BYKdb

Dataset for cluster tadcd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

219 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2A2XVF1      MSKRVDFPRRAFCEFRGIFVRFVFLFLIGMSVAAEPSNEYKLAPNDLLDFRVFQEPELDA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A5C9DC49      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A5R1Q5N3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5C9DS93      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      VVRVSGDGQAIFPLVGGVAIAGASISEAIELIKSRYRDGYLKNPQVTLTVRSYAKKLFTI
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      --------------------------------------------------MSEENPNTGS
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A5C9DC49      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A5R1Q5N3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5C9DS93      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      LGQVQQPGSYDIQSQIRGMSPLSVSRMVVSASSSLTRNAWRAVMKKPRSSSRREMSSPSA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ---------------------------------------------------------MRP
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      -------------------------------------------------MSMKMMSSPSP
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      -------------------------------------------------------MNPPA
A0A1D8AS58      -------------------------------------------------------MENAP
I6AQC1          -------------------------------------------------------MDSQA
W0ITH7          -------------------------------------------------------MDSQA
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------MLWWSR
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------MKDNHS
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A2V2DJ66      -----MENSDSKTPAQDGASQNAPSSQGAKSVRKKRNSGYGYG--YNYSAYGNYGGYGGY
R7L5A9          -----MESSNN--------NNSQPDSAPTKVIKKKIVASYGSGGYGGYGGYGDYGGYGAY
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A2V5URB2      -----------------------MSSISHLPVQSWSPTAFIGFSQPSCTSGPVSLLLDNK
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      --------MPLNGTAGVSPGLALLWPWSPCACNGHSAAFSSGLIIPVNGNIGTVRLYRTD
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ---------------------MENTESKDNSGQKTVKRVIKKRIISDAAGAYGYGPGYGG
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------MDPSQSAQTQPN
A0A1H1MGC9      ------------------------------------------------MDTVPKAEKAQG
A0A2A2PYE8      -------------------------------------------------MSSESGEKQSQ
A0A2T6CN73      ------------------------------------------------MAAEQEKHAPGE
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      TNSSSSSGSASGTNNTSRGSQRRGYGGGGYGGNYGGGYGGGYGGNYGGGYGGGYGGGYGG
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A5C9DC49      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ---------------------------------------------MKNDYVRGAPDPNSG
A0A2E9IN28      ---------------------------------------------MKNDYVRGGADPNTG
D5ENH7          ---------------------------------------------MKNDYVRGGADPNSG
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ----------------------------MRNTTESMVQDPQEEASKRKPNYHNYHSYHNH
A0A351MR11      -------------------------------------------MPSSYILRQRDDGNTSY
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------MKNEYVRGAPDPNAGGYA
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A5R1Q5N3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ---------------------------------------------------------MSQ
A0A4Y8P842      -----------------------------------------------------------M
B3DZK9          -----------------------------------------------------------M
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5C9DS93      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      -----------------------------------------------------MGVFLFL
                                                                            

A0A2A2XVF1      SPYFKMLDPSRPPAEKRFGSVLPTIHSSLDEVGTALDLRRIYHLLLQRW-----------
A0A2V5UHJ2      MEQVNQPSPYFIRRTLRPENQTIDLHEFSVVEDQVLPLRDYWLIIKRHR-----------
A0A2V5PST3      PYNMRTYFPENDTQRPALPDSSESDYAYYGSEEERVQLLDYWKNLVKRR-----------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ----MAEPAGSSPTPPVPLGAAPSSSAADAPVEQRRSLRDYYVILRERF-----------
A0A1D8AZK8      ----MSVP--DSPPSSSAAQRAASLHGNDHQVVERRSLRDYYIILRERL-----------
A0A1V5QB01      -MENILRPPRPPTAGDAPAQPVSIGSPPPAKGFGIADLKHYFHIVVKRI-----------
A0A139SPN4      -----------------------------MPAGQSRSLRDYYVILRERF-----------
A0A1V6E7N1      -------------MADVSAKSTHHSPGKDEEVVERRTLRDYLIILRERL-----------
A0A2D9MYT1      -----------------MXQXPFNESREEGLFEESINLRHYWHIVLERR-----------
A0A258ANJ7      KASFNTMQPTSLSLPQSPMEMTQRLEADSESSSSFMNPAQLVDGMRRHS-----------
A0A139TLN4      -----------------MKSSSPKPDSLETEGGASVSLFPSPRALLARI--------IRN
A0A290QGD9      SPAPHGGPDQAPESPYGYGAYQQPP-----DGPQQRGFQDYVLILRERI-----------
A0A1D8AS58      KADKVQGPGEA-YPAYYGGGQGGYGVLGQGESQMHRSMQDYLLILRERV-----------
I6AQC1          KQPK---ASDG-RAEYGYGGYNEYPGYGN-EASGQRTLSDYLLILRERI-----------
W0ITH7          KQPN---PSDG-RAEYGYGGYNEYPGYGN-EASGQRTLSDYLLILRERI-----------
A0A1G3ZFT0      --------------------MNTLTHGKANQENIEIDFVALFHQLLEHK-----------
A0A1Z8ZMT6      -------MAKLRSTPEPVDSYYDEAQAEIKKSPGLFDLAYLLPRLIARW-----------
A0A2E8MCT7      -------MAKLRSAPGPVDSYYQETKADIKKSPGVFDLAYLLPRLIARW-----------
A0A290Q2Z2      RVWWWRPEKTSLLTGGEGNSLAARSMAHTHVSKEGASLADFFHLLRLRK-----------
A0A2A2RGK2      -------------MSTDKVIQPRPPESAPP--IESIDWREYFHAVIDRL-----------
A0A2A2XXF7      -------------MNKETDLKKPPSASPPPPSQEGIDWREYFHAVVDRL-----------
A0A2A2R5D6      --------------------------MAAPASEVSLHFLDYWRVIRNRA-----------
A0A1J4XH17      NKNEPEDQKSYGGYYNGYGSYSYGYGSGAYEENNQRNIKDYLLILRERV-----------
A0A3C1VJ32      ----------------------MDQVTTSAAPEARLHFLDYWRVIRIRK-----------
A0A2N9NTX7      ----------------------MDPIPVPPPQESKLHFLDYWRIIRIRK-----------
B9XK55          ----------------------MDPLKTSAPPEAKLHFLDYWRIIRIRK-----------
A0A4P5YMI6      ----------------------MEAEAISSQPETKLHFLDYWRIIRIRK-----------
A0A2E6T482      ----------------------MDKIPTTDQSSDKLHILDYWRILRVRF-----------
A0A3C0DQZ7      ----------------------MDKIPTTDQSSDKLHILDYWRILRVRF-----------
A0A1Z9CBK5      ----------------------MERNTGSDQSSDKLHILDYWRIIRVRI-----------
A0A2D6ZI96      ----------------------MERNTGSDQSSDKLHILDYWRIIRVRI-----------
A0A358KGZ3      ----------------------MEPTSRKENSSDKLHILDYWRIIRVRI-----------
A0A2E9ZQX4      ----------------------MEPTSRKENSSDKLHILDYWRIIRVRI-----------
A0A3D5JZU0      ----------------------MEPTSGKENSSDKLHILDYWRIIRVRI-----------
A0A2E6HCR0      ----------------------MDNNSGSEQSSDKLHILDYWRIIRVRI-----------
A0A1Z8WN04      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2D7L1N4      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2E2R937      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A520QQY4      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2D5MR66      ----------------------MDKTSGLEQSSDKLHILDYWRIIRVRI-----------
A0A2E0PDQ1      ----------------------MDKTSGSEQSSDKLHILDYWRIIRVRI-----------
A0A2E2ZZP9      ----------------------MDKTSGSEQSSDKLHILDYWRIIRVRI-----------
A0A2A2RGF2      -----------------MDAAPKPTDSAPATPENRLHFLDYWRIIRMRA-----------
A0A2G4I5Y6      -----------------MDAAPHQAEPAPATPENRLHFLDYWRIIRMRG-----------
A0A3M1I883      ----------------------MQSTSSSARPQTEFHFLDYWRIIRIRK-----------
A0A1V6JZ45      ----------------------MDATKPNPISDSQLHFLDYWRIIRIRK-----------
A0A520RRW5      -------------------MQTKPSQQPQQQSDSKLHFLDYWRIIRIRK-----------
A0A356NPK0      -------------------MQTKPSQQPQQQSDSKLHFLDYWRIIRIRK-----------
