-VDQTIIVVQHRRFPRAMLTRVKQAVL-GVGG--TV
A0A838FVV7      RYDIVFFDSPPMLGVSDASVLASE-VDQTIIVVQHRRFPRAMLTRVKQAVL-GVGG--NV
A0A7C3HWX0      RYDFVFFDSPPIMGVSDASILASE-VDLAILVVQYRKYPQAMTLRAKQMVE-KVGG--TL
A0A7V4LSC4      RYDFVFFDSPPIMGVSDASILASE-VDLSLLVVQYRKYPQAMTLRAKQMVE-KVGG--TL
A0A2D5VY59      RYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGG--NL
A0A2D8UZZ4      RYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGG--NL
A0A353DV86      RYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGG--NL
A0A2E5EPT8      RYDFILLDSPPLMGVSDATVLTSM-VDLTLLVIQYRKYPQSLAVRSRQMIE-KVGG--TL
A0A5B5WZ91      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A2N8HD92      RFDMVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A2N8HIT2      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A354EBD3      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A355VEB2      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
R6K1U5          RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A2N8IWC2      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A2N8I441      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A2N8I3A6      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A410SCC4      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A3R5VEW0      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A7T9B0I0      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
B2UKW3          RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A411SSG2      RFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NL
A0A6M1RXR2      RYDFVFFDSPPIMGVSDASILASE-VDMALQVIQYRRYPQPMNIRAKQMIE-KVGG--NL
A0A7C3DXS4      RYDFVFFDSPPIMGVSDASILASE-VDLTLQVIQYRRYPQPMNIRAKQLIE-KVGG--NL
A0A7V6YXH8      RYDYVFFDSPPIMGVSDASILASE-VDLTLQVIQYRRYPQPMNIRAKQMIE-KVGG--NL
A0A2V2SDV4      HYDFVFFDSPPVMGVSDASIIASE-VDMTLQVIQYRRYPQPLNIRAKQLIE-KVGG--NL
A0A6N6PHJ5      RYDIVFFDSPPIMGVSDASILASE-VDMTVQVIQYRRYPQPMNVRAKQLIE-KVGG--NL
A0A7Y4QKN3      RYDFVFFDSPPIMGVSDASILASE-VDLTIQVIQYRRYPQPMNIRAKQLIE-KVGG--NL
A0A2V5PK75      RYDFVFFDSPPIMGVSDASILASE-VDMTLQVIQYRRYPQPMNVRAKQLIE-KVGG--NL
A0A1V6DME1      RYDFVFFDSPPIMGVSDASILASE-MDMTVQVIQYRRYPQPMNIRAKQLIE-KVGG--NL
A0A3D3DIJ3      RYDFVFFDSPPIMGVSDASILASE-VDMTIQVIQYRRYPQPMNIRAKQLIE-KVGG--NL
A0A7X7VJR5      RYDFVFFDSPPIMGVSDASILASE-VDMTIQVIQYRRYPQPMNIRAKQLIE-KVGG--NL
A0A6I1K583      RYDFVFFDAPPIMGVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGG--RL
A0A350EWA4      RYDFVFFDSPPIMGVSDASVLASE-VDLTLQVIQYRRYPQPMTIRAKQMIE-KVGG--NL
A0A832D3W5      RYDYVFFDSPPIIGVSDAAILASE-VDMTIQVIQYRRYPQPMYLRAKQIIE-KVGG--NL
A0A7V2G542      RFDIVFFDSPPILGVSDASVLASE-VDLTIIVIQHRRFPRSMLQRVKQAVQ-NVGG--TV
A0A7C4KPD7      RYDFVFFDSPPIMGISDASILASE-VDMTLQIIQYRRYPQPMTIRAKQMIE-KVGG--NL
A0A832MGU4      RYDYVFFDSPPIMGVSDASVLARA-VDYALQVVQYRRYPQPMTLRAKQMIE-KVGG--NL
A0A1M6RLZ4      RFDLVLIDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRKMLVRVKQAVE-NVGG--TV
A0A832M6Y9      HYDVILFDAPPILGISDAAVIVHE-VDTTLLAIQHRRYPRNISWRAKKVVE-EVGG--RF
A0A832HP42      RYDFVFFDSPPIMGVSDASIIASL-VDLSILVVQYRKYPQAMTLRAKQMVE-KVGG--TM
A0A354T7G8      RFDLVLIDSPPILGVSDASVLANE-ADMTMIVVQHRKLPRHMLMRVKQSVE-NAGG--KV
A0A512MBZ2      RFDLVLIDSPPILGVSDASVLSNE-ADMTMLVVQHRKLPRHMLMRVKQTVE-NVGG--RV
A0A2E8MEZ0      RFDLVLVDSPPILGVSDAAVLASE-VDLTMVVVQHRKLPRNMLLRVKQAVE-NVGG--QV
A0A7Y2T9S5      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLIRVKQAVE-NVGG--HV
A0A851GRQ2      RFDLVLVDSPPILGVSDASVLSSE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--HV
A0A6B3LBV6      RFDLVLVDSPPILGVSDASVLCSE-VDMTVVVIQHRKLPRNMLQRVKKAVE-SVGG--TL
A0A840UX61      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLQRVKSTVE-GVGG--HV
A0A4Q2YKS3      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLIRVKQAVE-NVGG--HV
A0A6N6P3T8      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLQRVKQAVE-NVGG--TI
A0A8A7W668      RFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--HV
A0A2E3EC33      RFDLVLVDSPPILGVSDASVLASE-VDLTIIVIQHRKLPRGMLIRVKQAIE-NVGG--KA
A0A2E4GN01      RFDLVLVDSPPILGVSDASVLASE-VDLTIIVIQHRKLPRGMLIRVKQAIE-NVGG--KA
A0A800JJX7      RFDLVLVDSPPILGVSDASVLASE-VDLTIIVIQHRKLPRGMLIRVKQAIE-NVGG--KA
A0A1Z8XU55      RFDLVFIDSPPILGVSDASVLSSE-VDLTIIVIQHRKLPRGMLVRVKQAIQ-NVGG--TA
A0A2E1RQR9      RFDLVFIDSPPILGVSDASVLSSE-VDLTIIVIQHRKLPRGMLVRVKQAIQ-NVGG--TA
A0A2E3ISQ4      RFDLVFIDSPPILGVSDASVISSE-VDLTIIVIQHRKLPRGMLLRVKQAIQ-NVGG--TA
A0A2D6W6F4      RFDLVFIDSPPILGVSXASVISSE-VXLTIIVIQHRKLPRGMLLRVKQAIQ-NVGG--TA
A0A2D8Z5A8      RFDLVFIDSPPILGVSDASVISSE-VDLTIIVIQHRKLPRGMLLRVKQAIQ-NVGG--TA
                 :  :..*  *                                                 

A0A2A2XVF1      AGFVLNRLP-----TGRAAGYYYYYYGDKYEKDSVYGTKT--------------------
A0A2V5UHJ2      LGMLLNRIN-----IHNNEYG---GY---YQ--QYY----EYYSQDPPAITDNAPALSEN
A0A2V5PST3      LGVILNGIN-----LEDPDYA---YYRHYYG--SDY------------------------
A0A2V5PXM3      AGVILNLIP------RSGGGY---GY---YYYDSYY--AYGYY-----------------
A0A1V5QB01      LGCVLNNLD-----FSRVGYY---YYSTYY---GYYDYDHIRE-----------------
A0A800JGC6      VGIVANAMPEMKKSSGYYGYYGNYYYGNYAY--SYYGSGSYYG-----------------
A0A7Y2T8X5      VGAVLNAMK-----TKHTGGG---YY--GYRDYGEYGGSYGYY-----------------
A0A1J4XH17      FGAVINQIS-----LDIVNYYYSNYYDKTYY--DYY------------------------
A0A7C5LI63      FGFILNNLE-----PGRVGYY---HYYPYYY--SYY--SRGYY-----------------
A0A7C5P291      FGFVLNNLE-----PGRVGYY---HYYPYYY--SYY--SHGYY-----------------
A0A290QGD9      FGAVLNGLN-----MNVSGYYYGQYTDKSYK--DYY------------------------
A0A1D8AS58      FGAVLNGLN-----LAVSGYYYAQYYDKSYK--DYY------------------------
I6AQC1          YGAVLNGLN-----LAVAGYYYAQYYDKSYK--DYY------------------------
W0ITH7          YGAVLNGLN-----LAVAGYYYAQYYDKSYK--DYY------------------------
A0A139SU05      LGVVLNGLT-----PRRVEYYSNYRY---YRSYGKY------------------------
A0A139SPN4      LGVILNGLA-----PRRVEYYSNYRYYRSYG--KYT------------------------
A0A1V6E7N1      LGIVLNGLS-----PRRIKYYSNYRYYRSYK--KYY------------------------
A0A2D9MYT1      VGVCINDLD-----FEGKDSY---YYSYYYYQNRYY---------------------ASH
A0A258ANJ7      TGLVLNRLT---------------QRTRSFD--QYY--HRSYY-----------------
A0A1Z8ZMT6      SGVILNDFT--------ENRLQGGKYGYGYGYGQYG------------------------
A0A2E8MCT7      SGVILNDFT--------ENRLQGGKYGYGYGYGHYG------------------------
A0A139TLN4      MGIVLCDVE-----NRSRPSR---KY-------AMY------------------------
A0A1G3ZFT0      HGSIFNFHN----ATSKKSSY---QY---YSSHYYY---------------------EDE
A0A5B5WI95      LAYIINAVD-----FKSSSYS---YYGYNYGYRYSY------------------------
A0A2N8I9W1      MAYIINGVN-----FKSSSYS---YYGYGYGYQYGY------------------------
A0A4Q5IH27      MAYIINGVN-----FKSSSYS---YYGYGYGYQYGY------------------------
A0A2N8IBZ6      MAYIINGVN-----FKSSSYS---YYGYGYGYQYGY------------------------
A0A7G6DX28      MAYIINGVN-----FKSSSYS---YYGYGYGYQYGY------------------------
R6J100          MAYIINGVN-----FKSSSYS---YYGYGYGYQYGY------------------------
A0A139TV24      MGFVINAVD-----FKAAGHH---YYGYGYHYNYGY------------------------
A0A2N8HT11      MGFVINAVD-----FKSSSYS---YYGYGYHYGNTS------------------------
R7DS70          MGFVINAVD-----FKSSSYS---YYGYGYHYGNTS------------------------
A0A2N8HNL6      MGFVINAVD-----FKSSSYS---YYGYGYHYGNTS------------------------
A0A290Q2Z2      VGVVLNRVP-----VNSSDDY---GY---YT--RNY----AYY------------SAREN
A0A2A2RGK2      AGLILNFLP-----SGRGGYY---AY---YYSGKYY---GSYG-----------------
A0A2A2XXF7      AGLILNFLP-----SGRGGYY---AY---YYSGKYY---GSYG-----------------
A0A146GCJ0      AGFIFNRLP-----VGGRSAG---YYYYYYG--GEYSKNSVYG-----------------
A0A2T6D6H8      GGFVFNRLP-----VGGQSAG---YYYYYYG--GDYAKNGVYG-----------------
A0A6B3L938      AGVVVNALR-----VKHTGGS---GYYGYHGYGEYG--HEGYY-----------------
A0A2A2R5D6      LGVVLNAVA-----VKSDEAY---YY---YSSYGNY-----YY-----------------
A0A2V5URB2      LGVVLNRVD-----VRSAEYR---DYYRYYNPEFYY------------------------
A0A2V2DJ66      LGAVMNMVN-----TGAVSGYSINYYDKNYQ--NYY------------------------
R7L5A9          LGAVMNMVN-----PSSASVYSMNYYDKSYQ--NYY------------------------
A0A5B5WU87      MGIVLCDVE-----NHSRSSR---KY-------AMY------------------------
R7DZW0          MGIVLCDVE-----PHGRSSR---GY-------AVY------------------------
A0A2N8HID1      MGIVLCDVE-----PHGRSSR---GY-------AVY------------------------
A0A2N8HS06      MGIVLCDVE-----PHGRSSR---GY-------AVY------------------------
A0A6N2TNT9      MGIVLCDVE-----PHGRSSR---GY-------AVY------------------------
A0A4P5QM05      IGVVLNNVD-----IHQDDSY---RYYSNYK--DYY------------------------
A0A4Q3C001      IGVVLNNVD-----TRHDEGY---SYYNNYN--DYY------------------------
B4DB23          IGVVLNNVD-----AKHDDGY---SYYYNYN--EYY------------------------
A0A5R8KA81      SGIILNMLP-----ARRNSGL---YY-------HYY--SGSYG-----------------
A0A2E6T482      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY--------------KSR
A0A3C0DQZ7      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY--------------KSR
A0A1Z9CBK5      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY--------------KSR
A0A2D6ZI96      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY--------------KSR
A0A358KGZ3      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY--------------KSR
A0A2E9ZQX4      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--XDYYX--------------KSR
A0A3D5JZU0      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY--------------KSR
A0A2E6HCR0      AGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY--------------KSR
A0A1Z8WN04      IGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDNYY--------------KSR
A0A2D7L1N4      IGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDNYY--------------KSR
A0A2E2R937      IGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDNYY--------------KSR
A0A520QQY4      IGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDNYY--------------KSR
A0A2D5MR66      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDNYY--------------KSR
A0A2E0PDQ1      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDNYY--------------KTR
A0A2E2ZZP9      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDNYY--------------KSR
A0A4P5YMI6      MGAVLNNIN-----IAQDSYY---YY---YS--GYQ--YT-------------------S
A0A7C4LRK7      MGIVLNNIN-----MSQDSYY---YY---YS--GYF--EESYY--------------QQD
A0A3C1VJ32      VGMVLNNIN-----MSQDEGY---YY---YS--GYY--HDYYY--------------SRD
A0A7W1VTI1      MGIVLNNIN-----VSQDESY---YY---YY--SGY--QEYSK--------------QSN
A0A7V4IGZ6      VGIVLNNIN-----MSQDESY---YY---YS--GYY--HDYYY--------------AKS
A0A2N9NTX7      IGIVLNNIN-----MSQDESY---YY---YS--GYY--HDYYS--------------RNE
B9XK55          IGIVLNNIN-----MSQDESY---YY---YS--GYY--HDYYS--------------KNE
A0A2A2RGF2      IGVVLNNIN-----LASDASY---YY---YS--GYN-----YH--------------SNN
A0A2G4I5Y6      IGVVLNNIN-----LASDASY---YY---YS--GYN-----YR--------------SNN
A0A6N6PS97      IGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------SKH
A0A3M1I883      LGIVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY--------------GSS
A0A1V6JZ45      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------SKG
A0A848A4B3      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------SKG
A0A7C7Z746      LGVVLNNIN-----ISQDENY---YY---YS--GYY--YDYYY--------------SRR
A0A520RRW5      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------SKQ
A0A356NPK0      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------SKQ
A0A2D7B5P5      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------SKQ
A0A3D3XGB5      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------SKQ
A0A2V6F8A1      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------SKR
A0A2V5TNH4      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------AKR
A0A2V5X5Q6      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YD-YY--------------AKR
A0A3R5R2M8      LAFIINGVN-----FKSASYN---YYGYGYG--YGYGTGSRSR-----------------
A0A411SUQ6      MAYIINGVN-----FKSASYS---YYGYGYG--YQYGYGTK-------------------
A0A2N8HZF2      MAYIINGVN-----FKSASYS---Y--YGYG--YQYGYGTK-------------------
A0A354E720      MAYIINGVN-----FKSASYS---YYGYGYG--YQYGYGAK-------------------
A0A7T8XNA1      MAYIINGVN-----FKSASYS---YYGYGYG--YQYGYGTK-------------------
B2UPB6          MAYIINGVN-----FKSASYS---YYGYGYG--YQYGYGTK-------------------
A0A1Q6UHJ9      VGAIMNMVS-------QGSAA---GYSLNYYDKSYQ----NYY-----------------
A0A2V2BXR0      VGAIMNMVS-------QGSAA---GYSLNYYDKSYQ----NYY-----------------
A0A3C1HEJ2      AGFILNGIT-----LLHRSDY---YD---YS--DYY----ARY--------------REK
A0A522ULD9      LGVVLNNIN-----IMRDDYY---YY---YH--SYY--ADYYY-----------------
A0A7W1RNH4      FGTILNDIE-PKSYSSYDGAY---RY---YGVPALKAYGEQYA-----------------
A0A2D8V0G3      LGTVINDID-----FEGKDSY---YYSYYYYQNRYY---ASYY-----------------
A0A348S017      LGTVINDID-----FEGKDSY---YYSYYYYQNRYY---ASYY-----------------
A0A3C1UUV7      LGTVINDID-----FEGKDSY---YYSYYYYQNRYY---ASYY-----------------
A0A350I3V2      LGTVINDID-----FEGKDSY---YYSYYYYQNRYY---ASYY-----------------
A0A520RGV5      LGTVINDID-----FEGKDSY---YYSYYYYQNRYY---ASYY-----------------
A0A3D3XF90      LGTVINDID-----FEGKDSY---YYSYYYYQNRYY---ASYY-----------------
A0A2D7B522      LGTVINDID-----FEGKDSY---YYSYYYYQNRYY---ASYY-----------------
A0A356NIC2      LGTVINDID-----FEGKDSY---YYSYYYYQNRYY---ASYY-----------------
A0A832MDW4      CGVVLNDID-----FEGRDSY---YYSYYYYQNRYY---SSYY-----------------
A0A1V6JU76      CGVVLNDID-----FEGRDSY---YYSYTYYQNRYY---SSYH-----------------
A0A848ABG7      CGVVLNDID-----FEGRDSY---YYSYTYYQNRYY---SSYH-----------------
A0A2A2XXW5      VGLVLNDID-----FEGKDSY---YYSYHYYQNQYY---SSHY-----------------
A0A6N6Q6V0      IGLVLNDID-----FEGKDSY---YYSYHYYQNRYY---SSHY-----------------
A0A2V6JLK8      LGVVLNNVD-----LKHDQNY---YY---YT--NYY----GYY-----------------
A0A2W5Z1A5      LGVVLNNVD-----LRHDQNY---YY---YT--NYY----GYY-----------------
A0A2V6EA09      LGVVLNDVD-----LKHDQNY---YY---YT--HYY----AYY-----------------
A0A2V6GQI7      LGVVLNDVD-----LKHDQNY---YY---YT--HYY----AYY-----------------
A0A7W1U7K0      LGVVLNNVD-----LKHDQNY---YY---YT--SYY----SYY-----------------
A0A7W0YDK6      LGVVLNNVD-----LKHDQNY---YY---YT--SYN----TYY-----------------
A0A7V9EPY1      LGVVLNNVD-----LKHDQNY---YY---YT--SYY----GYY-----------------
A0A838TCM2      LGVVLNNVD-----LKHDQNY---YY---YT--SYY----GYY-----------------
A0A2N8HDG3      LGFIINAVD-----FKAGSYS---YYGYGYHYGNTS--KNAHS-----------------
A0A3E1ET42      LGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------SPTN
A0A2A2YDW8      LGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APAE
A0A352XLN9      LGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APAE
A0A3D0YP62      IGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY-------------APTT
A0A3D3DV47      IGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY-------------APTT
A0A7Y1UNY2      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APST
A0A2E5XJ49      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A2E6SBY8      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APTA
A0A2E5QMS4      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSS
A0A2E7YXQ3      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSS
A0A2E3H787      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A2E7AGN1      VGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A2E7AKY7      VGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A3D4CU34      VGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A2E8M146      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A355S8S2      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A2D6DVN8      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A3C1W2R2      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A2E3NAY6      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A2E3II01      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A368B8C5      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A3R7RBB5      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APSA
A0A2A2QX62      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APAE
A0A4Q3BWH6      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APAE
A0A858RHU7      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APAE
A0A7V7VLV5      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APAE
A0A3N5WCF1      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APAE
A0A4Q3C1K5      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY-------------APAE
A0A3D1TI55      VGVVLNNIN-----VMRDDYY---YY---YH--TYY---SHYY-----------------
A0A3R8IT45      FGAVLNGLN------LAVAGY---YYAQYYD--KSY---KDYYVMAGAEDAIDNSASNEE
A0A2A2PYE8      FGAVLNGLN------LAVSGY---YYAQYYD--KSY---KDYYVVMSKNDTEQEK-----
A0A2T6CN73      FGAVLNGLN------LVVSGY---YYAQYYD--KSY---KDYYVV-SKGDTEQER-----
A0A2G4G428      LGAVLNRMS-----MRMASVY---TDSFDASYEKYY------------------------
A0A6N6PCD8      AGFILNRLP------SRLAGY---YY---YDAGNYSSAGVYGI-----------------
A0A139TUL1      VALILNAEN-----FKNSRFH---YY-------SEYSGSETAG-----------------
A0A2N8HCB0      VALILNAEN-----FKNSRFH---YY-------SEY--SETDG-----------------
A0A2N8HP04      GAVILNAEN-----FKNSRFH---YY-------DEY--SETDG-----------------
A0A2N8HRJ0      GAVILNAEN-----FKNSRFH---YY-------DEY--SETDG-----------------
A0A6N2U9Y7      GAVILNAEN-----FKNSRFH---YY-------DEY--SETDG-----------------
A0A6N6PAZ1      SGIIFNGFVEKRSLMGENYSY---GY---YKTSRYG--RAYRY------GYDAAYGAYGS
A0A7V7VK26      SGIIFNGFIEKRRLMSDNYSY---GY---YKTSRYG--RAYRY------GY-GAYGAYGS
A0A6I1K459      SGVVLNFLP-----QSAGSGY---YY-------YYS--GNKYY--------------GKK
D5ENH7          FGAILNNIT------TSLSSY---YYSQYSD--KAY--QDYYI-----------------
A0A0R2XQ77      FGAILNNIS------STLASY---YYSSYSD--KAY--QDYYI-----------------
A0A2E9IN28      FGAILNNIT------SSLSSY---YYSNYSD--KAY--QDYYI-----------------
A0A6N4WTJ5      FGAILNNIT------SSLSNY---YYSSYSD--KAY--QDYYI-----------------
A0A366HAG0      AGAVLNNVN-----INSDATY---GY---YT--SYY----GYY----------------S
A0A2U8DZK4      LGVVLNRVP-----KNAGADY---AY---YS--KNY----AYY---------------GS
A0A2T6DFL8      LGIVLNQIP-----GNAGGDY---GY---YT--SNY----AYY---------------HE
A0A1D8AWD4      IGVVLNQVP-----TGTGEDY---SY---YT--NNY----SYY---------------S-
A0A4Q1C9S2      IGVVLNQVP-----TGSGEDY---GY---YT--NNY----SYY---------------S-
A0A178IH18      LGIVLNRVP-----KNAGDDY---GY---YT--NNY----AYY---------------SS
A0A2T6DT99      VGIVLNRVP-----RNSGEDY---GY---YT--HNY----AYY---------------SS
A0A1G3ZT33      VGVVLNQVP-----HGSGDDY---GY---YT--GNY----DYY---------------SE
A0A3E1E2T2      LGVVLNQVP-----LNSGDDY---GY---YT--NNY----SYY---------------SE
B1ZMW1          LGVVLTQVP-----ENAGGDY---GY---YT--HNY----SYY---------------SD
A0A3M1I8A3      CGVLLNDID-----FEGRDSY---YYSYYFYQNRYY--SSYRS--------------RPD
A0A4V0XS84      FGTVVNDID--------------------YSNSQYY--YSEYY------SNQIASPEFGE
A0A351WE84      LGVVLNNIN-----IMRDDYY---YY---YH--ASY---------------------TQY
A0A7W1MRT6      IGAVLNDPD---HKVPDYGSY---YY---YY--DYH--DTKVEA----------------
A0A7W1YXK2      IAVVLNALP-----AHSRDSY---YY---YS--ADY--ARR-------------------
A0A2D5WGA5      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY-----------------
A0A2E7SSH2      VGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYY-----------------
A0A832HNU4      LGVVMNNID-----LQKRGYY---YY--PYS--SSH--YNRYY-----------------
A0A1V5QDZ6      LGVVLNNIN-----IMRDDYY---YY---YH--SYY--SQYYQ--------------SDE
A0A4Y8P964      LGVVLNKTD-----GSYQSYY---SY---YA----------YK--------------AKD
A0A3D4HF88      FGVIMNQIT------AAMSSY---YYTNYYE--KSY--DKYYT-----------------
A0A1V6J089      LGAVLNNIN-----IMRDDYY---YY---YH---YT--TRKYY-----------------
A0A3C1BZR1      MGAVLNNIN-----IMRDDYY---YY---YH---YA--TKKYY-----------------
A0A848WTQ6      IGVVMNNVD-----VRSDSQY---SY---YT--SYY----SYY------ATPNGPTVPNP
A0A6N6ZHN8      FGAILNNIN-----TNVAGYY---YSHYYYD--KSY--KNYYM-----------------
A0A6G6K641      AGIVLNRMP-----AAAAGQY---YY---YS-----------------------------
A0A849Y642      LGAVLNQVK------SEEEDY---YY---YNYYYYY--GEGKY------GYGGGKQPGPT
A0A7C4KLL2      CGVVLNLVP-----LRRGGGY---YYDSYYY---YH--TDSYH-------------KEKN
A0A1H6KPB7      MGVVMNNVD-----ISGDTQY---QY---YT--TYY----SYY------------SPTEG
A0A2E9ISN4      LGFCVNGVNESYLRSNGYDAY---GS---YG--TRH--IESAF-----------------
B9XAX1          TGIVLNFLP-----QHSGYRY---YY--HYTPRNGY--KSIGV--------------YGN
A0A5R8KKM9      VGVVLNNVD-----IHSDNTY---GY---YT--SYY----TYY--------------NSD
A0A7W8DJ38      TGLVLNRLA------HRARTY---DY--------YY--HRSYY--------------KAN
A0A7W1ZQ43      SGIVLNYLP------ERSGNY---YY---YAPKDAY--GNGTY-----------------
A0A139TS01      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SAESGASGGNA
A0A3E1EJT7      FGAVMNGMN-----TGITGDY---YM---ENNSKLF--KEYYN---------------PG
A0A848WYP9      AGCILNGST-----EQSAIKA---QY---YE--DYR----------PAPAPPVAALPMNS
A0A7C3I5X9      CGVVINDID-----FEGRDAY---YYSYYYYQNRYY--KGYYQ-----------------
A0A349GXM8      LGLVMNSIE-----MHKISSL---YYAYQYPNYAYY--SNAYA--------------YGY
A0A7V3QFN7      VGIVLNNIN-----IAQDESY---YY---YS--GYY--HDYYY--------------YYS
A0A4P5YP61      AGLILNRLP-----RRVGLGG---YY---YD--SYY--NYSYY--------------GKY
A0A6B2LYM4      FGAVLNNLN-------THVAG---YY---YS--HYY--DKSYK-----------------
A0A6D1VXB3      LGVVLNKTT-----TSYQSYY---SY---YA----------YK--------------EKN
I0JYY7          LGVVLNKTT-----TSYQSYY---SY---YA----------YK--------------EKN
A0A4Y8P842      LGIILNKAD-----PVSSSYY---YS---YS----Y----KYR-----------------
B3DZK9          LGIILNRAD-----PLSHSSY---Y----YA----Y----KYR-----------------
A0A4R7S1J2      SGLILNNVP-----EGSRGYY---YH---YS-PGYY--GSKGV-----------------
A0A2A2XV69      LGVVLNNVD-----IRHDQSY---GY---YT--SYY----NYY--------------SPS
A0A651H7X9      FGAILNGLN-----LSLAG-----YY---YA--QYY--DKSYK-----------------
A0A5E6MPC4      LGIVLNRVQ-----QANRSYY---AY---HY--AYR--LSEEQ-----------------
A0A840V0I7      SGAIFNGFSEKRRLIGENYSY---GY---YKYGKYG--STGSY-GYGSYGGYGAYGSDDD
A0A146G2Q9      LGVVLNNVD-----VRHDQHY---QY---YT--SYY--NYYYQ--------------KPQ
A0A2T6D3Y2      LGVVLNNVD-----VRHDQHY---QY---YT--SYY--NYYYQ--------------KPQ
A0A6N6PKP9      AGFVLNALP-----IRNGGYY---YH---YQAPGYG--SDEVY-----------------
A0A6N6Z250      RGVIFNQVP-----ARQQGAY---GY---YG--YGY--RRENT--------------GPA
A0A4V1SB02      AGVIMNRMP-----ARRGASY---YY---Y----YY--GDPYV------KDGVYGSSVNP
A0A6N6QEJ2      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYS--------------KSE
A0A3C1VB86      GGVVLNLLP-----KRRLSGY---YY-------SYH--HGYGY-----------------
A0A6N6P5E3      IGCILNNTD-----TRSDEYY---EY---YT--SYY----SYY--------------QPK
A0A838I246      LGVVLNNVD-----LKHDQNY---YY---YT--NYY----GYY--------------TPR
A0A6J4HTK1      LGVVLNNVD-----LKHDQNY---YY---YT--NYY----GYY--------------QPR
A0A838FVV7      LGVVLNNVD-----LKHDQNY---YY---YT--NYY----GYY--------------QPR
A0A7C3HWX0      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYS--------------KSS
A0A7V4LSC4      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYS--------------KTA
A0A2D5VY59      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYS--------------KQD
A0A2D8UZZ4      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYS--------------KQD
A0A353DV86      LGVVLNNIN-----ISQDSYY---YY---YS--GYY--YDYYS--------------KQD
A0A2E5EPT8      LGIVLNNIN-----VSSDASY---YY---YS--GYH-----YH--------------DNP
A0A5B5WZ91      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SAESGASDGNA
A0A2N8HD92      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGGSSGGNV
A0A2N8HIT2      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGGSSGENA
A0A354EBD3      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------STDGSSSGENA
A0A355VEB2      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------STDGSSSGENA
R6K1U5          AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGSSSGENA
A0A2N8IWC2      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGSSSGENA
A0A2N8I441      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGSSSGENA
A0A2N8I3A6      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGSSSGENA
A0A410SCC4      VGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGSSSGENA
A0A3R5VEW0      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGASSGENA
A0A7T9B0I0      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGASSGENA
B2UKW3          AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGASSGENA
A0A411SSG2      AGVVMNNVD-----ITSDHQY---QY---YT--TYY----SYY------SADGASSGENA
A0A6M1RXR2      VGIVLNNIN-----LSQDESY---YY---YS--GYY--HDYYY--------------RSD
A0A7C3DXS4      IGIVLNNIN-----LSQDESY---YY---YS--GYY--HDYYY--------------RSE
A0A7V6YXH8      LGIVLNNIN-----MSQDESY---YY---YS--GYY--HEYYS--------------KNE
A0A2V2SDV4      VGIVLNNIN-----MSQDENY---YY---YS--GYY--HEEGT--------------NDE
A0A6N6PHJ5      VGIVLNNIN-----MSQDESY---YY---YS--GYY--QDYYA--------------KNE
A0A7Y4QKN3      VGIVLNNIN-----MSQDESY---YY---YS--GYY--HDYYA--------------QSE
A0A2V5PK75      VGIVLNNIN-----MSQDESY---YY---YS--GYY--HDYYS--------------VNE
A0A1V6DME1      IGIVLNNIN-----MSQDESY---YY---YS--GYY--HDYYY--------------RSS
A0A3D3DIJ3      VGIVLNNIN-----MSQDESY---YY---YS--GYY--HDYYY--------------RSE
A0A7X7VJR5      VGIVLNNIN-----MSQDESY---YY---YS--GYY--HDYYY--------------RSE
A0A6I1K583      IGVVLNNIN-----LASDASY---YY---YS--GYH-----YH------SN------NNA
A0A350EWA4      LGVVLNNIN-----MAQDENY---YY---YS--GYY--YDYYS--------------KQN
A0A832D3W5      VGIVLNNIN-----IAQDESY---YY---YS--GYY--HDYYY--------------YYS
A0A7V2G542      LGVVLNNVD-----TKHDQGY---EY---YT--SYY----NYY----YSSPKTRKS----
A0A7C4KPD7      MGIVLNNIN-----MSSDSYY---YY---YS--GYF--EESYY-------------KDSD
A0A832MGU4      AGIVLNNIN-----MSQDSYY---YY---YS--GYF----EES--------------HYG
A0A1M6RLZ4      LGVVLNNVD-----VKSDSQY---QY---YT--SYY----TYY------APSEAPQ----
A0A832M6Y9      GGVILNKVQ-----LRSDDSY---YY---YT--SYY----GYYGYYKSGSKGDTQKKARE
A0A832HP42      LGVVLNNIN-----ISQDSYY---YY---YS--GYY----YDY------YS------KYD
A0A354T7G8      VGVVLNNVD-----LRSDAQY---QY---YT--SYY----TYY------APTNSPTGGAG
A0A512MBZ2      LGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY------SPNNQAA-APG
A0A2E8MEZ0      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY------AP--SSL-EET