A0A2D7B5P5      -------------------MQTKPSQQPQQQSXSKLHFLDYWRIIRIRK-----------
A0A3D3XGB5      -------------------MQTKPSQQPQQQSDSKLHFLDYWRIIRIRK-----------
A0A2V6F8A1      ---------------------MEAPKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A2V5TNH4      ---------------------MEAAKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A2V5X5Q6      ---------------------METAKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A2V2DJ66      YGGYGAYGGYGG-----YGYGTNPAASGEGAEAPNRTLRDYFMILRERL-----------
R7L5A9          GGGYGGYGGYGGSYGGYYGGYNSKNPAGEGG-VPNRTFRDYMMILRERF-----------
A0A4P5QM05      ---------------------------MTESNEAKLHFLDYWRVVKLRL-----------
A0A4Q3C001      ---------------------------MIDSSEVKLHFLDYWRVIRVRA-----------
B4DB23          ---------------------------MNDSNEVKLHFLDYWRIIRLRM-----------
A0A2V5URB2      EGPMKEISPHRARATMLLEDADLVSEPRLIESDEAPSLRDYWQIVRKHK-----------
A0A5R8KA81      -----------------MRKSPASSRKIQYDSTTAFTYSDIFHVLRDKA-----------
A0A5B5WU87      -------------MNDLSPKKESLDAVGAASVSLFPSPKAILGRIVRKW-----------
R7DZW0          -------------MKDLSPKKETLDVGGAAPASLLPSPRAIMGRIVRKW-----------
A0A2N8HID1      -------------MKDLSPKKESLDAGGAAPVSLLPSPRAIMGRIVRKW-----------
A0A2N8HS06      -------------MKDLSPKKESLDAGGAAPASLLPSPRAIMGRIVRKW-----------
A0A3R5R2M8      ------------------MNAAPNTTSPMEEEESSFSLDTVLVILRRFW-----------
A0A411SUQ6      SPGVQYFHTTFHPLSSMTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A2N8HZF2      ----------------MTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A354E720      ----------------MTKNTAPTPPGTENTEETALSLDTVLMILRRYW-----------
B2UPB6          ----------------MTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A2A2XXW5      ----------------MEEQFQSQQGNSMSGADPSINLRQYWHVILERR-----------
A0A2V6JLK8      ----------------MGGSPPKGPTGMAHNEEVKLHFLDYWRVIRIRW-----------
A0A2W5Z1A5      ---------------------------MAETDEGKLHFLDYWRVVRVRW-----------
A0A2V6EA09      ---------------------------MAHNDEVKLHFLDYWRVVRVRW-----------
A0A2V6GQI7      ---------------------------MAHNDEVKLHFLDYWRVVRVRW-----------
A0A3C1HEJ2      ----------------MATPSNYLPGDEGPEASSAVDLPSARTLIEKAW-----------
A0A522ULD9      -------------------------MADKEAPEVGLHFLDYWRVVRSRK-----------
A0A1V6JU76      -------------MSYSYYTSQAAPPEASESSSSNLNLRHYWNIVLQRR-----------
A0A1Q6UHJ9      GYGGGYGGGYGGGGYGYGYGYGGGQGEGGSPERPNRTFRDYMMILRERW-----------
A0A2V2BXR0      -----------------------------------------MMILRERW-----------
A0A2D8V0G3      ------------------MEFQQSSQATETSVAENLNLRHYWHILLERR-----------
A0A348S017      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A3C1UUV7      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A350I3V2      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A520RGV5      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A3D3XF90      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A2D7B522      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A356NIC2      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A2N8HDG3      ----------------MPDTSAPPAVPPAEESESSLSLDVITGILLRRW-----------
A0A2U8DZK4      -------------------------MAYSDPVKESAPLPAFLQTLNLRK-----------
A0A2T6DFL8      -------------------------MANVHAAPVGASVAGFLQILRQRQ-----------
A0A1D8AWD4      -------------------------MPTLPSTKDSATLGDFVGLLRLRK-----------
A0A4Q1C9S2      -------------------------MAFSPVSKDSATLGDFVGLLRLRK-----------
A0A178IH18      -------------------------MARPDSSSETAALPEFFQVLRQRK-----------
A0A2T6DT99      -------------------------MASTHASREGASLADFFQLLRLRK-----------
A0A1G3ZT33      -------------------------MASIITSRDGGSLTDFFNILRLRK-----------
A0A3E1E2T2      -------------------------MAQPSASKDSATLADFLRLLRLRK-----------
B1ZMW1          -------------------------MVPTSASKDSASLADFMQLLRQRK-----------
A0A3D1TI55      --------------------------MDEKQQDSSLHFLDYWRVIRARK-----------
A0A3R8IT45      DGR------YGYGYQEY--PGYGNENAAG-----HRTLGDYLLILRERI-----------
A0A1H1MGC9      SGEAYPYTYYGTSYSGYGSPGHGDNQ-------MQRSMQDYVLILRERA-----------
A0A2A2PYE8      NSSGYGYN-YGGNYAGYSAVGYGYGEGGGGGSHSQRTFQDYLLILRERI-----------
A0A2T6CN73      SGGGYSYG-TGGNYAGYSAAGYGYGD-AGESSTIQRTFQDYLLIVRERI-----------
A0A3E1ET42      --------------------------MREQLNESKMHALDYWQVIRNRW-----------
A0A2A2YDW8      ------------------------MQPQSSNSEAALHAVDYWQVIKNRY-----------
A0A352XLN9      ------------------------MQPQSSNSEAALHAVDYWQVIKNRY-----------
A0A3D0YP62      -----------------------MQPQNSQQNEASLHAIDYWQVLKNRY-----------
A0A3D3DV47      -----------------------MQPQNSQQNEASLHAIDYWQVLKNRY-----------
A0A2E5XJ49      --------------------MQNDLDRQSAASEASLHAVDYWQVLKNRY-----------
A0A2E6SBY8      --------------------MQNDPDRQPAASEASLHAVDYWQVLKNRY-----------
A0A2E5QMS4      --------------------MQNDPDRQTAASEASLHAVDYWQVLKNRY-----------
A0A2E7YXQ3      --------------------MQNDPDRQTAASEASLHAVDYWQVLKNRY-----------
A0A2E3H787      --------------------MRNGPDRQTSASEAALHAVDYWQVLKNRY-----------
A0A2E7AGN1      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A2E7AKY7      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A3D4CU34      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A2E8M146      --------------------MPNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A355S8S2      --------------------MPNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2D6DVN8      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A3C1W2R2      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2E3NAY6      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2E3II01      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A368B8C5      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A3R7RBB5      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2A2QX62      ------------------------MNPTTNTSEASLHAIDYWQVAKNRY-----------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      -----------------------MNTSAPQQNEAALHAVDYWQVIKNRY-----------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      GNYGGGYGGGYGRQRGGYGGGYGGGYGEGSSKDTEVSISTYVNMVRERI-----------
A0A139TV24      ---------------MPQPTVPPVSSPAPETPDSSLSLDIVAIILRRRW-----------
A0A2N8HT11      ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
R7DS70          ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
A0A2N8HNL6      ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
A0A146GCJ0      --------MPKDDGENLTSKPAVNLSFRDDTHGDLFDSERWFNLLRSKA-----------
A0A2T6D6H8      --------MVNKGAENKDRKSAAQVTLLRELSGEVIDFERLLNLLRARA-----------
A0A5C9DC49      -----------------MEPFEQPRAGDVSPEAGTLFNRNLWHAFMEKA-----------
A0A139TUL1      ----------------------MSIPVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HCB0      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HP04      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HRJ0      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A366HAG0      -------------------------MATPNNLELQRHALDYWQIIRNRL-----------
A0A3M1I8A3      ---------MAYQAYPQTAPADPVSLPPAGGAMGSMTLRHYWHVLLERR-----------
A0A4V0XS84      -------------------MNSKGNLTQSKSLADKIDFNEYWNVLRDQR-----------
A0A0R2XQ77      GYSGYG-GYG-SNSYSDGGYGAG---GYGAGGAPQRSFKDYFLMFRERV-----------
A0A2E9IN28      GYGGYGYGYGYGGGYGYGGYGAGGGYGEGGGGAPQRSFKDYFLMFRERI-----------
D5ENH7          GYGGYGYGYG-GGSYGYGGYGSGGG-GAGYEQGPQRSAKDYLLMFRERI-----------
A0A351WE84      ------METSEATRASLVILGCGVKFMADSQQDTALHFLDYWRVIKSRK-----------
A0A1V5QDZ6      -------------------------MEQQPSDSSGLHFLDYWRVIRSRK-----------
A0A4Y8P964      --------MSEEIQRIPDQNFPSGQIQDPNSNLTAIPSDPYYSFSTGQWLKDRLKEIYRY
A0A3D4HF88      GYHGYHGYGGHGGAGYGGYGYGYGDDYSTQHRQPPRTFRDYIFILRERI-----------