A0A7Y2T9S5      IGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------AP------TTG
A0A851GRQ2      IGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------AP-------SG
A0A6B3LBV6      LGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY------AS------GDD
A0A840UX61      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY------AP---SD-SPQ
A0A4Q2YKS3      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY------APAEGQV-GPP
A0A6N6P3T8      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY------APAESQI-GPP
A0A8A7W668      IGVVLNNVD-----VRSDSQY---QY---YT--SYY----TYY------APAESQI-GPA
A0A2E3EC33      LGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------SP--SNI-DPN
A0A2E4GN01      LGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------SP--SNM-DPN
A0A800JJX7      LGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------SP--SNI-DPN
A0A1Z8XU55      LGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------AP--RNL-DPN
A0A2E1RQR9      LGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------AP--RNL-DPN
A0A2E3ISQ4      LGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------AP--RNL-DPN
A0A2D6W6F4      LGVVLNNVD-----VRSDNXY---QY---YT--SYY----TYY------AP--RNL-DPD
A0A2D8Z5A8      LGVVLNNVD-----VRSDNQY---QY---YT--SYY----TYY------AP--RNL-DPD
                 .                                                          

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      GHGRLSRRSRLNGSFPVTLKPVASEKSSNGVSTGALDVVRAKLGEAMGPMASLVLRDSIR
A0A2V5PST3      -----GTVA---------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A800JGC6      ------------------------------------------------------------
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      NNGELPEKK---------------------------------------------------
A0A7C5LI63      ---YAHKEE---------------------------------------------------
A0A7C5P291      ---YARSEE---------------------------------------------------
A0A290QGD9      ----VVMSK---------------------------------------------------
A0A1D8AS58      ----VTMAK---------------------------------------------------
I6AQC1          ----VMTES---------------------------------------------------
W0ITH7          ----VMTES---------------------------------------------------
A0A139SU05      ---TERVDR---------------------------------------------------
A0A139SPN4      -NVEPARGE---------------------------------------------------
A0A1V6E7N1      -GTHG-------------------------------------------------------
A0A2D9MYT1      YKSDKPXEE---------------------------------------------------
A0A258ANJ7      -----KGSE---------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      SDHPKKKRR---------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A290Q2Z2      RSSERRDKR---------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      ----NRNGE---------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      -MTPPEIEN---------------------------------------------------
R7L5A9          -TAPMESDE---------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A4P5QM05      --GPKRDTP---------------------------------------------------
A0A4Q3C001      --APRTESP---------------------------------------------------
B4DB23          --GPRRGTP---------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A2E6T482      EK----EEE---------------------------------------------------
A0A3C0DQZ7      EK----EEE---------------------------------------------------
A0A1Z9CBK5      EG----EED---------------------------------------------------
A0A2D6ZI96      EG----EED---------------------------------------------------
A0A358KGZ3      ET----EDE---------------------------------------------------
A0A2E9ZQX4      ET----EEE---------------------------------------------------
A0A3D5JZU0      ET----EEE---------------------------------------------------
A0A2E6HCR0      EN----EEE---------------------------------------------------
A0A1Z8WN04      ED----EEG---------------------------------------------------
A0A2D7L1N4      ED----EEG---------------------------------------------------
A0A2E2R937      ED----EEG---------------------------------------------------
A0A520QQY4      ED----EEG---------------------------------------------------
A0A2D5MR66      EN----EEE---------------------------------------------------
A0A2E0PDQ1      EN----EEE---------------------------------------------------
A0A2E2ZZP9      EN----EEE---------------------------------------------------
A0A4P5YMI6      EN----QPE---------------------------------------------------
A0A7C4LRK7      GE----KKS---------------------------------------------------
A0A3C1VJ32      PS----EQE---------------------------------------------------
A0A7W1VTI1      AD----DV----------------------------------------------------
A0A7V4IGZ6      ED----AEE---------------------------------------------------
A0A2N9NTX7      DQ----EKG---------------------------------------------------
B9XK55          DE----SE----------------------------------------------------
A0A2A2RGF2      NA----DEP---------------------------------------------------
A0A2G4I5Y6      ND----DES---------------------------------------------------
A0A6N6PS97      DD----GDK---------------------------------------------------
A0A3M1I883      SEYGRRRRK---------------------------------------------------
A0A1V6JZ45      EY----GES---------------------------------------------------
A0A848A4B3      EY----GES---------------------------------------------------
A0A7C7Z746      DD----DDS---------------------------------------------------
A0A520RRW5      DG----DNT---------------------------------------------------
A0A356NPK0      DG----DNT---------------------------------------------------
A0A2D7B5P5      DG----DNT---------------------------------------------------
A0A3D3XGB5      DG----DNT---------------------------------------------------
A0A2V6F8A1      EE----EP----------------------------------------------------
A0A2V5TNH4      EE----EPP---------------------------------------------------
A0A2V5X5Q6      EE----EPA---------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
A0A7T8XNA1      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A1Q6UHJ9      ---TMPDVE---------------------------------------------------
A0A2V2BXR0      ---TMPDVE---------------------------------------------------
A0A3C1HEJ2      DHSPAAPAP---------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A7W1RNH4      ------------------------------------------------------------
A0A2D8V0G3      ---SNEKKL---------------------------------------------------
A0A348S017      ---SNEKKL---------------------------------------------------
A0A3C1UUV7      ---SNEKKL---------------------------------------------------
A0A350I3V2      ---SNEKKL---------------------------------------------------
A0A520RGV5      ---SNEKKL---------------------------------------------------
A0A3D3XF90      ---SNEKKL---------------------------------------------------
A0A2D7B522      ---SNEKKL---------------------------------------------------
A0A356NIC2      ---SNEKKL---------------------------------------------------
A0A832MDW4      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A848ABG7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A2V6JLK8      ----QPRDK---------------------------------------------------
A0A2W5Z1A5      ----QPQDR---------------------------------------------------
A0A2V6EA09      ----QPRGK---------------------------------------------------
A0A2V6GQI7      ----QPRGK---------------------------------------------------
A0A7W1U7K0      ----QPRQD---------------------------------------------------
A0A7W0YDK6      ----PTDRG---------------------------------------------------
A0A7V9EPY1      ----TTPGA---------------------------------------------------
A0A838TCM2      ----PTPGS---------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A3E1ET42      AEARKPRQA---------------------------------------------------
A0A2A2YDW8      SELPQPQPS---------------------------------------------------
A0A352XLN9      SELPQPQPS---------------------------------------------------
A0A3D0YP62      --------G---------------------------------------------------
A0A3D3DV47      --------G---------------------------------------------------
A0A7Y1UNY2      DVAPTPTAA---------------------------------------------------
A0A2E5XJ49      DPDPVA--G---------------------------------------------------
A0A2E6SBY8      DADPVP--X---------------------------------------------------
A0A2E5QMS4      DVDPISSPP---------------------------------------------------
A0A2E7YXQ3      DVDPISSPP---------------------------------------------------
A0A2E3H787      DADPVPGAG---------------------------------------------------
A0A2E7AGN1      DADPVPGGG---------------------------------------------------
A0A2E7AKY7      DADPVPGGG---------------------------------------------------
A0A3D4CU34      DADPVPGGG---------------------------------------------------
A0A2E8M146      DSDPVPTVG---------------------------------------------------
A0A355S8S2      DSDPVPTVG---------------------------------------------------
A0A2D6DVN8      DSDPVPSVG---------------------------------------------------
A0A3C1W2R2      DSDPVPSVG---------------------------------------------------
A0A2E3NAY6      DSDPVPTGG---------------------------------------------------
A0A2E3II01      DSDPVPTVG---------------------------------------------------
A0A368B8C5      DSDPVPTVG---------------------------------------------------
A0A3R7RBB5      DSDPVPTVG---------------------------------------------------
A0A2A2QX62      SQ-SLPSQG---------------------------------------------------
A0A4Q3BWH6      SQ-PMPTQS---------------------------------------------------
A0A858RHU7      SQAPAPSSS---------------------------------------------------
A0A7V7VLV5      SQIGQPTQT---------------------------------------------------
A0A3N5WCF1      AQVVAP--P---------------------------------------------------
A0A4Q3C1K5      SQIGPPVSS---------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      EDVVAPGSK---------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A6N6PAZ1      DSEKKPRSR---------------------------------------------------
A0A7V7VK26      DSEKEPRES---------------------------------------------------
A0A6I1K459      GVYGATSSR---------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A366HAG0      GDGKGDGTM---------------------------------------------------
A0A2U8DZK4      KSARTR------------------------------------------------------
A0A2T6DFL8      GSRRTRRSA---------------------------------------------------
A0A1D8AWD4      --HEKPVPG---------------------------------------------------
A0A4Q1C9S2      --HEKP------------------------------------------------------
A0A178IH18      RDVRRRSRR---------------------------------------------------
A0A2T6DT99      HGRRRSRRS---------------------------------------------------
A0A1G3ZT33      GHKRRKSAR---------------------------------------------------
A0A3E1E2T2      GSGRRRR-----------------------------------------------------
B1ZMW1          GSHRRHRPG---------------------------------------------------
A0A3M1I8A3      QIGAVRST----------------------------------------------------
A0A4V0XS84      AKSSSVATD---------------------------------------------------
A0A351WE84      NPDGQEKVP---------------------------------------------------
A0A7W1MRT6      ------------------------------------------------------------
A0A7W1YXK2      ------------------------------------------------------------
A0A2D5WGA5      KSREKEEES---------------------------------------------------
A0A2E7SSH2      KSRETEEES---------------------------------------------------
A0A832HNU4      ------------------------------------------------------------
A0A1V5QDZ6      SKPADELAD---------------------------------------------------
A0A4Y8P964      ELQNKNETQ---------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A848WTQ6      KPAQTQPIQ---------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A849Y642      GKSAEDATP---------------------------------------------------
A0A7C4KLL2      KSGGEEQVS---------------------------------------------------
A0A1H6KPB7      VEPSAALNP---------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          DYPAKIPLN---------------------------------------------------
A0A5R8KKM9      QRGKKDRQP---------------------------------------------------
A0A7W8DJ38      DQEESAPLR---------------------------------------------------
A0A7W1ZQ43      ------------------------------------------------------------
A0A139TS01      DASSLKKAE---------------------------------------------------
A0A3E1EJT7      GEPPVTSQS---------------------------------------------------
A0A848WYP9      DPAAEEANQ---------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A349GXM8      DYYYDEKGG---------------------------------------------------
A0A7V3QFN7      RHEEEEESK---------------------------------------------------
A0A4P5YP61      GAKGVYGAK---------------------------------------------------
A0A6B2LYM4      ------SYK---------------------------------------------------
A0A6D1VXB3      EIQNKNQTQ---------------------------------------------------
I0JYY7          EIQNKNQTQ---------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      KNVPEKSGQ---------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A840V0I7      DTPRKKNRK---------------------------------------------------
A0A146G2Q9      QQKADKKPA---------------------------------------------------
A0A2T6D3Y2      QQKADKKPA---------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      SSSTTAAKP---------------------------------------------------
A0A4V1SB02      KKKRGKKAN---------------------------------------------------
A0A6N6QEJ2      DSKPDGEKK---------------------------------------------------
A0A3C1VB86      GNYGEKAAD---------------------------------------------------
A0A6N6P5E3      QFSEKPSSK---------------------------------------------------
A0A838I246      DKEARHDSR---------------------------------------------------
A0A6J4HTK1      DKETRRSSR---------------------------------------------------
A0A838FVV7      DNESKRDTR---------------------------------------------------
A0A7C3HWX0      ESEPEGK-----------------------------------------------------
A0A7V4LSC4      AAEPDEKTR---------------------------------------------------
A0A2D5VY59      DSEGGSSAQ---------------------------------------------------
A0A2D8UZZ4      DSEGGSSAQ---------------------------------------------------
A0A353DV86      DSEGGSSAQ---------------------------------------------------
A0A2E5EPT8      SSSGSLNID---------------------------------------------------
A0A5B5WZ91      DASSLKKAE---------------------------------------------------
A0A2N8HD92      DASSMKKAE---------------------------------------------------
A0A2N8HIT2      DASSMKKAE---------------------------------------------------
A0A354EBD3      EASSMKKAE---------------------------------------------------
A0A355VEB2      EASSMKKAE---------------------------------------------------
R6K1U5          DASSMKKVE---------------------------------------------------
A0A2N8IWC2      DASSMKKVE---------------------------------------------------
A0A2N8I441      DASSMKKVE---------------------------------------------------
A0A2N8I3A6      DASSMKKVE---------------------------------------------------
A0A410SCC4      DASSMKKVE---------------------------------------------------
A0A3R5VEW0      DASSMKKVE---------------------------------------------------
A0A7T9B0I0      DASSMKKVE---------------------------------------------------
B2UKW3          DASSMKKVE---------------------------------------------------
A0A411SSG2      DASSMKKVE---------------------------------------------------
A0A6M1RXR2      D---SEKSD---------------------------------------------------
A0A7C3DXS4      D---SEKIG---------------------------------------------------
A0A7V6YXH8      E---ETESA---------------------------------------------------
A0A2V2SDV4      E---QEAAP---------------------------------------------------
A0A6N6PHJ5      D---SEPLA---------------------------------------------------
A0A7Y4QKN3      E---AMETP---------------------------------------------------
A0A2V5PK75      D---QESAA---------------------------------------------------
A0A1V6DME1      ESSDKDEAA---------------------------------------------------
A0A3D3DIJ3      E---QEPVV---------------------------------------------------
A0A7X7VJR5      E---QEPVV---------------------------------------------------
A0A6I1K583      DEPGANGKP---------------------------------------------------
A0A350EWA4      DDDGDQSGR---------------------------------------------------
A0A832D3W5      RHEEEEESK---------------------------------------------------
A0A7V2G542      ------------------------------------------------------------
A0A7C4KPD7      DKSSSRRKG---------------------------------------------------
A0A832MGU4      KSGSDSTKP---------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A832M6Y9      NKRQLEKRN---------------------------------------------------
A0A832HP42      YDEYKHHDE---------------------------------------------------
A0A354T7G8      GKTRRRKVK---------------------------------------------------
A0A512MBZ2      EQPQKRRRR---------------------------------------------------
A0A2E8MEZ0      GTPQQMTAA---------------------------------------------------
A0A7Y2T9S5      DEGNTAADV---------------------------------------------------
A0A851GRQ2      DESPTEQSQ---------------------------------------------------
A0A6B3LBV6      QAAKPKKRG---------------------------------------------------
A0A840UX61      PSGGAKPKS---------------------------------------------------
A0A4Q2YKS3      VNAETAPRQ---------------------------------------------------
A0A6N6P3T8      ALGASPKPQ---------------------------------------------------
A0A8A7W668      VGITAAAAQ---------------------------------------------------
A0A2E3EC33      QKISSDKPK---------------------------------------------------
A0A2E4GN01      QKISSDKTK---------------------------------------------------
A0A800JJX7      QKISSDKPK---------------------------------------------------
A0A1Z8XU55      MNSNSDDLF---------------------------------------------------
A0A2E1RQR9      MNSNSDDLF---------------------------------------------------
A0A2E3ISQ4      MESDSIGST---------------------------------------------------
A0A2D6W6F4      MESGSIGSP---------------------------------------------------
A0A2D8Z5A8      MESGSIGSP---------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      ALGESSESFPEAKLEVLVQHVSQEILDDYQRQRFEEETLKEIKKTTEQHGAAQPDGPVKA
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A800JGC6      ------------------------------------------------------------
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A7W1VTI1      ------------------------------------------------------------
A0A7V4IGZ6      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A848A4B3      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
A0A7T8XNA1      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A7W1RNH4      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A832MDW4      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A848ABG7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A7W1U7K0      ------------------------------------------------------------
A0A7W0YDK6      ------------------------------------------------------------
A0A7V9EPY1      ------------------------------------------------------------
A0A838TCM2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A7Y1UNY2      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A858RHU7      ------------------------------------------------------------
A0A7V7VLV5      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A7V7VK26      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A7W1MRT6      ------------------------------------------------------------
A0A7W1YXK2      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A832HNU4      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A848WTQ6      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A849Y642      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A7W8DJ38      ------------------------------------------------------------
A0A7W1ZQ43      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A848WYP9      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A7V3QFN7      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A840V0I7      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A838I246      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A838FVV7      ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7V4LSC4      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A7T9B0I0      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A7V6YXH8      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A7Y4QKN3      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A7X7VJR5      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A832D3W5      ------------------------------------------------------------
A0A7V2G542      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A832MGU4      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A832M6Y9      ------------------------------------------------------------
A0A832HP42      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A7Y2T9S5      ------------------------------------------------------------
A0A851GRQ2      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A840UX61      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
A0A8A7W668      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A800JJX7      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      DSAISKKKPNGTAVDNPSLTSEPAAIQEPRDGADGATASGAASISEKTSEALPHRPSKNP
A0A2V5PST3      --------------------------------------------AAENGNGGEHTDVEVL
A0A2V5PXM3      -------------------------------------------------GKYGHGQKEKA
A0A1V5QB01      ------------------------------------------------------------
A0A800JGC6      ------------------------------------------------------EEEEQE
A0A7Y2T8X5      ------------------------------------------------------------
A0A1J4XH17      --------------------------------------------SNLDKATKLATRVKSA
A0A7C5LI63      --------------------------------------------EEARAGEIKAGEAPAA
A0A7C5P291      --------------------------------------------DKGKGGDIKGLEVPRA
A0A290QGD9      --------------------------------------------KDDTQSPLK-------
A0A1D8AS58      --------------------------------------------QDGEPDAR--------
I6AQC1          --------------------------------------------EEGEDTAEADDKVPEM
W0ITH7          --------------------------------------------EEGEDTAEADDKVPEM
A0A139SU05      --------------------------------------------PERETKRPKKVVEEAE
A0A139SPN4      --------------------------------------------LDREPARAPEAAPAAE
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      --------------------------------------------EAXQLPLQPGVKXAGK
A0A258ANJ7      --------------------------------------------TDETAPLRPASRGLHT
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A139TLN4      -----------------------------------------------------RSFDTSS
A0A1G3ZFT0      --------------------------------------------TLV-------------
A0A5B5WI95      ----------------------------------------------------GSG--REA
A0A2N8I9W1      ----------------------------------------------------GSGEPRQT
A0A4Q5IH27      ----------------------------------------------------GSGEPRQT
A0A2N8IBZ6      ----------------------------------------------------GSGEPRQT
A0A7G6DX28      ----------------------------------------------------GSGEPRQT
R6J100          ----------------------------------------------------GSGEPRQT
A0A139TV24      ----------------------------------------------------NTTNS---
A0A2N8HT11      ----------------------------------------------------KNNPS---
R7DS70          ----------------------------------------------------KNNPS---
A0A2N8HNL6      ----------------------------------------------------KNNPS---
A0A290Q2Z2      --------------------------------------------SRTEQAERAKSDERIT
A0A2A2RGK2      ----------------------------------------------------------AK
A0A2A2XXF7      ----------------------------------------------------------AK
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2A2R5D6      --------------------------------------------KKPRSGAATPQRATLA
A0A2V5URB2      -----------------------------------------------------------P
A0A2V2DJ66      --------------------------------------------QQEGRRQPPEVSHSDG
R7L5A9          --------------------------------------------DEQPPEDVPPEMPSES
A0A5B5WU87      -----------------------------------------------------RSFDTSS
R7DZW0          -----------------------------------------------------RSLDTSS
A0A2N8HID1      -----------------------------------------------------RSLDTSS
A0A2N8HS06      -----------------------------------------------------RSLDTSS
A0A6N2TNT9      -----------------------------------------------------RSLDTSS
A0A4P5QM05      --------------------------------------------E-DRKKPEVAAA----
A0A4Q3C001      --------------------------------------------K-QASGQQPRRPAAAP
B4DB23          --------------------------------------------KIEAPAPQLARP----
A0A5R8KA81      -------------------------------------------------------KPVYG
A0A2E6T482      --------------------------------------------NADKSEDG--AKEGKL
A0A3C0DQZ7      --------------------------------------------NADKSEDG--AKEGKL
A0A1Z9CBK5      --------------------------------------------AGEEKKAD---KDQKL
A0A2D6ZI96      --------------------------------------------AGEEKKAD---KDQKL
A0A358KGZ3      --------------------------------------------PVEDKKDG---KEEKL
A0A2E9ZQX4      --------------------------------------------PVEDKKDG---KEEKL
A0A3D5JZU0      --------------------------------------------PVEDKKDG---KEEKL