A0A351MR11      SGGYGGYGGYGAYGESRYGGYGSVPAPGYGQAAGVNPLANYMLMLRERM-----------
A0A5B5WI95      -----------------MVNRPSPSPPVMEEEESNLSLDLALAILRRYW-----------
A0A2N8I9W1      -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
A0A4Q5IH27      -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
A0A2N8IBZ6      -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
A0A2N8IJW9      -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
R6J100          -----------------MANNTAPTPPVTENTEETTSLDTVLLVLRRYW-----------
A0A1V6J089      --------------------------MAEESQTTALHFLDYWRVIRDRK-----------
A0A3C1BZR1      --------------------------MAEESQTTALHFLDYWRVIRDRK-----------
A0A1H6KPB7      ----------------------MSSPAINQKSEASLHAGDYLQILRNRW-----------
A0A2E9ISN4      -----------MQIPNSTISESKPPTPADNDRETTTAFSNPWALVQLIF---------RH
B9XAX1          ---------------MKLRLSNEREIAEMTEVDRPLDVQEFLQTLIEKW-----------
A0A5R8KKM9      -------------------------MNPSPPQEHRQHALDYWQIIRNRL-----------
A0A139TS01      -----------------------MNAPDQQNGDPIVRNIDYIQVLKNRW-----------
A0A3E1EJT7      -------MNPPSPYARSSYAPVNPDFTDGEEPEDNDYLRRWWVMVLERK-----------
A0A317ZP96      GGYGYGSYGYGGGYGYGGAGYGYGGGYGGGGGGPQRSFKDYFLMFRERI-----------
A0A2D5WGA5      ----------------------MDKLPKTDQSSDKLHILDYWRIIRVRF-----------
A0A2E7SSH2      ----------------------MERKPGTEHSSDKLHILDYWRIIRVRI-----------
A0A349GXM8      -------------------MATPRPGGGVSTEENKIDFRIYLSVMLFRW-----------
A0A4P5YP61      ------------------MIQNRSESEFDQEAGSSVDLRQIYHVFLERI-----------
A0A5R1Q5N3      ---------MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSFSTGEWLKERFNEIYRY
I0JYY7          ---------MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSFSTGEWLKERFNEIYRY
A0A4R7S1J2      ------MSLSSLPPQGPTRLNLPKTFSQDLESEADFDWRGLLITAREKL-----------
A0A2A2XV69      ------------------------MMNSSDSNEIQLHFLDYWRVIRIRL-----------
A0A651H7X9      QPPHQEPESTRPTPHRYAYSDSGIDSSPYGEGGPQRSIKDYILILRERI-----------
A0A4Y8P842      SEELQKKPEDVLAVGSKEALPTEVLLSPYESSDLDWIKQKLWDIYRFRR-----------
B3DZK9          SEELQKKPKDNLTVGNKDVFQTEVLLSPYESSDLEWLKEKLWDIYRFRK-----------
A0A5E6MPC4      ----MEEIQPRPRESLGPLASGALPLEVSEEGSGWESVRSLLSDVNRYR-----------
A0A4V1SB02      -----------------------------------MNPLHYLYLFLRYS-----------
A0A3C1VB86      --------------MPNPDPLDLPPSLETSAPGSISDLHGVIRLLLDKS-----------
A0A146G2Q9      -----------------------MSLESPDSGEIKLHFLDYWRVIRVRL-----------
A0A2T6D3Y2      -----------------------MSFESPDSGEIKLHFLDYWRVIRVRL-----------
A0A2V2SDV4      ----------------------MDPIKAAAPQDSKLHFLDYWRIIRIRK-----------
A0A2V5PK75      ----------------------MDPLKVPASQETKLHFLDYWRIIRIRK-----------
A0A1V6DME1      ----------------------MDPLKTTPPPETKLHFLDYWRIIRIRK-----------
A0A3D3DIJ3      ----------------------MDPLKVAPPQEAKLHFLDYWRIIRIRK-----------
A0A2D5VY59      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A2D8UZZ4      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A353DV86      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A2E5EPT8      ---------------------MEYQSNGPTSSDNRLHFLDYWRILRLRK-----------
A0A5C9DS93      -----------------MDAASNYATPAAGTPENRLHFLDYWRIIRMRG-----------
A0A350EWA4      -----------------------MDSFKQDQPTASLHFLDYWRIIRIRK-----------
A0A5B5WZ91      -----------------------MNAPDLQNGDPIVRNIDYIQVLKNRW-----------
A0A2N8HD92      -----------------------MNSQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8HIT2      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A354EBD3      -----------------------------------VRNIDYLQVLKNRW-----------
A0A355VEB2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8IMT3      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
R6K1U5          -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8IWC2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8I441      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8I3A6      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A410SCC4      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A3R5VEW0      -----------------------MSVQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A411SSG2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
B2UKW3          -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A1M6RLZ4      ----------------------MQQNNSLNPSEASLHAVDYWQIVKNRY-----------
A0A354T7G8      --------------------------MNETGSEFQKHAMDTWQVVKNRI-----------
A0A2S7U4L6      ----------------------MQPNNSLNTSDATLHAVDYLQILKNRY-----------
A0A512MBZ2      --------------------------MSEAGKDIQAQAIDSWQIIRNRF-----------
A0A2E8MEZ0      ------------------------MQGTNFRNADDAPSVDYWQVVKNRY-----------
A0A4Q2YKS3      -----------------------MQSPSTQQSEAALHAVDYWQVIKNRY-----------
A0A2E3EC33      ---------------------------MAKQSETKLHALDYWQVIRNRY-----------
A0A2E4GN01      ---------------------------MAKQSETKLHALDYWQVVRNRY-----------
A0A1Z8XU55      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2E1RQR9      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2E3ISQ4      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2D6W6F4      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2D8Z5A8      VEKTSECSYFADSKFILNSPQIKYIXTMAKQSETKLHALDYWQVARNRY-----------
                                                                            

A0A2A2XVF1      -WVITLLVGVSMMAATGYV-MRQPKIYESRAVLQVQQSEQQVVNI-------DGVSQENP
A0A2V5UHJ2      -WLILSCALALFIGATLYT-FTRTPLYTADATLLIERKAPQILKL-------QDARADSV
A0A2V5PST3      -RIIIQIFIIFLLVGAYFT-FTATPVYKATATLKIEPINPMVT---------GVTGVGES
A0A2V5PXM3      --------MVAAIGTTTYL-LRAPKIYASKLVLQVEQEEQKILNI-------QRVQQEDP
A0A139SU05      -WIALPLALLVSLVIGYYQ-ARQTPMYASTAIIQFERPETVVTT--------QTVMDATI
A0A1D8AZK8      -WIALPVALLVSLSVGYYK-AQETPMYSSVATMQFERPERVVQN--------EQVVDTSV
A0A1V5QB01      -WLVALCFVLSLTVMVAIL-VRQVPVYRCRVTLLMSKGVPMPYSL-------RQVESQPM
A0A139SPN4      -WIALPLALLVALGIGYYQ-ARQTPMYASTAIIQFERPETIVTT--------QGVVDASI
A0A1V6E7N1      -WIALPIALLVAVGIGYYQ-SRATPLYQSRATLRFEKPDRIVAT--------EGVTRPEV
A0A2D9MYT1      -WLVAATFLVVIILTAFYL-FSATPIFSATTRLQIDRETENALRM-------ESFVMEGA
A0A258ANJ7      -WIPITLSLFGLILGYAYF-KRQKPVYEAVSVAQFGSEQSSLLGL-------NSMSTPGL
A0A139TLN4      WYWCLLSLCICLPLAYLYA-ARLPFVYGKATTVLIKNDYPKESVA-------TTVLATSN
A0A290QGD9      -WYILAVFLVIFSCVLVYT-LTQTKIYQSRSLIQILRRDPAVLKV-------QSVTDNDV
A0A1D8AS58      -WYIVLVFALVFSAAVIFT-FTRVPRYTSVASVQVFRNDPVVMQV-------QSVVNNEI
I6AQC1          -WYIVVVFLVIFSSALVYT-FSQTKIFSSSATVQIMRRPAMTLPT-------PELLPTNV
W0ITH7          -WYIVVVFLVIFSSALVYT-FSQTKIFSASATVQIMRRTAVTLPT-------QNPIDNNV
A0A1G3ZFT0      -WLIAVIIAISLMGGKYYA-SKQIPVYNPDVLIQVESNRGVSGLTIGLPGMGGGSGPSLG
A0A1Z8ZMT6      -HWILIGSLLGVVLGVITI-RMSVPEYRSTATVRVKSQNSGSMGNSSDSDDIDLQSLEAA
A0A2E8MCT7      -HWILIGILLGVVLGVINI-RMSVPEYRSTATVRVKSQNSGSMGNSSESEDIDLQGLEAV
A0A290Q2Z2      -ALIFLILSLVVITTVVVT-AFLPKWYLSTLNVRVEKPEGEVKLF-----------QAQS
A0A2A2RGK2      -WIVILCVILGGIYAGFTL-SKIETTYRARAVLFIEQDQARIL---------DPRFSQVR
A0A2A2XXF7      -WIVILCVVVGGIYAGVTL-SKVETTYRARAVLFIEQDKSRIL---------DAKMEQVR
A0A2A2R5D6      -AIIVTVLLLTLMTGYVVTVYVMQKMYDAKAQLRVYKEKSDVEFM----------GNSRT
A0A1J4XH17      -WLLVFVFAIIFLGSIIYL-IKATPIYEAEAMLQILRDDTTVLGV-------RSVESNEV
A0A3C1VJ32      -AIIITVFLITAIIATAVT-LILPESYASTARIKVENEGGIVSGM---------GNSPAA
A0A2N9NTX7      -TVILAVFLLVVITATVVT-FILPPKYKSMARIKIERDQTDIPSL---------TQQQGS
B9XK55          -TVILAVFLLVVITATIVT-FILPEQFSSTARIKVEGDTTDVPGI---------TQTPNY
A0A4P5YMI6      -MVILTVFLLVVITTTAVT-YVLPKTYMSSVRIDVQKDVSDVQ-F---------SGMSE-
A0A2E6T482      -VTILLVFLLTAVTTTVVT-FLLPRTYMSLSRISVEKDSSDIAPL---------LGMQAG
A0A3C0DQZ7      -VTILLVFLLTAVTTTVVT-FLLPRTYMSLSRISVEKDSSDIAPL---------LGMQAG
A0A1Z9CBK5      -ATILLVFLLTAITTTVVT-VMLPSTYMSLSRIAVEKDTSDIAPL---------MGVQAT