A0A2E6HCR0      --------------------------------------------SEDVKESE---NGKSL
A0A1Z8WN04      --------------------------------------------SDGTGSDNKEIKDKSI
A0A2D7L1N4      --------------------------------------------SDGTGSDNKEIKDKSI
A0A2E2R937      --------------------------------------------SDGTGSDNKEIKDKSI
A0A520QQY4      --------------------------------------------SDGTGSDNKEIKDKSI
A0A2D5MR66      --------------------------------------------SLPEKGSD---QEKSI
A0A2E0PDQ1      --------------------------------------------SIAVKESD---KDKLI
A0A2E2ZZP9      --------------------------------------------PIAEKESD---KDKLI
A0A4P5YMI6      --------------------------------------------APAVAKRA---TKGAL
A0A7C4LRK7      --------------------------------------------KSRSGGKS---RETEV
A0A3C1VJ32      --------------------------------------------AEAKKADL---AAKGP
A0A7W1VTI1      ---------------------------------------------------------KGK
A0A7V4IGZ6      --------------------------------------------QP---------GGAAE
A0A2N9NTX7      --------------------------------------------SG---------PDEGP
B9XK55          --------------------------------------------TA---------TDAGE
A0A2A2RGF2      --------------------------------------------GTNGKPPG---KADRH
A0A2G4I5Y6      --------------------------------------------STNGKPPG---KVDRH
A0A6N6PS97      --------------------------------------------YGDKYGDS---YEGSK
A0A3M1I883      --------------------------------------------SSRKRRKS---REKDS
A0A1V6JZ45      --------------------------------------------KSSEDDES---RKAAP
A0A848A4B3      --------------------------------------------KSSEDDES---RKAAP
A0A7C7Z746      --------------------------------------------DDSKKSRK---KSGNL
A0A520RRW5      --------------------------------------------SSKKKSDG---KSGKT
A0A356NPK0      --------------------------------------------SSKKKSDG---KSGKT
A0A2D7B5P5      --------------------------------------------SSKKKSDG---KSGKT
A0A3D3XGB5      --------------------------------------------SSKKKSDG---KSGKT
A0A2V6F8A1      --------------------------------------------S--KNNGE---KKKPA
A0A2V5TNH4      --------------------------------------------A--KNNGE---KKTPA
A0A2V5X5Q6      --------------------------------------------A--KNNGE---KKKPA
A0A3R5R2M8      ----------------------------------------------------------RN
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
A0A7T8XNA1      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A1Q6UHJ9      --------------------------------------------EEDSEGEEAQEGGESE
A0A2V2BXR0      --------------------------------------------EEDSEGEEAQKGGESE
A0A3C1HEJ2      --------------------------------------------KAANSGK---------
A0A522ULD9      -----------------------------------------------RSQESMPKPETVG
A0A7W1RNH4      ----------------------------------------------------------AT
A0A2D8V0G3      --------------------------------------------GSKKGEGAKDGELVQG
A0A348S017      --------------------------------------------EPNK----KSKSVVQL
A0A3C1UUV7      --------------------------------------------EPNK----KSKSVVQL
A0A350I3V2      --------------------------------------------EPNK----KSKSVVQL
A0A520RGV5      --------------------------------------------EPNK----KSKSVVQL
A0A3D3XF90      --------------------------------------------EPNK----KSKSVVQL
A0A2D7B522      --------------------------------------------EPNK----KSKSVVQL
A0A356NIC2      --------------------------------------------EPNK----KSKSVVQL
A0A832MDW4      -------------------------------------------------RSRSTGSTSST
A0A1V6JU76      -------------------------------------------------RERAESRRQAV
A0A848ABG7      -------------------------------------------------RERAESRRQAV
A0A2A2XXW5      -------------------------------------------------RNKSA--DEPA
A0A6N6Q6V0      -------------------------------------------------RTKPG--KPEA
A0A2V6JLK8      --------------------------------------------ETHRRGRQKSRVAANG
A0A2W5Z1A5      --------------------------------------------QSRRSRSRAGVGAES-
A0A2V6EA09      --------------------------------------------ETRRGRSRKAAATVAH
A0A2V6GQI7      --------------------------------------------ETRRGRSRKAAATVAH
A0A7W1U7K0      --------------------------------------------EKKKSGRRDKTISSIR
A0A7W0YDK6      --------------------------------------------ERKLGRGRKAAASATR
A0A7V9EPY1      --------------------------------------------ERKPARRRQRAVASAR
A0A838TCM2      --------------------------------------------DRKAARRSPRTV-PAR
A0A2N8HDG3      ------------------------------------------------------------
A0A3E1ET42      --------------------------------------------APAGGAPQRPAPAKAG
A0A2A2YDW8      --------------------------------------------TSSRPAT------PSS
A0A352XLN9      --------------------------------------------TSSRPAT------PSS
A0A3D0YP62      --------------------------------------------DEIARDTATAAPAPSQ
A0A3D3DV47      --------------------------------------------DEIARDTATAAPAPSQ
A0A7Y1UNY2      --------------------------------------------AGSTAPS----PAPSG
A0A2E5XJ49      --------------------------------------------GSPGGPPGGGSRTVST
A0A2E6SBY8      --------------------------------------------ASPGGASAGRVRSAAA
A0A2E5QMS4      --------------------------------------------RKMTVST-GASPTATP
A0A2E7YXQ3      --------------------------------------------RKMTVST-GASPTATP
A0A2E3H787      --------------------------------------------FEAAAES-ATAEATGS
A0A2E7AGN1      --------------------------------------------VTKSAER-ASVKTPGG
A0A2E7AKY7      --------------------------------------------VTKSAER-ATVKTPGG
A0A3D4CU34      --------------------------------------------VTKSAER-ASVKTPGG
A0A2E8M146      --------------------------------------------ATASATSGSALESKVV
A0A355S8S2      --------------------------------------------ATASATSGSALESKVV
A0A2D6DVN8      --------------------------------------------ATASGTS-AATESTVA
A0A3C1W2R2      --------------------------------------------ATASGTS-AATESTVA
A0A2E3NAY6      --------------------------------------------TTSSGTT-EAIESTVA
A0A2E3II01      --------------------------------------------TTASGTS-AAIESAVA
A0A368B8C5      --------------------------------------------TTASGTS-AAIESAVA
A0A3R7RBB5      --------------------------------------------TTASGTS-AAIESAVA
A0A2A2QX62      --------------------------------------------SSSAPAKPAPPRSTSR
A0A4Q3BWH6      --------------------------------------------GSQAPSQSPAPRSSSR
A0A858RHU7      --------------------------------------------PNQPAAQRPSSRSSK-
A0A7V7VLV5      --------------------------------------------AAAKPQAASKSQAAA-
A0A3N5WCF1      --------------------------------------------PGSSSAPSKPQAAAT-
A0A4Q3C1K5      --------------------------------------------PTSSTPAAKPQAPA--
A0A3D1TI55      ----------------------------------------------------GPQEERTP
A0A3R8IT45      --------------------------------------------S---------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      --------------------------------------------NAAAGAAAKDDAGDAV
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A6N6PAZ1      --------------------------------------------K---------------
A0A7V7VK26      --------------------------------------------A---------------
A0A6I1K459      --------------------------------------------G---------------
D5ENH7          ------------------------------------------------HQEDEFEEELAG
A0A0R2XQ77      ------------------------------------------------SQDVELEDELAG
A0A2E9IN28      ------------------------------------------------HHEEELEEEMAG
A0A6N4WTJ5      ------------------------------------------------HQDEEFEEELAG
A0A366HAG0      --------------------------------------------KAKRKTRQSTPAKGAK
A0A2U8DZK4      ----------------------------------------------------DKTAGDTI
A0A2T6DFL8      --------------------------------------------RSDK--KPEAGGEDRL
A0A1D8AWD4      --------------------------------------------AAGAAGPNEARGSDRI
A0A4Q1C9S2      ----------------------------------------------AVAGKAAERGAERL
A0A178IH18      --------------------------------------------HRSGRDRDDEADA-RE
A0A2T6DT99      --------------------------------------------RRDDADGESDSRGDRI
A0A1G3ZT33      --------------------------------------------TEAA--AVPAGGAERI
A0A3E1E2T2      ---------------------------------------------SAAKPKSPGRGGDEL
B1ZMW1          --------------------------------------------PSAAHQAAPAVEGDRL
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      --------------------------------------------SDRANGASRSASFNGG
A0A351WE84      --------------------------------------------A-------------KT
A0A7W1MRT6      ------------------------------------------------------------
A0A7W1YXK2      ----------------------------------------------------------TE
A0A2D5WGA5      --------------------------------------------GDAAKDGKKEPKLLAK
A0A2E7SSH2      --------------------------------------------TEDNKNGGND-KLIAQ
A0A832HNU4      ----------------------------------------------------------KQ
A0A1V5QDZ6      --------------------------------------------TSNRKKDAL-------
A0A4Y8P964      --------------------------------------------NLSPFQSLRFLNGWVK
A0A3D4HF88      ----------------------------------------------------------GG
A0A1V6J089      ----------------------------------------------------------GV
A0A3C1BZR1      ----------------------------------------------------------GS
A0A848WTQ6      --------------------------------------------TEPRQQPRTRPVQEQP
A0A6N6ZHN8      ------------------------------------------------SGNEEGTREVEN
A0A6G6K641      ------------------------------------------------------------
A0A849Y642      --------------------------------------------PAGPVVASVKNGKPGR
A0A7C4KLL2      --------------------------------------------Q-------------SG
A0A1H6KPB7      --------------------------------------------LPVTSRSSKRSEVAKK
A0A2E9ISN4      ----------------------------------------------------------LY
B9XAX1          --------------------------------------------T---------------
A0A5R8KKM9      --------------------------------------------VANAPQKTLASLQSPK
A0A7W8DJ38      --------------------------------------------PNSRGMSNPPRIIG--
A0A7W1ZQ43      ----------------------------------------------------------GE
A0A139TS01      --------------------------------------------R---SGKAK-----EL
A0A3E1EJT7      --------------------------------------------S---------------
A0A848WYP9      --------------------------------------------PGPAPAAAL-------
A0A7C3I5X9      ------------------------------------------------AGAGA-----ET
A0A349GXM8      --------------------------------------------N---RRSRRQIRWRKQ
A0A7V3QFN7      --------------------------------------------EPSSEKSPK-----TE
A0A4P5YP61      --------------------------------------------A---------------
A0A6B2LYM4      --------------------------------------------HYYLQNKGMEDLDEEV
A0A6D1VXB3      --------------------------------------------SLSPFHSLQFLNDWVQ
I0JYY7          --------------------------------------------SLSPFHSLQFLNDWVQ
A0A4Y8P842      ----------------------------------------------------------SA
B3DZK9          ----------------------------------------------------------SQ
A0A4R7S1J2      ------------------------------------------------YGASA-------
A0A2A2XV69      --------------------------------------------NAQAA---------SP
A0A651H7X9      ----------------------------------------------------------DY
A0A5E6MPC4      ----------------------------------------------------------RR
A0A840V0I7      --------------------------------------------RKKRATSEA-------
A0A146G2Q9      --------------------------------------------KKAPVSA-------VQ
A0A2T6D3Y2      --------------------------------------------KKAPVSA-------VQ
A0A6N6PKP9      ----------------------------------------------------------GA
A0A6N6Z250      --------------------------------------------SIEGARWRE-------
A0A4V1SB02      --------------------------------------------DEDAAWPES-----TP
A0A6N6QEJ2      --------------------------------------------KKSRSGKAGA----AV
A0A3C1VB86      --------------------------------------------K---TSDDT-----RG
A0A6N6P5E3      --------------------------------------------QPQIDLVGEKKEKKVA
A0A838I246      --------------------------------------------R---P-A-------ST
A0A6J4HTK1      --------------------------------------------K---AAA-------AT
A0A838FVV7      --------------------------------------------K---ATA-------SA
A0A7C3HWX0      --------------------------------------------S---AKPAKDVPKAVA
A0A7V4LSC4      --------------------------------------------S---GKSGSSNEKAAE
A0A2D5VY59      --------------------------------------------P---KTKSS-----KT
A0A2D8UZZ4      --------------------------------------------P---KTKSS-----KT
A0A353DV86      --------------------------------------------P---KTKSS-----KT
A0A2E5EPT8      --------------------------------------------SKPRELKGKVDRQRGQ
A0A5B5WZ91      --------------------------------------------R---SGKAK-----EL