A0A2D6ZI96      -ATILLVFLLTAITTTVVT-VMLPSTYMSLSRIAVEKDTSDIAPL---------MGVQAT
A0A358KGZ3      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPL---------LGMQAT
A0A2E9ZQX4      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPL---------LGMQAT
A0A3D5JZU0      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPL---------LGMQAT
A0A2E6HCR0      -ATILLVFLLTAITTTVVT-FLIPPTYMSISRIAVEKDTSDIAPL---------MGVQTA
A0A1Z8WN04      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPL---------MGAQSS
A0A2D7L1N4      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPL---------MGAQSS
A0A2E2R937      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPL---------MGAQSS
A0A520QQY4      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPL---------MGAQSS
A0A2D5MR66      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPL---------MGVQAS
A0A2E0PDQ1      -AIILVVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPL---------MGVQAA
A0A2E2ZZP9      -AIILVVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPL---------MGVQAA
A0A2A2RGF2      -LLIFVVFALVVGTTALLT-HNMEPTFMSTVRMDVQKDVGDISSL---------MPQQQ-
A0A2G4I5Y6      -LLIFVVFALVVGTTAVLT-HSMEPTYMSTVRMDVQKDVGDITSL---------MPQQQ-
A0A3M1I883      -MVILAVWLLVVLTTLAVT-FVLKPTYASTVRIEIEKDATDIPTI---------GGQQR-
A0A1V6JZ45      -TVILAVFLLVVLTTTAVT-FVLKPTFMSTARIEVEKQPTDFDPF---------LRPQV-
A0A520RRW5      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPL---------MGLQA-
A0A356NPK0      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPL---------MGLQA-
A0A2D7B5P5      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPL---------MGLQA-
A0A3D3XGB5      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPL---------MGLQA-
A0A2V6F8A1      -TVILAVFLLVVLTTTAVT-FILPESWSSMVRIAVEKDISDISPL---------GITQN-
A0A2V5TNH4      -TVILAVFLLVVLTTTAVT-FILPESWSSTVRIAVEKDVSDINPI---------GFAQN-
A0A2V5X5Q6      -TVILAVFLLVVLTTTAVT-FILPESWSSTVRIAVEKDVSDINPI---------GFTQN-
A0A2V2DJ66      -WYIIVTFIVIFSGIALYT-LRITPLYTSASSVLIFREAAA-----------PIDGPGSS
R7L5A9          -WYIIVTFFIIFAGVLLYT-FRITPIYTSAASVQILRDSDS-----------PIDGPGST
A0A4P5QM05      -GLILLTFFLVMVSAEVYV-YFLPRQFYSHVTVEIKPDVFDRL---------NEVGTQTS
A0A4Q3C001      -GLITLVFLLVMITAGVTT-YFMPRQYLAKVSMVVKPDSTKGV---------SIFESSA-
B4DB23          -GLILLTFFLVMVTAGVTT-YFLPKKYYSKVTMEVKQDKSDLV---------QTFGPGQF
A0A2V5URB2      -WKILACFLAAVVITAIIV-FSMTPIYTATATLLIERKAPQVVKIQQVLSESIEADER--
A0A5R8KA81      -WLIVLCLLVAAFIVAAML-VRSVPLYQSRVVVQVEQSETKVL---------DSVQEVNP
A0A5B5WU87      -YWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYPK-----------ESVAATVL
R7DZW0          -YWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYPR-----------ESVAATVL
A0A2N8HID1      -YWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYPR-----------ESVAATVL
A0A2N8HS06      -YWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYPR-----------ESVAATVL
A0A3R5R2M8      -FLIILAAIAGGSLAFYLA-GRQNYVYQKTASVMMRDAKSGTDAS-------SERIMSEL
A0A411SUQ6      -FIIILAALAGGTAAYYLA-GKQNYIYQKTASVLMRDAKTGSDAS-------SERIMAEL
A0A2N8HZF2      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDAS-------SERIMAEL
A0A354E720      -FIIILAALAGGTAAYYLA-GKQNYIYQKKASVLMRDSKTGSDAS-------SERIMAEL
B2UPB6          -FIIILAALAGGTAAYYLA-GKQNYIYQKTASVLMRDAKTGSDAS-------SERIMAEL
A0A2A2XXW5      -WLIVATWSVCIIAGVLYA-FQATPMFRAIARLQIDPENQGVLNL-----------NSMA
A0A2V6JLK8      -VLVLLAFLLVLITAAIFT-YFQPREYKADVFVEVKSTAENPRIF---------GQGDPN
A0A2W5Z1A5      -VLILLAFSLVLITAAVVT-YFQPREYQSSAFIEVRSTAQNPHIF---------SQIDPS
A0A2V6EA09      -GLISLAFFLVLITAAIVT-YFQPREYKASAFIEVKSTAENPRIF---------GN-DLH
A0A2V6GQI7      -GLISLAFFLVLITAAIVT-YFQPREYKASAFIEVKSTAENPRIF---------GN-DLH
A0A3C1HEJ2      --VVVLCLLAAGFITYGYL-KRAPVIYASTVTLKVEEQSQKIL---------SGLQEGVR
A0A522ULD9      -EIVLAVALLVIITVTAWT-MTLPRMYETEVKVSLKEDQADVEVF----------GPGGA
A0A1V6JU76      -WLVIATFVSVFVLCLVYL-FKAPRIYSATARLQIDRESAASLNL-----------NEVV
A0A1Q6UHJ9      -AYILITALIILAGVILYT-LRVTPIYMSVSRVQILRDSDV-----------AIEGPGST
A0A2V2BXR0      -AYILITALIILAGVILYT-LRVTPIYMSVSRVQILRDSDV-----------AIEGPGST
A0A2D8V0G3      -WLVITTFISVVILSVLYL-YRAVPIYQAKTVLQINKESTSI----------MDVGSQVV
A0A348S017      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSM----------MDGATPIV
A0A3C1UUV7      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSM----------MDGATPIV
A0A350I3V2      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSM----------MDGATPIV
A0A520RGV5      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSM----------MDGATPIV
A0A3D3XF90      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSM----------MDGATPIV
A0A2D7B522      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSM----------MDGATPIV
A0A356NIC2      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSM----------MDGATPIV
A0A2N8HDG3      -YWILLFALIGGGAAYYLT-GRQNYIFEKTASVIMRESSKEST---------SDRIKVDL
A0A2U8DZK4      -ALILLILALVVITTIAVT-AFLPKWYRSKASIRVLKIGTTSAVF-----------QAQS
A0A2T6DFL8      -WLIALILALVVVTTIGVT-AFLPKGYRATTKVRVERPDGQVKLF-----------QAQT
A0A1D8AWD4      -GLIFLVLGLVLLTTLGVT-ALLPKWYLSTAKISVQKPESEVKLF-----------QAQS
A0A4Q1C9S2      -GLVFLVLALVVLTTLGVT-ALLPKWYLSTTKISVQKPESEVKLF-----------QAQN
A0A178IH18      -FLILLVMALVVGTAAVVT-ALLPKWYLSTINIRVEKPEGKV-VF-----------ENQA
A0A2T6DT99      -ALIFLILSLVVVTTAVVT-ALMPKWYVSTLNVRVEKPEGEVKLF-----------QNQQ
A0A1G3ZT33      -ALIFLILALVLLTTLGVT-ALLPRWYLSTVAMRVEKPESEVKLF-----------QAQS
A0A3E1E2T2      -SLILLILSLVVITTVAVT-AFLPRWYLATAKIRVEKPESEVKLF-----------QAQS
B1ZMW1          -ALIALILGLVLITTIVVT-AFLPRWYLATTKIRVEKPEGEVKLF-----------QAQS
A0A3D1TI55      -EIIITVSVLIILTVFIIT-LIMPEKYRASVRITIDQYRPDIELV-----------DRGR
A0A3R8IT45      -WYIVVVFLVIFSSALVYT-FSQTKIYRAMATAQILRKTATMF---------SQSREMLD
A0A1H1MGC9      -WYIVLVFALVFSAATIFT-FTRVPQYQSVASVQVFRRDPVVM----------QVQGVVD
A0A2A2PYE8      -WYIVVVFLVVFSSSLVYT-LSDTKIYQSSATVQIFRRDPTVM----------QVQQVVD
A0A2T6CN73      -WYIVVVFLVVFSSALVYT-LSKPKIYESTATVQIFRRDPTIM----------PGQQVVD
A0A3E1ET42      -GVILLTFFLIALASLVII-ALLDKKYQSTTRFRVLL-----------S---SAIDPFQT
A0A2A2YDW8      -GVILITLLLVFMTAAVIT-YVMPRKFESRAVVQVNP-----------S---NRFGTAFG
A0A352XLN9      -GVILITLLLVFMTAAVIT-YVMPRKFESRAVVQVNP-----------S---NRFGTAFG
A0A3D0YP62      -GVILLTFLLVFLTAAVIT-YVMPKKYESAALVEVKP-ISDIDPVGMRG---GGIGTPM-
A0A3D3DV47      -GVILLTFLLVFLTAAVIT-YVMPKKYESAALVEVKP-ISDIDPVGMRG---GGIGTPM-
A0A2E5XJ49      -GVILLTFLLIFMTAAVIT-YVIPKQYESTALVQVNHSFVELDPL---N---GVAGAPMT
A0A2E6SBY8      -GVILLTFLLIFMTAAVIT-YVIPKQYESTALVQVNHSYIELDPL---N---GAAGPPMT
A0A2E5QMS4      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---N---GAAGHPMT
A0A2E7YXQ3      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---N---GAAGHPMT
A0A2E3H787      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---N---GAAGRPMT
A0A2E7AGN1      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---N---GSVGQPMT
A0A2E7AKY7      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---N---GSVGQPMT
A0A3D4CU34      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---N---GSVGQPMT
A0A2E8M146      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---N---GSVGQPMT
A0A355S8S2      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---N---GSVGQPMT
A0A2D6DVN8      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---N---GSVGQPMT
A0A3C1W2R2      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---N---GSVGQPMT
A0A2E3NAY6      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---N---GSVGQPMT
A0A2E3II01      -GVILLTFVLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---N---GSVGQPMT
A0A368B8C5      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---N---GSVGQPMT
A0A3R7RBB5      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---N---GSVGQPMT
A0A2A2QX62      -GVILLTFLLVFMTALVIT-YVMPKKYESTAVVQVRPKGAGAVMM---P---GTEPRGQ-
A0A4Q3BWH6      --------LLVFMTALVIT-YVMPKKYESTATVQVRPMGTGTQVI---P---GVTDNRS-
A0A3N5WCF1      -GIILLTLLLVFMTAAVIT-YVMPKKYESQAVIEVKPRMPGMSPL---G---AAMTETSG
A0A4Q3C1K5      ---ILLTLLLVFMTAAVIT-YVMPKKFESEATIEVKPRSAGISPL---G---PGFSDNQ-
A0A2G4G428      -WWLVLSVLIFFTLSLVYT-YNMMPEYKASGRLRVFRLAPNISG--------SNTAAESN
A0A139TV24      -YWILFCALLGGTAAYYMA-ATQNYVFEKTASVMMREASKD-SS--------TDRIMVEL
A0A2N8HT11      -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDSSS--------SDRIKVEL
R7DS70          -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDSSS--------SDRIKVEL
A0A2N8HNL6      -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDSSS--------SDRIKVEL
A0A146GCJ0      -WLIAAVAVVVVIGAAAYA-FRLPKIYESRALLQVEQLAQKV----------VDIADVSQ
A0A2T6D6H8      -WLVIVVAVIFFAAAFAYA-LRSPKIYESRALIQVEQASQNV----------VDIDDIAR
A0A5C9DC49      -WLVVCIMAAAAAAGIWTS-NRTPPVYQSRAVMFFDFGEQKV----------LNIEDVDK
A0A139TUL1      -LWILAAALLGGAGAYFIF-ARQGYLYEKTARIMLRDDKQKNSQV-------SEIILSDL
A0A2N8HCB0      -PWILACALLGGGLAYFIS-ARQGYLYQKTARIMLRDDKQKNAQV-------SEIILSDL
A0A2N8HP04      -PWILACALLGGGLAYFIC-ARQGYLYQKTARIMLRDDKQKNAQV-------SEIILSDL
A0A2N8HRJ0      -PWILACALLGGGLAYFIC-ARQGYLYQKTARIMLRDDKQKNAQV-------SEIILSDL
A0A366HAG0      -GLILASFIFIFAVAAVLT-YIMPRKFRGRVEMVIERKLDDARVV-------GNANLQDD
A0A3M1I8A3      -WLVIMVLILSVAASVGYV-VKAPRIFRATVRLQIDPESETGV---------NLRDGFGG
A0A4V0XS84      -YLIVATFICVFASCVFYL-YKAPRIYQATVSLQVDKDSDNAL---------SGIKGVVV
A0A0R2XQ77      -WYLIVAFFIIFSGSILYT-FNKTKVYTAVATVQLLRDDPSAM---------A-SAEMEM
A0A2E9IN28      -WYLIVAFFIIFSGSILYT-FNKTKIYTAAAQVQLFRDDASAL---------GKGAEMEQ
D5ENH7          -WWMIVAFFIIFSGAILYT-FNKTKVYTAVAQVRLLREDPAAM---------GDQVDLAQ
A0A351WE84      -EIVMAVTLLIVITGVAVT-FMQPKKYSSTVRILVREDSMDVDVF-----------ERQM
A0A1V5QDZ6      -EVILAVLLLVVVTGTSFT-LTLPKKYMADARILVRDDSLDVDVF-----------ERQI
A0A4Y8P964      KAIVLISFLLILLFTIIFT-FTQQPVYQGVTTVKINFNKSEVLPY-------KSVGEDQA
A0A3D4HF88      -WFFLVIFLIVFLGSVLYT-FNTTPLFTAGATVQVLRDPVNPLG--------AGAEDITK
A0A351MR11      -WYLVLTVLVFVTAALIYT-VNATPEYRASGRLKVYKYAPNIT---------GRGAGEEL
A0A5B5WI95      -FIIMLAAVAGGMLAFYLA-GRQNYVYQKTASIIMRDAKSGTDAS-------SDRIMSEL
A0A2N8I9W1      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDAS-------SERIMAEL
A0A4Q5IH27      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDAS-------SERIMAEL
A0A2N8IBZ6      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDAS-------SERIMAEL
A0A2N8IJW9      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDAS-------SERIMAEL
R6J100          -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDAS-------SERIMAEL
A0A1V6J089      -EVILAVALLTIVSGTAYT-LMMPKKYTALTQIQVREDAMDVDPF---------YQRDIN
A0A3C1BZR1      -EVILAVALLTIVTGTAYT-LMMPKKFTATTQLEVREDAMDVDPF---------YERQAS
A0A1H6KPB7      -KEAVLVFVLVFVAAAVAT-YLMPPSYTSVINFEIKKPGAIVSL--------SRGAERVL
A0A2E9ISN4      WSWLVCSVVLCTLLGGLYA-YLATPIYRATARIEILNDS-------------RVETRATT
B9XAX1          -WLIVLVTCAVTLPAFWWV-RNVPVGYQARAVLQVEQEEQRL----------VGIEEVSR
A0A5R8KKM9      -GLIFLCFLLVFAAAAVIT-HVMPRKYRAVVEIELKRQLKDTNVFGQLNQNNNLAGD---
A0A139TS01      -KEVFLVFMLVLVISLVVT-LLMPPSFRATSKFQIKRPRPVMGI--------GTGEDVVA
A0A3E1EJT7      -WYALAAFVVIVAGVSAYT-FLSTPIYAGQVTVQVLKHGSQV----------MRVADVVD
A0A317ZP96      -WYLIVAFFIIFSGSILYT-FNKTKVYTSAATVQLLRDDPSAL---------GDTVEMEQ
A0A2D5WGA5      -INIMLVFLLTALTTTLVT-FLLDKTYMSQSRISIEKDTSDIAPL---------LGMQTG
A0A2E7SSH2      -ATILLVFLLTAITTTAVT-FLIPATYMSLSRIAVEKDTSDIAPL---------MGMQAT
A0A349GXM8      -QLIALCFLYTMLGAVAYL-YLAPKTYESNTKIMIYRDPLLT----------------VS
A0A4P5YP61      -WAVLLVLTLTTFLGGLYV-VRSPKIYSATLTLQVEQESKIVDLT-----------KFKP
A0A5R1Q5N3      KAVVVISFLLILLFTILFT-FTQKPVYRGVATIKINFNKSEVLPY-------KTVGEDQA
I0JYY7          KAVVVISFLLILLFTILFT-FTQKPVYRGVATIKINFNKSEVLPY-------KTVGEDQA
A0A4R7S1J2      -WLLILLPLIGAAVSYGYL-KQAKPVFSSNATLEVEEKQRVVDVK-----------EVTD
A0A2A2XV69      -PLIVLVFLLVVITTGVVT-YFLPKQYESSVTMQVNQNDTYLQVF----------DDRGG
A0A651H7X9      -WYIIIIFLAVFSAALIYT-LTRPKVYEAVASVEILRTSPVV----------LQVQDVLD
A0A4Y8P842      -QALLF-FLVVLFIVLLFT-FTQKPIYRGESLVKVNSTKAEVVPY-------KQVSNDEP
B3DZK9          -QALLF-FLVCLFVVFLFT-FSQKPIYRGESVVKINSTKSEVVPY-------KQVSNDEP
A0A5E6MPC4      -GAALLFFAAVFLLTVVAT-FSQKPIYEGIAVVKIGTGAESSSIVPYRQIGQDQIGQESA
A0A4V1SB02      -WLIILIVAIMMGGTWAWL-SKQSPVYASRAVLQVDMDEGNL----------VNIEGLDS
A0A3C1VB86      -WLIVSCLVLALLAAAVYV-ERAPRVYAATTTVQVEQADAKV----------VKVEQVVS
A0A146G2Q9      -PLIILVLLLVVITAGVVT-YFMPKQYASTVTMQIRQNDKVLQVF----GQGGVQG----
A0A2T6D3Y2      -PLIILVLLLVVITAGVVT-YFMPKQYASTVTMQIRQNDKVLQVF----GQGGVQG----
A0A2V2SDV4      -AIILAVFLLVVITTVVVT-FIYPESFSGTARIRVERDQSDIS---------GVLQGQAF
A0A2V5PK75      -TVILAVFLLVVITATLVT-FILPESYSSKARI----DSPDIS---------GIAKRMPT
A0A1V6DME1      -TVILAVFLLVVLTATLVT-WILPVSYSSEARIKVDRDVSDIP---------GMTQTPLL
A0A3D3DIJ3      -TVILAVFLLVVITATLVT-FILPESYSSKARIKIDRDQTDIS---------GLADRSTL
A0A2D5VY59      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPL----I------GMQM
A0A2D8UZZ4      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPL----I------GMQM
A0A353DV86      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPL----I------GMQM
A0A2E5EPT8      -GVIFVNFIFVVLVATFVT-YLLPKTYKSTVRMDVKK-----DTA----SDIELLGGTPQ
A0A5C9DS93      -LLIFVVFALVVGTTAVLT-HWMEPTFMSTVRMDVQKDVGDISSL----MPQQQQGGFDP
A0A350EWA4      -TVILAVFLLVVLTTTLVT-FLLPESYSSTVTIEVKKDSSTL----------DRIGGPTA
A0A5B5WZ91      -KEVFLVFMLVLVISLVVT-LLMPPSFRATSKFQIKRPRPVMGI--------GTGEDVVA
A0A2N8HD92      -KEVFLVFLLVLVISVVVT-FLMPPAYQTRCQFQIKLPKPVMEI--------GQGGDVVA
A0A2N8HIT2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMEI--------GQGGDVVA
A0A354EBD3      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
A0A355VEB2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
A0A2N8IMT3      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVIA
R6K1U5          -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVIA
A0A2N8IWC2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
A0A2N8I441      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
A0A2N8I3A6      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
A0A410SCC4      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
A0A3R5VEW0      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
A0A411SSG2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
B2UKW3          -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDI--------GRGGDVVA
A0A1M6RLZ4      -GIILLTFILVVVTAAVIT-YVMPKKYESVAQIEIKPLGIKTDTV----LGQDTSGRLMT
A0A354T7G8      -GLITLCFILIFAAAAILT-YIMPRKYRGHVEMTIERITQDINVF----DR-----NRGD
A0A2S7U4L6      -GIILLTFILVVLTAAVIT-YVMPKKYEAIAVVKINPLGTNNQVL----GS-------GS
A0A512MBZ2      -GLICLSFLLVFATAAIIT-YIMPRKYRGRVEMKIERLQNKVQVF----NRDTSDMLAGS
A0A2E8MEZ0      -GVILLTFLLVFMTAAVIT-SVMPRKYESSSVVQVHPSVLLMTPF----LG-GSQMTPGS
A0A4Q2YKS3      -GVILLTLLLVFMTAAVIT-YVMPKKFESSAVIEVKPRGQILSPF----GERGSEASGMD
A0A2E3EC33      -TVILLTFFLVIMTAAVIA-YLRPPEYLGRVQIQVQREARDLEVF----RETGSVGNLGT
A0A2E4GN01      -SVXLLTFFLVXMTAMVIA-YLRPPEYLGRVQIQVQREARDLEVF----RETGTVGNLGS
A0A1Z8XU55      -SVILXTFALVFMTALVIA-YLRPSEYLGRVXIQVQRVARDIEVF----RETGSVGNLGS
A0A2E1RQR9      -SVILXTFALVFMTALVIA-YLRPSEYLGRVXIQVQRVARDIEVF----RETGSVGNLGS
A0A2E3ISQ4      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVF----RETGSVGNLGS
A0A2D6W6F4      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVF----RETGSVGNLGS
A0A2D8Z5A8      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVF----RETGSVGNLGS
                                          :                                 

A0A2A2XVF1      SSP---------DFINTVVQSITSRNLMLRVIDA------------NKLRT---------