A0A2N8HD92      --------------------------------------------R---SGKAK-----EL
A0A2N8HIT2      --------------------------------------------R---SGKAK-----EL
A0A354EBD3      --------------------------------------------R---SGKAK-----EL
A0A355VEB2      --------------------------------------------R---SGKAK-----EL
R6K1U5          --------------------------------------------R---SGKAK-----EL
A0A2N8IWC2      --------------------------------------------R---SGKAK-----EL
A0A2N8I441      --------------------------------------------R---SGKAK-----EL
A0A2N8I3A6      --------------------------------------------R---SGKAK-----EL
A0A410SCC4      --------------------------------------------R---SGKAK-----EL
A0A3R5VEW0      --------------------------------------------R---SGKAK-----EL
A0A7T9B0I0      --------------------------------------------R---SGKAK-----EL
B2UKW3          --------------------------------------------R---SGKAK-----EL
A0A411SSG2      --------------------------------------------R---SGKAK-----EL
A0A6M1RXR2      --------------------------------------------S---GKGREKTDK-AA
A0A7C3DXS4      --------------------------------------------S---DKDKEKAGKTAS
A0A7V6YXH8      --------------------------------------------E---T---------AG
A0A2V2SDV4      --------------------------------------------G---G---------PA
A0A6N6PHJ5      --------------------------------------------E---GQAKK-----PA
A0A7Y4QKN3      --------------------------------------------A---G--VK-----PP
A0A2V5PK75      --------------------------------------------R---P--DE-----PA
A0A1V6DME1      --------------------------------------------G---E--KK-----AD
A0A3D3DIJ3      --------------------------------------------K---E--GA-----ES
A0A7X7VJR5      --------------------------------------------K---E--GA-----ES
A0A6I1K583      --------------------------------------------PGKVDRRKP-----VA
A0A350EWA4      --------------------------------------------K---NGHPA-----TK
A0A832D3W5      --------------------------------------------EPSSEKSPK-----TE
A0A7V2G542      ------------------------------------------------AGAPE-----PA
A0A7C4KPD7      --------------------------------------------K---RSGSD-----AG
A0A832MGU4      --------------------------------------------K---AAGSK-----KG
A0A1M6RLZ4      ------------------------------------------------EVRAA-----AQ
A0A832M6Y9      --------------------------------------------KQIQQQAPA-----PG
A0A832HP42      --------------------------------------------S---DAEKQ-----AS
A0A354T7G8      --------------------------------------------AETTANALT-----SP
A0A512MBZ2      --------------------------------------------SDAPAAPNA-----AP
A0A2E8MEZ0      --------------------------------------------P---ASSKT-----EE
A0A7Y2T9S5      --------------------------------------------A---VVSTP-----AA
A0A851GRQ2      --------------------------------------------K---QTAAA-----AE
A0A6B3LBV6      --------------------------------------------K---KEVSS-----SV
A0A840UX61      --------------------------------------------V---AGSDG-----SG
A0A4Q2YKS3      --------------------------------------------Q---KSGGR-----EN
A0A6N6P3T8      --------------------------------------------A---ASKSQ-----PT
A0A8A7W668      --------------------------------------------Q---QATAS-----DA
A0A2E3EC33      --------------------------------------------A---PSSKE-----PK
A0A2E4GN01      --------------------------------------------S---SSSKE-----SK
A0A800JJX7      --------------------------------------------A---SSSKE-----SK
A0A1Z8XU55      --------------------------------------------K---SGDKL-----AS
A0A2E1RQR9      --------------------------------------------K---SGDKL-----AS
A0A2E3ISQ4      --------------------------------------------K---SESKV-----AS
A0A2D6W6F4      --------------------------------------------K---AGSKL-----AS
A0A2D8Z5A8      --------------------------------------------K---PGSKL-----AS
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      AAIPKPATKKTMNKESREELSPEFLKLVIVRLTQAMGPIAPLVLREHISALGETLESFPQ
A0A2V5PST3      MNDGPFEKDPWPKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARNRFPK
A0A2V5PXM3      RAAAA-------------------------------------------------------
A0A1V5QB01      -----------------SKEDAKT------------------------------------
A0A800JGC6      KEKSG-------------------------------------------------------
A0A7Y2T8X5      -----------------GDDE---------------------------------------
A0A1J4XH17      LSKKK------------NKEKTLV------------------------------------
A0A7C5LI63      EKKEE------------DQIEDVY------------------------------------
A0A7C5P291      ESGKD------------D-IDDVY------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          PTSRS-------------------------------------------------------
W0ITH7          PTSRS-------------------------------------------------------
A0A139SU05      VSEIA-------------------------------------------------------
A0A139SPN4      PAVAA-------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      EEXSA-------------------------------------------------------
A0A258ANJ7      PSNFG-------------------------------------------------------
A0A1Z8ZMT6      -----------------DDA----------------------------------------
A0A2E8MCT7      -----------------DDT----------------------------------------
A0A139TLN4      PCPGK-------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A5B5WI95      AGKN--------------------------------------------------------
A0A2N8I9W1      TRKQD-------------------------------------------------------
A0A4Q5IH27      TRKQD-------------------------------------------------------
A0A2N8IBZ6      TRKQD-------------------------------------------------------
A0A7G6DX28      TRKQD-------------------------------------------------------
R6J100          TRKQD-------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A290Q2Z2      FTERE------------RDERRKS------------------------------------
A0A2A2RGK2      GVYGE-------------------------------------------------------
A0A2A2XXF7      GVYGE-------------------------------------------------------
A0A146GCJ0      -EKSV-------------------------------------------------------
A0A2T6D6H8      -AKAG-------------------------------------------------------
A0A6B3L938      -----------------GDND---------------------------------------
A0A2A2R5D6      KNDEQ------------SHGSEDF------------------------------------
A0A2V5URB2      SARLT-------------------------------------------------------
A0A2V2DJ66      EEKNS-------------------------------------------------------
R7L5A9          KQ----------------------------------------------------------
A0A5B5WU87      PCPGK-------------------------------------------------------
R7DZW0          PCAGK-------------------------------------------------------
A0A2N8HID1      PCAGK-------------------------------------------------------
A0A2N8HS06      PCAGK-------------------------------------------------------
A0A6N2TNT9      PCAGK-------------------------------------------------------
A0A4P5QM05      ----N------------ADNEDAY------------------------------------
A0A4Q3C001      TPAST------------GSKHGDY------------------------------------
B4DB23          ----R------------DTHREDY------------------------------------
A0A5R8KA81      KPVAS-------------------------------------------------------
A0A2E6T482      LAKADLGA---------GEDKPKY------------------------------------
A0A3C0DQZ7      LAKADLGA---------GEDKPKY------------------------------------
A0A1Z9CBK5      VAQANPGG---------SDVKPKY------------------------------------
A0A2D6ZI96      VAQANPGG---------SDVKPKY------------------------------------
A0A358KGZ3      IAQADAAG---------EDVNPKY------------------------------------
A0A2E9ZQX4      IAQADAXG---------XDVXPKX------------------------------------
A0A3D5JZU0      IAQADAVG---------EDVKPKY------------------------------------
A0A2E6HCR0      VSEAASDR---------EDVKPKY------------------------------------
A0A1Z8WN04      TTE-VDSS---------SDVKPKY------------------------------------
A0A2D7L1N4      TTE-VDSS---------SDVKPKY------------------------------------
A0A2E2R937      TTE-VGGS---------SDVKPKY------------------------------------
A0A520QQY4      TTE-VDSS---------SDVKPKY------------------------------------
A0A2D5MR66      TNESADRD---------GSVKPKY------------------------------------
A0A2E0PDQ1      NTEATENN---------ESVEPKY------------------------------------
A0A2E2ZZP9      NTEDAENN---------ESVEPKY------------------------------------
A0A4P5YMI6      AEKPA------------AELNQKY------------------------------------
A0A7C4LRK7      ASTGG-------------EIKQKY------------------------------------
A0A3C1VJ32      G-DTE------------VNIKQKY------------------------------------
A0A7W1VTI1      GDMAQ------------ADLKSKY------------------------------------
A0A7V4IGZ6      G-KPK------------VEIKQKY------------------------------------
A0A2N9NTX7      GDKTK------------LDIKPKY------------------------------------
B9XK55          G-KAR------------TDIKPKY------------------------------------
A0A2A2RGF2      KPAAPTADA--------PTIKPKY------------------------------------
A0A2G4I5Y6      KPVAPVADA--------TSIKPKY------------------------------------
A0A6N6PS97      KKKKKGSEKPTEVAETTVKIEQKF------------------------------------
A0A3M1I883      SAEAPATAATETEEAETPELKEKF------------------------------------
A0A1V6JZ45      KKPAE------------AELKTKY------------------------------------
A0A848A4B3      KKPAE------------AELKTKY------------------------------------
A0A7C7Z746      KRSGDSKKASSAKGETAVNLKTKY------------------------------------
A0A520RRW5      SARGD------------LELKNKF------------------------------------
A0A356NPK0      SARGD------------LELKNKF------------------------------------
A0A2D7B5P5      SARGD------------LELKNKF------------------------------------
A0A3D3XGB5      SARGD------------LELKNKF------------------------------------
A0A2V6F8A1      GERAQ------------LDLKQKY------------------------------------
A0A2V5TNH4      GERAQ------------LDLKQKY------------------------------------
A0A2V5X5Q6      GERAQ------------LDLKQKY------------------------------------
A0A3R5R2M8      EPETA------------PEDSDKQ------------------------------------
A0A411SUQ6      EPQQT------------SRKQDK-------------------------------------
A0A2N8HZF2      KPQQT------------SRKQNK-------------------------------------
A0A354E720      DPQQT------------ARKRD--------------------------------------
A0A7T8XNA1      EPQQT------------SRKQNK-------------------------------------
B2UPB6          EPQQT------------SRKQDK-------------------------------------
A0A1Q6UHJ9      DPENS------------ENSK---------------------------------------
A0A2V2BXR0      DPENS------------ENSK---------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      GVTAA------------EVRKEST------------------------------------
A0A7W1RNH4      SDSKR------------E------------------------------------------
A0A2D8V0G3      GKAGK------------DDEPSKA------------------------------------
A0A348S017      DKTAK------------KSESEV-------------------------------------
A0A3C1UUV7      DKTAK------------KSESEV-------------------------------------
A0A350I3V2      DKTAK------------KSESEV-------------------------------------
A0A520RGV5      DKTAK------------KSESEV-------------------------------------
A0A3D3XF90      DKTAK------------KSESEV-------------------------------------
A0A2D7B522      DKTAK------------KSESEV-------------------------------------
A0A356NIC2      DKTAK------------KSESEV-------------------------------------
A0A832MDW4      AEQTE------------TKKS---------------------------------------
A0A1V6JU76      VESSG------------STPAPHA------------------------------------
A0A848ABG7      VESSG------------STPAPHA------------------------------------
A0A2A2XXW5      DKKSA------------SEKSKSA------------------------------------
A0A6N6Q6V0      EKGAG------------VAKAKG-------------------------------------
A0A2V6JLK8      SADNG------------HIDTDEY------------------------------------
A0A2W5Z1A5      -NGAS------------DNGRDEY------------------------------------
A0A2V6EA09      -NGAS------------GSDEDEY------------------------------------
A0A2V6GQI7      -NGA--------------SDSDEY------------------------------------
A0A7W1U7K0      SNGA--------------SKPDDY------------------------------------
A0A7W0YDK6      GNGA--------------ANPEEY------------------------------------
A0A7V9EPY1      -NGA--------------STPEDY------------------------------------
A0A838TCM2      -NGA--------------GSPDEY------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A3E1ET42      AGRGE------------NED---Y------------------------------------
A0A2A2YDW8      TASTS------------NQNDTLY------------------------------------
A0A352XLN9      TASTS------------NQNDTLY------------------------------------
A0A3D0YP62      QAQPA------------RNDEDLY------------------------------------
A0A3D3DV47      QAQPA------------RNDEDLY------------------------------------
A0A7Y1UNY2      GGSNA------------PDDDNLY------------------------------------