A0A2V5UHJ2      DYNDYNN-----EFYKTQYEILKSRALAERVVRD------------EGLES---------
A0A2V5PST3      GAR-TAEGGGPYDYYQTQYKLLASSALAARVIAD------------LRLDS---------
A0A2V5PXM3      QSL---------EFLKTVEQTFESRSLFERVLDT------------NNLAT---------
A0A139SU05      RNE---------LDLNTYIHQLTSNRVRTRVLES------------LTPEE---------
A0A1D8AZK8      RSD---------VDLNTYIQILTSGRLRTMVSQS------------LTPEE---------
A0A1V5QB01      G-----------DYLATQQLIIQSGQLISRARAR------------LNKPA---------
A0A139SPN4      RNE---------IDLNTYIHQLTSNRVRTRVLES------------LTPEE---------
A0A1V6E7N1      QSE---------FDINTYLEILKSDKLRQRVVNS------------LSPQE---------
A0A2D9MYT1      REQ---------DYLQTQYKNLQSRSLMEMALEETLQNAMILDGLKAGRRN---------
A0A258ANJ7      GDE---------KSVNTLIQAAKSREVIGRVISE------------LNLTQ---------
A0A139TLN4      GIVNTAS-----TNLDNEIFLLSSYSLMEEVVRK------------LKLDVTYWKKSGFR
A0A290QGD9      RSL---------EDLNTIVQILESGTIIQKVSDR------------LTGEK---------
A0A1D8AS58      RSA---------EDLNTQVKVLESLAIVQRVADR------------LTGAD---------
I6AQC1          IST---------EDMNTMVKIFESPTIIQKVSER------------ITGDE---------
W0ITH7          LST---------EDMNTMVKIFESPTIIQKVSER------------ITGDE---------
A0A1G3ZFT0      SPA------------AIQIALIKSRYILTPVIQS------------LHLNT---------
A0A1Z8ZMT6      EDI-RSD-----FDRTELFLAVASDPTVRNLANL------------IPPEA---------
A0A2E8MCT7      EDI-RSD-----FDRTELFLAVASDPTVRNLANL------------IPPDP---------
A0A290Q2Z2      SGY-YDP-----YFLQDQFKIMQSAKVLYPVIEN------------LGLND---------
A0A2A2RGK2      DEQIRSI-----DMINTVVDLIRSYPFSQRVSAR------------LKLDQ---------
A0A2A2XXF7      DEQIRSI-----DMINTVVDLLRSYSFAQRVSAR------------LKLDQ---------
A0A2A2R5D6      DAP-FDL-----VFFTSEISTIQSKKILNPVIEK------------LGLQK---------
A0A1J4XH17      RTS---------EDLNTQIKVLESSTLAKAVADR------------LQKEN---------
A0A3C1VJ32      TSFGYDP-----YFIQTTFEIMQSQLVLSNVIAT------------MNLNV---------
A0A2N9NTX7      FSP-YDP-----YFMQTEFELMKSEVVLDKVIKN------------LNLNE---------
B9XK55          SGH-YDP-----YFIQTEFEVIQSEVILDRVIEG------------LNLNE---------
A0A4P5YMI6      SKA-YDP-----FFVLTQFEKLQSTAVIYPVITD------------LGLRE---------
A0A2E6T482      PTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK------------CDLTN---------
A0A3C0DQZ7      PTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK------------CDLTN---------
A0A1Z9CBK5      QSS-FDP-----XFISTEFEKIQSQVVLDAVVES------------CELQE---------
A0A2D6ZI96      QSS-FDP-----XFISTEFEKIQSQVVLDAVVES------------CELQE---------
A0A358KGZ3      QSS-FDP-----YFISTEFEKIQSQKVLDEVVKS------------CELRE---------
A0A2E9ZQX4      QSS-FDP-----YFISTEFEKIQSQKVLDEVVRS------------CELRE---------
A0A3D5JZU0      QSS-FDP-----YFISTEFEKIQSQKVLDEVVKS------------CELRE---------
A0A2E6HCR0      QSS-FDP-----YFISTEFEKIQSQIVLDAVVRS------------CELRD---------
A0A1Z8WN04      QSS-FDP-----YFISTEFEKIQSQIVLDAVVET------------CELRE---------
A0A2D7L1N4      QSS-FDP-----YFISTEFEKIQSQIVLDAVVET------------CELRE---------
A0A2E2R937      QSS-FDP-----YFISTEFEKIQSQIVLDAVVET------------CELRE---------
A0A520QQY4      QSS-FDP-----YFISTEFEKIQSQIVLDAVVET------------CELRE---------
A0A2D5MR66      QSS-FDP-----YFISTEFEKIQSQIVLDAVVAT------------CELRE---------
A0A2E0PDQ1      QSS-FDP-----YFISTEFEKIQSQIVLDAVVSS------------CELRE---------
A0A2E2ZZP9      QSS-FDP-----YFISTEFEKIQSQIVLDAVVSS------------CELRE---------
A0A2A2RGF2      QGG-FDP-----YFVMTQFEILQSKEVLYKVIDD------------LKLVP---------
A0A2G4I5Y6      QGG-FDP-----YFVMTQFEILQSKEVLYKVIDE------------LKLVQ---------
A0A3M1I883      DPS-FDP-----YFMATEFEKIQSMSVLMPVIHSPTNAAGEKLPPDRQFIP---------
A0A1V6JZ45      QNQ-FDP-----YFIQTEFEKIQSKPILYKVIES------------LDLRK---------
A0A520RRW5      AQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA------------LGLNH---------
A0A356NPK0      AQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA------------LGLNH---------
A0A2D7B5P5      AQQ-HDP-----YWVLTEYEKIQSKKVIHPVINX------------LGLNH---------
A0A3D3XGB5      AQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA------------LGLNH---------
A0A2V6F8A1      STQ-YDP-----FFLQTEFEKIRSQKVLYKVIDN------------LKLNE---------
A0A2V5TNH4      NSA-YDP-----FFIQTEFEKIRSRKVLYKVIEN------------LKLNE---------
A0A2V5X5Q6      NSA-YDP-----FFIRTEFEKIRSRKVLYKVIEN------------LRLNE---------
A0A2V2DJ66      DRT-RNDKVLSVEDFNTQVKILESNEVIRAVRSR------------LKEDD---------
R7L5A9          ERS-RNNVIMSMEDFNTQVKLFESAEIVKAVKSR------------MKEDE---------
A0A4P5QM05      SGR-IDP-----QFVATQIQVLKKAEILNPVIEK------------LNLVK---------
A0A4Q3C001      QRS-YDP-----AFVATEFHTLRKSDILYPVIDQ------------LELVK---------
B4DB23          RQT-YDP-----QFVATQFQILQKTEILYPVIER------------LDLIK---------
A0A2V5URB2      ------------SYYESQYEMLKSRSLAAEVIKG------------QGLDR---------
A0A5R8KA81      QDL-RMN-----DLLATIMENLKNRDLLLRVVRR------------AELGK---------
A0A5B5WU87      ATS-NGIVNTVATNLDNEMFLLSSHSLLETVVRK------------LKLDVTYWKKDKFR
R7DZW0          AST-NGIVNTGATNLDNEIFLLSSHSLLKTVVRN------------LKLDVTYWKKNGFR
A0A2N8HID1      AST-NGIVNTGATNLDNEIFLLSSHSLLKTVVRN------------LKLDVTYWKKNGFR
A0A2N8HS06      AST-NGIVNTGATNLDNEIFLLSSHSLLKTVVRN------------LKLDVTYWKKNGFR
A0A3R5R2M8      GID-SGA-----ANLANESFVLKSTAIMQKVVED------------LKLNTSYWQAQDFR
A0A411SUQ6      NID-PNA-----ANLANESLVLKSTALMNKVVED------------LNLNTSYWQKKDFR
A0A2N8HZF2      GID-SGA-----ANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFR
A0A354E720      NID-PNA-----ANLANESLVLKSTALMNKVVED------------LNLNTSYWQKKDFR
B2UPB6          NID-PNA-----ANLANESLVLKSTALMNKVVED------------LSLNTSYWQKKDFR
A0A2A2XXW5      LGN-SDQ-----NYLTTQYRNLESRSLILAVMNK------------LKLET---------
A0A2V6JLK8      QPI-HDP-----QLAPTVYQVIQRTGILYPVIEQ------------LKLQD---------
A0A2W5Z1A5      QPV-HDP-----TLAPTVFQVIQRTGILYPVIDE------------LKLQE---------
A0A2V6EA09      QPV-HDP-----ELAPTVFQVIQRTGILYPVIDD------------LKLQD---------
A0A2V6GQI7      QPV-HDP-----ELAPTVFQVIQRTGILYPVIDD------------LKLQD---------
A0A3C1HEJ2      DDG-ERP-----EDLKTIIETLKSRAVIERVIET------------NHLAT---------
A0A522ULD9      AFS-YNP-----YFLRTQFEIIQSRQILYKVVDN------------LNLTK---------
A0A1V6JU76      MSM-TDQ-----DYLQTQYRNLLSRSLLEIVIKR------------EKINE---------
A0A1Q6UHJ9      DRS-RNNTVLTIEDFNTQVKILESNEIIKAVKSR------------MKEDE---------
A0A2V2BXR0      DRS-RNNTVLTIEDFNTQVKILESNEIIKAVKSR------------MKEDE---------
A0A2D8V0G3      FNS-NDQ-----EYLQTQYKNLLSRSLIESVITD------------LELKQ---------
A0A348S017      FNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD------------LGLDE---------
A0A3C1UUV7      FNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD------------LGLDE---------
A0A350I3V2      FNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD------------LGLDE---------
A0A520RGV5      FNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD------------LGLDE---------
A0A3D3XF90      FNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD------------LGLDE---------
A0A2D7B522      FNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD------------LGLDE---------
A0A356NIC2      FNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD------------LGLDE---------
A0A2N8HDG3      GMD-SGA-----ANLANESFILRSSTVMRSTVED------------LALNISYWKQQDLR
A0A2U8DZK4      NDY-YDP-----YFVQDQLRTIKSPKIINPVIER------------LKLNE---------
A0A2T6DFL8      SPS-YDP-----VFLQDQFKIMQSEKILYPVIER------------LDLNR---------
A0A1D8AWD4      NTY-YDP-----YFIQDQFRIIQAEKILYPVIES------------LGLNE---------
A0A4Q1C9S2      NSY-YDP-----YFIQDQFKIIQSEKIIYPVIDA------------LGLNA---------
A0A178IH18      NNY-YDP-----YFLQDQFKVIQSPKILNPVIEN------------LGLNR---------
A0A2T6DT99      SAY-YDP-----YFLQDQFKIMQSAKILYPVIER------------LQLNE---------
A0A1G3ZT33      SSY-YDP-----YFLQDQFKTIQSDIILKPVIEI------------LNLNA---------
A0A3E1E2T2      SSS-YDP-----YFLQDQFKILQSEKILYPVIKN------------LKLST---------
B1ZMW1          SSY-YDP-----YFLQDQFKIMQSEKILYPVIEN------------LGLNT---------
A0A3D1TI55      QSQ-YDP-----YFYLTQFELIRSRPVLTGVIRD------------MNLQE---------
A0A3R8IT45      STM-FST-----EDINTMVKVFESSIIIQKVSER------------ITGEE---------
A0A1H1MGC9      NEI-RSA-----EDLNTQVKVLESFAIVQRVADR------------LTGED---------
A0A2A2PYE8      TDI-RSA-----EDLNTQIKVIESVTMIQRVAER------------ITGDD---------
A0A2T6CN73      TDI-RST-----EDLNTQVKVIESEAIIESVASR------------ITGQE---------
A0A3E1ET42      NEI-SNRSAYSGNWLETEFKTVTAHETLSLVIKK------------LNLDQ---------
A0A2A2YDW8      DDN-NSQIQMTPQFFATQFEIIRSQMTLRRVVDK------------LRLTN---------
A0A352XLN9      DDN-NSQIQMTPQFFATQFEIIRSQMTLRRVVDK------------LRLTN---------
A0A3D0YP62      -----TR-----QFMNTQFEIIVAPETLGRAIDK------------IQLET---------
A0A3D3DV47      -----TR-----QFMNTQFEIIVAPETLGRAIDK------------IQLET---------
A0A2E5XJ49      GAS-PSH-----AYIYNQFKIIESEKTLARVVER------------LDLTT---------
A0A2E6SBY8      GAS-PSH-----SYIQNQFKIIESEKTLARVVER------------LDLXT---------
A0A2E5QMS4      GAS-PSH-----AYIQNQFKIIESEKTMLRVVER------------LDLTT---------
A0A2E7YXQ3      GAS-PSH-----AYIQNQFKIIESEKTMLRVVER------------LDLTT---------
A0A2E3H787      GAS-PSQ-----AYIQNQFKVIESEKTLLRVVER------------LDLTT---------
A0A2E7AGN1      GAS-PSH-----AYIQNQFKIIESEKTLSRVVET------------LDLTT---------
A0A2E7AKY7      GAS-PSH-----AYIQNQFKIIESEKTLSRVVET------------LDLTT---------
A0A3D4CU34      GAS-PSH-----AYIQNQFKIIESEKTLSRVVET------------LDLTT---------
A0A2E8M146      GAS-PSH-----AYIQNQFKIIESETVLNRVVES------------LDLTT---------
A0A355S8S2      GAS-PSH-----AYIQNQFKIIESETVLNRVVES------------LDLTT---------
A0A2D6DVN8      GAS-PSH-----AYIQNQFKIIESEKTLLRVVEQ------------LDLPT---------
A0A3C1W2R2      GAS-PSH-----AYIQNQFKIIESEKTLLRVVEQ------------LDLPT---------
A0A2E3NAY6      GAS-PSH-----AYIQNQFKIIESERTMSRVVER------------LDLTT---------
A0A2E3II01      GAS-PSH-----AYIQNQFKIIESERTMSRVVER------------LDLPT---------
A0A368B8C5      GAS-PSH-----AYIQNQFKIIESERTMGRVVER------------LDLTT---------
A0A3R7RBB5      GAS-PSH-----AYIQNQFKIXESERTMGRVVER------------LDLTT---------
A0A2A2QX62      -YE-MTS-----TFFPTEFEVIKAQKTLDSAIEN------------LDLVN---------
A0A4Q3BWH6      -ME-NGA-----TFLPTEFAVIKAQKTLDAAIEN------------LDLVN---------
A0A3N5WCF1      GGR-MSP-----QFFGTEFEKIKSRNSLAKVVDN------------LQLVN---------
A0A4Q3C1K5      -NL-MTP-----QFFGTEFEKIKSYNSLSKVVAK------------LELMS---------
A0A2G4G428      FSI-TSA-----DDFYTAVESMRSSTIIEAVSRQ------------LTTAE---------
A0A139TV24      GVD-SGA-----ANLANESFILRSSTVMRHTVED------------LKLNVSYWKKRDLR
A0A2N8HT11      GMD-SGA-----ANLANESFILRSSTVMRNTVED------------LTLNVSYWKQQDLR
R7DS70          GMD-SGA-----ANLANESFILRSSTVMRNTVED------------LTLNVSYWKQQDLR
A0A2N8HNL6      GMD-SGA-----ANLANESFILRSSTVMRNTVED------------LTLNVSYWKQQDLR
A0A146GCJ0      ENP-QST-----DFLKTVVEALKSRKLLARVVKA------------EGLDK---------
A0A2T6D6H8      ENP-QTT-----DFVNTVVQALTSRKLMLRVVKA------------TGLDH---------
A0A5C9DC49      REK-GGV-----DLLNTIANNIRSSGIIKRVVTA------------HNLTR---------
A0A139TUL1      GVR-AGE-----ANLANESYVVQSSEVMGRVVKG------------LELGVSYWEKRNIR
A0A2N8HCB0      GFK-PGE-----ANLANESYVVKSSEVMGRVVKG------------LGLDVSYWEKRNIR
A0A2N8HP04      GFK-PGE-----ANLANESYVVKSSEVMGRVVKG------------LGLDVSYWEKRNIR
A0A2N8HRJ0      GFK-PGE-----ANLANESYVVKSSEVMSRVVKG------------LGLDVSYWEKRNIR
A0A366HAG0      NLA-STD-----SFLKTQFEIITKRRTLDRVVDK------------LDLLE---------
A0A3M1I8A3      VSR-MDP-----EYLQTQYKNLLSRSLLERVVKA------------ERLEQ---------
A0A4V0XS84      QNR-QDP-----DYLQTVAKNLKSRTLMKALIAD------------LKLDE---------
A0A0R2XQ77      NQI-RSS-----EDLNTQISVLNSGAIVQGVERR------------LQDDE---------
A0A2E9IN28      NQI-RGA-----EDLNTQISVMESATIIKGVEQR------------LQDEM---------
D5ENH7          DSI-RTA-----EDLNTQISLLNSSKIIQQVERR------------MSEEQ---------
A0A351WE84      IQG-YNP-----FFLRTQERILKSTPLLYAVIDN------------LNLQA---------
A0A1V5QDZ6      PQA-YNP-----FFLRTQYEVIQSRKVLYQVVEN------------LDLQK---------
A0A4Y8P964      GLF-DYE-----NYFKTQVEILKSRSLAQRVVER------------LDLDE---------
A0A3D4HF88      EEI-RTS-----EDLNTQIKILESLAIVNSVADR------------IKGAE---------
A0A351MR11      YAI-MSA-----DDFNTAIEVMKSSGIIEAVERR------------LTTSE---------
A0A5B5WI95      GID-SGA-----ANLANESFILKSTAVMKKVVED------------LKLNTSYWYSQDFR
A0A2N8I9W1      GID-SGA-----ANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFR
A0A4Q5IH27      GID-SGA-----ANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFR
A0A2N8IBZ6      GID-SGA-----ANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFR
A0A2N8IJW9      GID-SGA-----ANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFR
R6J100          GID-SGA-----ANLANESFILKSTALMKKVVED------------LNLNTSYWQKKDFR
A0A1V6J089      RMG-YNP-----FFLMTQEKILKSKPVLTTVIRN------------LNLQK---------
A0A3C1BZR1      RMG-YNP-----FFLMTQEKIMKSRPVLTAVIRN------------LNLQK---------
A0A1H6KPB7      QNN-ASE-----NYIPTQFEILVSDMNLMAVSKK------------LNLAQ---------
A0A2E9ISN4      QYD-RQE-----RSLSRQMLLLNSNRLHQQVR--------------ANLAE---------
B9XAX1          QDL-RTG-----EMLNTIVQNVKNTKVLGRVVRN------------IGLAT---------
A0A5R8KKM9      ------------GFLKTQLEIIQKPKTLERVVEK------------LKLLE---------
A0A139TS01      SSN-ITD-----NYIPMQYSVLTSSEVLKVVSKK------------LNLAA---------
A0A3E1EJT7      SNI-TSE-----PDFNTQIKVLESLTILQNVANR------------LTPDE---------
A0A317ZP96      NQI-RSA-----EDLNTQISLLESGTIIQGVEQR------------LQDDM---------
A0A2D5WGA5      PTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK------------CELED---------
A0A2E7SSH2      QSS-FDP-----YFISTEFEKIQSQVVLDEVVKK------------CDLKK---------
A0A349GXM8      NEG-AQW-----TSLHTHTYMLNNEKLHERVMNK--------------LAE---------
A0A4P5YP61      DEQ-TTT-----EILKTFEQTIVSRPVLERVAAT------------NQLTK---------
A0A5R1Q5N3      GLF-DFE-----NFFKTQVEILKSRSLAQRVVER------------LDLDE---------
I0JYY7          GLF-DFE-----NFFKTQVEILKSRSLAQRVVER------------LDLDE---------
A0A4R7S1J2      KDW-ANT-----EAMNTLAATMRSSTFLERLIDR------------EKLQT---------
A0A2A2XV69      GRG-FDP-----RFITTQFEIIQRKEILYPVIEA------------LGLEQ---------
A0A651H7X9      PTI-RTT-----EDFNTQVRRMESISLIQRVASR------------LTGEE---------
A0A4Y8P842      GLF-DWE-----TFFKTQCEIIKSRSLAQRVVER------------LDLDE---------
B3DZK9          GLF-DWE-----TFFKTQCEIIKSRSLAQRVVER------------LELDE---------
A0A5E6MPC4      NAF-EYD-----TFFRTEIEILKSRAMAERVVDR------------LNLEE---------
A0A4V1SB02      TPI-KGT-----DQLNTVVQSLTSNKVLLAVANH------------TNYGK---------
A0A3C1VB86      EDM-RSQ-----ETLNTVAQKLSNLALLTQVLEE------------NHLLP---------
A0A146G2Q9      ----LDP-----RFLATQFEIIQRKEILYPVIDA------------LGLDR---------
A0A2T6D3Y2      ----LDP-----RFLATQFEIIQRKEILYPVIDA------------LGLDR---------
A0A2V2SDV4      PSS-YDP-----YYINTEFELIQSEVILQPVITK------------LDLNK---------
A0A2V5PK75      A-G-YDP-----YFIQTEFETIQSERVLGKVIDK------------LELND---------
A0A1V6DME1      P-G-YDP-----YFIQTEFEVIQSERILSNVVHQ------------LNLSV---------
A0A3D3DIJ3      A-G-YDP-----FFIQTEFELIQSELILGKVVAD------------LDLNT---------
A0A2D5VY59      SQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA------------LELRN---------
A0A2D8UZZ4      SQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA------------LELRN---------
A0A353DV86      SQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA------------LELRN---------
A0A2E5EPT8      GPD-FDP-----FFILTQFERLQSAEVLYPVIEK------------MNLGR---------
A0A5C9DS93      ------------YFVMTQFEILQSKEVLYKVIDD------------LKLVQ---------
A0A350EWA4      VQG-FDP-----YFLQTEFEKIQSKTVLYQVITN------------LNLAD---------
A0A5B5WZ91      SSN-MTD-----NYIPMQYSVLTSSEVLKVVSKK------------LNLAA---------