A0A2E5XJ49      S-APQ------------DEDEALY------------------------------------
A0A2E6SBY8      SPSSQ------------DDDGGLY------------------------------------
A0A2E5QMS4      STPEE------------DDDGLSY------------------------------------
A0A2E7YXQ3      STPEE------------DDDGLSY------------------------------------
A0A2E3H787      SKDEN------------DDDGLTY------------------------------------
A0A2E7AGN1      KNETD------------DEEGLTY------------------------------------
A0A2E7AKY7      KNELD------------DEKGLTY------------------------------------
A0A3D4CU34      KNETD------------DEEGLTY------------------------------------
A0A2E8M146      ANDSE------------EDEGLNY------------------------------------
A0A355S8S2      ANDSE------------EDEGLNY------------------------------------
A0A2D6DVN8      TSDED------------KDEGLTY------------------------------------
A0A3C1W2R2      ANDED------------KDEGLTY------------------------------------
A0A2E3NAY6      TNDAD------------DDEGLTY------------------------------------
A0A2E3II01      ATDAD------------KDEGLTY------------------------------------
A0A368B8C5      ANDAD------------KDEGLTY------------------------------------
A0A3R7RBB5      ANDAD------------KDEGLTY------------------------------------
A0A2A2QX62      GDAAD------------DAKQDLY------------------------------------
A0A4Q3BWH6      ASSTD------------DSKQDLY------------------------------------
A0A858RHU7      ----D------------DSKQDLY------------------------------------
A0A7V7VLV5      ----H------------SNDTELY------------------------------------
A0A3N5WCF1      ----R------------GADSELY------------------------------------
A0A4Q3C1K5      ----R------------GNDSELY------------------------------------
A0A3D1TI55      DRPKE------------LDVGEAY------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ASTEN------------PEDNPKV------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A7V7VK26      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
D5ENH7          SVEPD------------KQ-----------------------------------------
A0A0R2XQ77      SVEP--------------EMEPRS------------------------------------
A0A2E9IN28      SVEPQ------------SELGPKA------------------------------------
A0A6N4WTJ5      SVEP--------------EMRPKA------------------------------------
A0A366HAG0      VKSPR------------AKADEVF------------------------------------
A0A2U8DZK4      NFSEK------------K------------------------------------------
A0A2T6DFL8      DLHE--------------------------------------------------------
A0A1D8AWD4      EMRET------------REPERKR------------------------------------
A0A4Q1C9S2      DLDEK---------------PRRR------------------------------------
A0A178IH18      TFTEP------------ER-----------------------------------------
A0A2T6DT99      EYVER------------ERRRSKE------------------------------------
A0A1G3ZT33      VLDEP------------DSRRHG-------------------------------------
A0A3E1E2T2      KLS---------------------------------------------------------
B1ZMW1          VLREP------------ERKDPA-------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      GKSAT------------VPLASTLATSPRRPVGSEKSSFKMNRNS---------------
A0A351WE84      IAASA------------DGKDSLF------------------------------------
A0A7W1MRT6      ------------------------------------------------------------
A0A7W1YXK2      EERET------------LAPAQRV------------------------------------
A0A2D5WGA5      ADVGG------------EDEKPKY------------------------------------
A0A2E7SSH2      ADIGG------------DDVKPKY------------------------------------
A0A832HNU4      PGPTA------------KPTA---------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      KKSSD------------KTTDS--------------------------------------
A0A3D4HF88      SNPKA-------------------------------------------------------
A0A1V6J089      VRHEN------------DDNLTES------------------------------------
A0A3C1BZR1      SKHDK------------EDDATEA------------------------------------
A0A848WTQ6      QQQQP------------VASERSHHHPATETPQPAQSNPNVAANGFDARIMAAAAAGSHP
A0A6N6ZHN8      THRKT------------PPSEEMHV-----------------------------------
A0A6G6K641      ---SS------------HGERKVYGSA---------------------------------
A0A849Y642      KGAAP------------SDFTETF------------------------------------
A0A7C4KLL2      DDKQA------------KQETASSVPR---------------------------------
A0A1H6KPB7      TESTD------------QPGDDLY------------------------------------
A0A2E9ISN4      GMESE------------TPKNKRWKFR---------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      SEKNR------------TSYQDAF------------------------------------
A0A7W8DJ38      ------------------------------------------------------------
A0A7W1ZQ43      APESR------------VLLKS--------------------------------------
A0A139TS01      AATQS------------NDNEDLY------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A848WYP9      ------------------------------------------------------------
A0A7C3I5X9      EPAEE------------STPVQKA------------------------------------
A0A349GXM8      LEHAG------------AWIRKTLMPM---------------------------------
A0A7V3QFN7      KSGGM------------EGLETKY------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      AASGP------------SDGPQETKTS---------------------------------
A0A6D1VXB3      EKIKR------------PDK----------------------------------------
I0JYY7          EKIKR------------PDK----------------------------------------
A0A4Y8P842      VPSDS------------QEIMRKEKEG---------------------------------
B3DZK9          ASSNS------------QELMRKEEEA---------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ATTKP------------TPQSGEY------------------------------------
A0A651H7X9      YVVTS------------EDEKEMR------------------------------------
A0A5E6MPC4      AEALR------------APSQPPS------------------------------------
A0A840V0I7      ------------------------------------------------------------
A0A146G2Q9      QLNGE------------KDQEDTY------------------------------------
A0A2T6D3Y2      QLNGE------------KDQEDTY------------------------------------
A0A6N6PKP9      SAALA------------DEAVVEYASK---------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      AVSPS------------QASRAKE------------------------------------
A0A6N6QEJ2      ADDKS------------AEVKPKY------------------------------------
A0A3C1VB86      NLASE------------ARPENLL------------------------------------
A0A6N6P5E3      VVDAE------------AGSTGDY------------------------------------
A0A838I246      AASNG------------SSGPEEY------------------------------------
A0A6J4HTK1      VASNG------------QSDSEEY------------------------------------
A0A838FVV7      TTRNG------------YSDPEEY------------------------------------
A0A7C3HWX0      AVTGA------------GDPAKK-------------------------------------
A0A7V4LSC4      SV----------------QLAKK-------------------------------------
A0A2D5VY59      ASRGD------------VELKNKF------------------------------------
A0A2D8UZZ4      ASRGD------------VELKNKF------------------------------------
A0A353DV86      ASRGD------------VELKNKF------------------------------------
A0A2E5EPT8      DSSEE------------PDLKSKY------------------------------------
A0A5B5WZ91      AATQS------------SDNEDLY------------------------------------
A0A2N8HD92      AANQS------------HDSEDLY------------------------------------
A0A2N8HIT2      AATQS------------HDSEDLY------------------------------------
A0A354EBD3      AATQS------------HDSEDLY------------------------------------
A0A355VEB2      AATQS------------HDSEDLY------------------------------------
R6K1U5          AATQS------------HDSEDLY------------------------------------
A0A2N8IWC2      AATQS------------HDSEDLY------------------------------------
A0A2N8I441      AATQS------------HDSEDLY------------------------------------
A0A2N8I3A6      AATQS------------HDSEDLY------------------------------------
A0A410SCC4      AATQS------------HDSEDLY------------------------------------
A0A3R5VEW0      AATQS------------HDSEDLY------------------------------------
A0A7T9B0I0      AATQS------------HDSEDLY------------------------------------
B2UKW3          AATQS------------HDSEDLY------------------------------------
A0A411SSG2      AATQS------------HDSEDLY------------------------------------
A0A6M1RXR2      GELAR------------TEIKPKY------------------------------------
A0A7C3DXS4      ADTAR------------VEIKSKY------------------------------------
A0A7V6YXH8      DDVAK------------IDIKPKY------------------------------------
A0A2V2SDV4      SQKS--------------------------------------------------------
A0A6N6PHJ5      DKKTE------------GEIKQKY------------------------------------
A0A7Y4QKN3      DEKSK------------TEIKQKY------------------------------------
A0A2V5PK75      GDKAR------------RA-----------------------------------------
A0A1V6DME1      DSQAK------------VEIKKKY------------------------------------
A0A3D3DIJ3      GGKDK------------LDIKQKY------------------------------------
A0A7X7VJR5      GGKDK------------LDIKQKY------------------------------------
A0A6I1K583      PATDA------------PTIKPKY------------------------------------
A0A350EWA4      DEPAS------------RLDLKKY------------------------------------
A0A832D3W5      KSGGM------------EGLETKY------------------------------------
A0A7V2G542      TEDLA------------ARSHDEY------------------------------------
A0A7C4KPD7      STSAE------------VEIKQKY------------------------------------
A0A832MGU4      EPAVE------------VEIKQKY------------------------------------
A0A1M6RLZ4      PQGAQ------------SNSADLY------------------------------------
A0A832M6Y9      GQESE------------RRRSDEF------------------------------------
A0A832HP42      EKAAS------------ADLKPKY------------------------------------
A0A354T7G8      RTVSR------------PEGEDVF------------------------------------
A0A512MBZ2      SPASR------------APQGDLF------------------------------------
A0A2E8MEZ0      KKSER------------SSSEDLY------------------------------------
A0A7Y2T9S5      PAAQD------------QKDEDLY------------------------------------
A0A851GRQ2      PKKVT------------EQDDDLY------------------------------------
A0A6B3LBV6      GGGDV------------KLGDDVY------------------------------------
A0A840UX61      RSSSS------------KDQDDLY------------------------------------
A0A4Q2YKS3      DS-------------------ELY------------------------------------
A0A6N6P3T8      AQGND---------------TELY------------------------------------
A0A8A7W668      GSKES----------------DLY------------------------------------
A0A2E3EC33      GSSEE------------ISIEDKF------------------------------------
A0A2E4GN01      SSSEE------------ISAEDKY------------------------------------
A0A800JJX7      SSSEE------------ISVEDKF------------------------------------
A0A1Z8XU55      NDKDN------------LTAEDKF------------------------------------
A0A2E1RQR9      NDKDN------------LTAEDKF------------------------------------
A0A2E3ISQ4      NDQNN------------LSAEDKF------------------------------------
A0A2D6W6F4      NDQNN------------LSAEDKF------------------------------------
A0A2D8Z5A8      NDQNN------------LSAEDKF------------------------------------
                                                                            

A0A2A2XVF1      ----------------------------------
A0A2V5UHJ2      ARLEELVQRLCKEIVTDSFRQQFEEEMAKLTSDV
A0A2V5PST3      NRLQELFDRICEEILDDKLKNDFQQSMQEELRVL
A0A2V5PXM3      ----------------------------------
A0A1V5QB01      ----------------------------------
A0A800JGC6      ----------------------------------
A0A7Y2T8X5      ----------------------------------
A0A1J4XH17      ----------------------------------
A0A7C5LI63      ----------------------------------
A0A7C5P291      ----------------------------------
A0A290QGD9      ----------------------------------
A0A1D8AS58      ----------------------------------
I6AQC1          ----------------------------------
W0ITH7          ----------------------------------
A0A139SU05      ----------------------------------
A0A139SPN4      ----------------------------------
A0A1V6E7N1      ----------------------------------
A0A2D9MYT1      ----------------------------------
A0A258ANJ7      ----------------------------------
A0A1Z8ZMT6      ----------------------------------
A0A2E8MCT7      ----------------------------------
A0A139TLN4      ----------------------------------
A0A1G3ZFT0      ----------------------------------
A0A5B5WI95      ----------------------------------
A0A2N8I9W1      ----------------------------------
A0A4Q5IH27      ----------------------------------
A0A2N8IBZ6      ----------------------------------
A0A7G6DX28      ----------------------------------
R6J100          ----------------------------------
A0A139TV24      ----------------------------------
A0A2N8HT11      ----------------------------------
R7DS70          ----------------------------------
A0A2N8HNL6      ----------------------------------
A0A290Q2Z2      ----------------------------------
A0A2A2RGK2      ----------------------------------
A0A2A2XXF7      ----------------------------------
A0A146GCJ0      ----------------------------------
A0A2T6D6H8      ----------------------------------
A0A6B3L938      ----------------------------------
A0A2A2R5D6      ----------------------------------
A0A2V5URB2      ----------------------------------
A0A2V2DJ66      ----------------------------------
R7L5A9          ----------------------------------
A0A5B5WU87      ----------------------------------
R7DZW0          ----------------------------------
A0A2N8HID1      ----------------------------------
A0A2N8HS06      ----------------------------------
A0A6N2TNT9      ----------------------------------
A0A4P5QM05      ----------------------------------
A0A4Q3C001      ----------------------------------
B4DB23          ----------------------------------
A0A5R8KA81      ----------------------------------
A0A2E6T482      ----------------------------------
A0A3C0DQZ7      ----------------------------------
A0A1Z9CBK5      ----------------------------------
A0A2D6ZI96      ----------------------------------
A0A358KGZ3      ----------------------------------
A0A2E9ZQX4      ----------------------------------
A0A3D5JZU0      ----------------------------------
A0A2E6HCR0      ----------------------------------
A0A1Z8WN04      ----------------------------------
A0A2D7L1N4      ----------------------------------
A0A2E2R937      ----------------------------------
A0A520QQY4      ----------------------------------
A0A2D5MR66      ----------------------------------
A0A2E0PDQ1      ----------------------------------
A0A2E2ZZP9      ----------------------------------
A0A4P5YMI6      ----------------------------------
A0A7C4LRK7      ----------------------------------
A0A3C1VJ32      ----------------------------------
A0A7W1VTI1      ----------------------------------
A0A7V4IGZ6      ----------------------------------
A0A2N9NTX7      ----------------------------------
B9XK55          ----------------------------------
A0A2A2RGF2      ----------------------------------
A0A2G4I5Y6      ----------------------------------
A0A6N6PS97      ----------------------------------
A0A3M1I883      ----------------------------------
A0A1V6JZ45      ----------------------------------
A0A848A4B3      ----------------------------------
A0A7C7Z746      ----------------------------------
A0A520RRW5      ----------------------------------
A0A356NPK0      ----------------------------------
A0A2D7B5P5      ----------------------------------
A0A3D3XGB5      ----------------------------------
A0A2V6F8A1      ----------------------------------
A0A2V5TNH4      ----------------------------------
A0A2V5X5Q6      ----------------------------------
A0A3R5R2M8      ----------------------------------
A0A411SUQ6      ----------------------------------
A0A2N8HZF2      ----------------------------------
A0A354E720      ----------------------------------
A0A7T8XNA1      ----------------------------------
B2UPB6          ----------------------------------
A0A1Q6UHJ9      ----------------------------------
A0A2V2BXR0      ----------------------------------
A0A3C1HEJ2      ----------------------------------
A0A522ULD9      ----------------------------------
A0A7W1RNH4      ----------------------------------
A0A2D8V0G3      ----------------------------------
A0A348S017      ----------------------------------
A0A3C1UUV7      ----------------------------------
A0A350I3V2      ----------------------------------
A0A520RGV5      ----------------------------------
A0A3D3XF90      ----------------------------------
A0A2D7B522      ----------------------------------
A0A356NIC2      ----------------------------------
A0A832MDW4      ----------------------------------
A0A1V6JU76      ----------------------------------
A0A848ABG7      ----------------------------------
A0A2A2XXW5      ----------------------------------
A0A6N6Q6V0      ----------------------------------
A0A2V6JLK8      ----------------------------------
A0A2W5Z1A5      ----------------------------------
A0A2V6EA09      ----------------------------------
A0A2V6GQI7      ----------------------------------
A0A7W1U7K0      ----------------------------------
A0A7W0YDK6      ----------------------------------
A0A7V9EPY1      ----------------------------------
A0A838TCM2      ----------------------------------
A0A2N8HDG3      ----------------------------------
A0A3E1ET42      ----------------------------------
A0A2A2YDW8      ----------------------------------
A0A352XLN9      ----------------------------------
A0A3D0YP62      ----------------------------------
A0A3D3DV47      ----------------------------------
A0A7Y1UNY2      ----------------------------------
A0A2E5XJ49      ----------------------------------
A0A2E6SBY8      ----------------------------------
A0A2E5QMS4      ----------------------------------
A0A2E7YXQ3      ----------------------------------
A0A2E3H787      ----------------------------------
A0A2E7AGN1      ----------------------------------
A0A2E7AKY7      ----------------------------------
A0A3D4CU34      ----------------------------------
A0A2E8M146      ----------------------------------
A0A355S8S2      ----------------------------------
A0A2D6DVN8      ----------------------------------
A0A3C1W2R2      ----------------------------------
A0A2E3NAY6      ----------------------------------
A0A2E3II01      ----------------------------------
A0A368B8C5      ----------------------------------
A0A3R7RBB5      ----------------------------------
A0A2A2QX62      ----------------------------------
A0A4Q3BWH6      ----------------------------------
A0A858RHU7      ----------------------------------
A0A7V7VLV5      ----------------------------------
A0A3N5WCF1      ----------------------------------
A0A4Q3C1K5      ----------------------------------
A0A3D1TI55      ----------------------------------
A0A3R8IT45      ----------------------------------
A0A2A2PYE8      ----------------------------------
A0A2T6CN73      ----------------------------------
A0A2G4G428      ----------------------------------
A0A6N6PCD8      ----------------------------------
A0A139TUL1      ----------------------------------
A0A2N8HCB0      ----------------------------------
A0A2N8HP04      ----------------------------------
A0A2N8HRJ0      ----------------------------------
A0A6N2U9Y7      ----------------------------------
A0A6N6PAZ1      ----------------------------------
A0A7V7VK26      ----------------------------------
A0A6I1K459      ----------------------------------
D5ENH7          ----------------------------------
A0A0R2XQ77      ----------------------------------
A0A2E9IN28      ----------------------------------
A0A6N4WTJ5      ----------------------------------
A0A366HAG0      ----------------------------------
A0A2U8DZK4      ----------------------------------
A0A2T6DFL8      ----------------------------------
A0A1D8AWD4      ----------------------------------
A0A4Q1C9S2      ----------------------------------
A0A178IH18      ----------------------------------
A0A2T6DT99      ----------------------------------
A0A1G3ZT33      ----------------------------------
A0A3E1E2T2      ----------------------------------
B1ZMW1          ----------------------------------
A0A3M1I8A3      ----------------------------------
A0A4V0XS84      ----------------------------------
A0A351WE84      ----------------------------------
A0A7W1MRT6      ----------------------------------
A0A7W1YXK2      ----------------------------------
A0A2D5WGA5      ----------------------------------
A0A2E7SSH2      ----------------------------------
A0A832HNU4      ----------------------------------
A0A1V5QDZ6      ----------------------------------
A0A4Y8P964      ----------------------------------
A0A3D4HF88      ----------------------------------
A0A1V6J089      ----------------------------------
A0A3C1BZR1      ----------------------------------
A0A848WTQ6      QISPLDAVAQQPSVQPQPATPVASNAPAPHTDVY
A0A6N6ZHN8      ----------------------------------
A0A6G6K641      ----------------------------------
A0A849Y642      ----------------------------------
A0A7C4KLL2      ----------------------------------
A0A1H6KPB7      ----------------------------------
A0A2E9ISN4      ----------------------------------
B9XAX1          ----------------------------------
A0A5R8KKM9      ----------------------------------
A0A7W8DJ38      ----------------------------------
A0A7W1ZQ43      ----------------------------------
A0A139TS01      ----------------------------------
A0A3E1EJT7      ----------------------------------
A0A848WYP9      ----------------------------------
A0A7C3I5X9      ----------------------------------
A0A349GXM8      ----------------------------------
A0A7V3QFN7      ----------------------------------
A0A4P5YP61      ----------------------------------
A0A6B2LYM4      ----------------------------------
A0A6D1VXB3      ----------------------------------
I0JYY7          ----------------------------------
A0A4Y8P842      ----------------------------------
B3DZK9          ----------------------------------
A0A4R7S1J2      ----------------------------------
A0A2A2XV69      ----------------------------------
A0A651H7X9      ----------------------------------
A0A5E6MPC4      ----------------------------------
A0A840V0I7      ----------------------------------
A0A146G2Q9      ----------------------------------
A0A2T6D3Y2      ----------------------------------
A0A6N6PKP9      ----------------------------------
A0A6N6Z250      ----------------------------------
A0A4V1SB02      ----------------------------------
A0A6N6QEJ2      ----------------------------------
A0A3C1VB86      ----------------------------------
A0A6N6P5E3      ----------------------------------
A0A838I246      ----------------------------------
A0A6J4HTK1      ----------------------------------
A0A838FVV7      ----------------------------------
A0A7C3HWX0      ----------------------------------
A0A7V4LSC4      ----------------------------------
A0A2D5VY59      ----------------------------------
A0A2D8UZZ4      ----------------------------------
A0A353DV86      ----------------------------------
A0A2E5EPT8      ----------------------------------
A0A5B5WZ91      ----------------------------------
A0A2N8HD92      ----------------------------------
A0A2N8HIT2      ----------------------------------
A0A354EBD3      ----------------------------------
A0A355VEB2      ----------------------------------
R6K1U5          ----------------------------------
A0A2N8IWC2      ----------------------------------
A0A2N8I441      ----------------------------------
A0A2N8I3A6      ----------------------------------
A0A410SCC4      ----------------------------------
A0A3R5VEW0      ----------------------------------
A0A7T9B0I0      ----------------------------------
B2UKW3          ----------------------------------
A0A411SSG2      ----------------------------------
A0A6M1RXR2      ----------------------------------
A0A7C3DXS4      ----------------------------------
A0A7V6YXH8      ----------------------------------
A0A2V2SDV4      ----------------------------------
A0A6N6PHJ5      ----------------------------------
A0A7Y4QKN3      ----------------------------------
A0A2V5PK75      ----------------------------------
A0A1V6DME1      ----------------------------------
A0A3D3DIJ3      ----------------------------------
A0A7X7VJR5      ----------------------------------
A0A6I1K583      ----------------------------------
A0A350EWA4      ----------------------------------
A0A832D3W5      ----------------------------------
A0A7V2G542      ----------------------------------
A0A7C4KPD7      ----------------------------------
A0A832MGU4      ----------------------------------
A0A1M6RLZ4      ----------------------------------
A0A832M6Y9      ----------------------------------
A0A832HP42      ----------------------------------
A0A354T7G8      ----------------------------------
A0A512MBZ2      ----------------------------------
A0A2E8MEZ0      ----------------------------------
A0A7Y2T9S5      ----------------------------------
A0A851GRQ2      ----------------------------------
A0A6B3LBV6      ----------------------------------
A0A840UX61      ----------------------------------
A0A4Q2YKS3      ----------------------------------
A0A6N6P3T8      ----------------------------------
A0A8A7W668      ----------------------------------
A0A2E3EC33      ----------------------------------
A0A2E4GN01      ----------------------------------
A0A800JJX7      ----------------------------------
A0A1Z8XU55      ----------------------------------
A0A2E1RQR9      ----------------------------------
A0A2E3ISQ4      ----------------------------------
A0A2D6W6F4      ----------------------------------
A0A2D8Z5A8      ----------------------------------
                                                  

© 1998-2022Legal notice