A0A2N8HD92      TSN-VTA-----NYIPMQYSVLTSTEVLKIVSKK------------LNLAA---------
A0A2N8HIT2      SSN-VTA-----NYIPMQYSVLTSTEVLKVVSRK------------LNLAA---------
A0A354EBD3      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A355VEB2      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A2N8IMT3      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
R6K1U5          TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A2N8IWC2      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A2N8I441      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A2N8I3A6      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A410SCC4      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A3R5VEW0      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A411SSG2      TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
B2UKW3          TSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK------------LNLAA---------
A0A1M6RLZ4      R-----------QFFATQFQLIESEENLKRAAIR------------CQLPE---------
A0A354T7G8      SLA-FTQ-----EYIKTQFETITKPSTLYPVIQS------------LDLAK---------
A0A2S7U4L6      SAL-MTR-----QFFGTEFKKIESDENLKRAAEL------------VQLPQ---------
A0A512MBZ2      D-----------VFVKTEFESINKPETLYPVIEK------------LDLQK---------
A0A2E8MEZ0      TMT-A-------RYMENEFETITAPETLAEAAEN------------IDLPR---------
A0A4Q2YKS3      RMT-P-------RFFETEFEKIKSSKSLEKVVNN------------LDLVK---------
A0A2E3EC33      ESL-PYM-----TFMQTQFEIIQSRETLKEVINNGKDSLGQP----LDLXA---------
A0A2E4GN01      ESL-PYM-----TXMQTQFEIIQSRETFKEVINNGKDSLGRP----LXLME---------
A0A1Z8XU55      EQL-PYM-----TFMQTQFEIIQSRETLKQVISKGKDSAGNP----LDLKK---------
A0A2E1RQR9      EQL-PYM-----TFMQTQFEIIQSRETLKQVISKGKDSAGNP----LDLKK---------
A0A2E3ISQ4      EQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGENSAGNL----LDLKK---------
A0A2D6W6F4      DQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGVDSAGNL----LDLKK---------
A0A2D8Z5A8      DQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGVDSAGNL----LDLKK---------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      ------------------------------------------------------HPLFGG
A0A2V5PST3      -----------------------------NKIFTGASITSDNPIKRVRSWILGTLNSLIS
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      -------------------------------PKQLIGETGLSETNVIERLHQISKAGFFG
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      KEEIYDRSPIAVHFSERGNPAEAGFRVIPVSDTEFRLESGVNDSRPERETGVFGREIEFC
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------NLSPSHPQSRWSRILSRSQPEAEMTLFTFPPEDNRPYYLVSEKGNKISLFDSNH
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A2V5URB2      ----------------------------------------------------------NP
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      KVEVYEDSPIAVQFTPEGGAADARFCVVPLSGKEFRLEKDEKDRGGQETGTFGKEVRFDS
R7DZW0          KVEIYQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDS
A0A2N8HID1      KVEIYQDSPIAAQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDS
A0A2N8HS06      KVEIYQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDS
A0A3R5R2M8      EIDLYRNSPILAVFEEIGSNRSCRISVTPVGEQSFILAYSNSREEPAFLKGEYGQPISLP
A0A411SUQ6      ELDLYHATPLLVHFEQIDKQRACTLHITPLDEKRFTLGHPNDQGELILLEGFYGKPLTLP
A0A2N8HZF2      EIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLP
A0A354E720      ELDLYHASPLLVNFEQIDKQRACTLHITPLDEKRFTLGHPNNQGELILLEGFYGKPLTLP
B2UPB6          ELDLYHATPLLVHFEQIDKQRACTLNITPLDEKRFMLGHPNDQGELILLEGFYGKPLTLP
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      QIDLYRDSPITVTFDGIAENRFCNVDITLQEGNTLVLTYHDINGNPVQEKGTFHSPIHLP
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      QIDLYRESPVEVIFENIPSDRSCSFDITLKGDSALSLTYQGSDGKPVQLEEELKKPVHLP
A0A2N8HT11      QIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLP
R7DS70          QIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLP
A0A2N8HNL6      QIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLP
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A5C9DC49      ------------------------------------------------------------
A0A139TUL1      KVELYHTTPLKVEFGEEVDFQPCSLAVTPLNGREFSLSYREKGGRETALAGKFGIPLELP
A0A2N8HCB0      KVDLYHTTPLKVEFSEEAAFQPCSLAVTPLNGREFSLSCREKEGGENVLHGKFGVPLKLP
A0A2N8HP04      EVDLYHTTPLKAEFSEEVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLP
A0A2N8HRJ0      EVDLYHTTPLKAEFSEQVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLP
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A5B5WI95      KIELYNSSPILAVFEEIGKQRSCSFSITPRGEQNFILAYTTSQKKTTTLEGTYGQSIALP
A0A2N8I9W1      EIDLYKTSPLLVHFERIDKQRACTLHITPLDEKRFMLSHYNNQGESVQLEGFYGKPLTLP
A0A4Q5IH27      EIDLYKTSPLLVHFERIDKQRACTLHITPLDEKRFMLSHYNNQGESVQLEGFYGKPLTLP
A0A2N8IBZ6      EIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLP
A0A2N8IJW9      EIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLP
R6J100          EIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLP
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A5R1Q5N3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5C9DS93      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      -----------------------------NPAFVAPGAKPTEIQLADKLRG-KVRAVLRR
A0A2V5UHJ2      GKTNDAAKEGLVAGFWKELKNWAKGFMPATPTPSTPDPIPLSTRLAGSYLL-MLEVRPVV
A0A2V5PST3      PVAKFFRESRQESAESDTPDAAARGGNLVDRQETDKNKPVVSRGLVGHYMS-FLQVNSIE
A0A2V5PXM3      --------------------------DPRFLKIDDGAPRPTREKLVTRLSK-MVDAKLRK
A0A139SU05      -------------------------VAIIQRPYLKSQAPGEPLPPLAAMLG-LLSIDPVR
A0A1D8AZK8      -------------------------IKILQRPYLKDLAPGANPPPVGGLLG-SMAPQSVR
A0A1V5QB01      ------------------------------------------EEVSRTITR--ISVAPVG
A0A139SPN4      -------------------------IAIIQRPYLKSQPPGEPLPPLAAMLG-LLSIDPVR
A0A1V6E7N1      -------------------------VKILQRPFLTKLSPGATPPSAGAALG-SMVPSPVR
A0A2D9MYT1      LTGYAGGDAPALSREENRPLATGLFAFPPKPKDGEEPEDLTYEEQLKRLSD-AVSVSPIR
A0A258ANJ7      --------------------------LPSFSGGHPADSKEARDNAIFMVSS-MIRISLRK
A0A139TLN4      SHTFTVEKTPRFDSRS--------------LDAPVIVRKTFIKNAAIALIG-GLTVNKAS
A0A290QGD9      --------------------------LAQFMAPYLKGGSGDPLTPAEVLFK-NRRVIPRR
A0A1D8AS58      --------------------------LELFMAPFKSPGAEVPITAAEVVYL-NRKIVPVR
I6AQC1          --------------------------LRRFMQPYEKGRFGDPLTPLEVLGE-NRSIVPFR
W0ITH7          --------------------------LRRFMQPYEKGRFGDPLTPLEVLGQ-NRSIIPFR
A0A1G3ZFT0      QRILEGKIGERLANQDKSIQLQINQISARAGTKFTLMQYPINDRMVRSMAR-RITIDDPE
A0A1Z8ZMT6      ------------------PSIMEVFTAKKAEEKKVFAEAPAPEQLAGIISG-WTSSEVRR
A0A2E8MCT7      ------------------PSIMGIFTAKEPVKKKVFADAPEPEQLSGMISG-WTSSEVRR
A0A290Q2Z2      ---------------------------KIGRSIGAYAPLATDETYNYLLKK-MLRVESPR
A0A2A2RGK2      -------------------------DPRFLSAVGISAKDATNDRTAGALSG-MVGVIYRP
A0A2A2XXF7      -------------------------DPRFLAAAGISARDASPDRVAAALSS-MSASVYRL
A0A2A2R5D6      --------------EW--------------GTRLFGGSNLPMDKAFVLLNN-RVDVNVQR
A0A1J4XH17      --------------------------LTDVFLAPYSVSNKSKEAIAEILFH-NRKIVPER
A0A3C1VJ32      --------------EW------------GKK--YNNGETLKTTETMEILKQ-RMGLVPVR
A0A2N9NTX7      --------------EW------------G-K--LEGGAPLKKQQTIDKLKR-MMDPRQVR
B9XK55          --------------AW------------K-Q--YNNGQKLKTSQSRAQLKR-MMELHPDR
A0A4P5YMI6      --------------KW------------AQR--YGSPVPLLDTEAYGVLTK-RLDLRQVR
A0A2E6T482      --------------KW------------DPN---EKG--LDLIKAREILKK-TIDVRQYR
A0A3C0DQZ7      --------------KW------------DPN---EKG--LDLIKAREILKK-TIDVRQYR
A0A1Z9CBK5      --------------KW------------KEH---YGGEELDEVRARKHLEK-VIDVSQYR
A0A2D6ZI96      --------------KW------------KEH---YGGEELDEVRARKHLEK-VIDVSQYR
A0A358KGZ3      --------------KW------------KKH---YGGKQLTDVEARKHLEK-VIDVSQYR
A0A2E9ZQX4      --------------KW------------KKH---YGGKQLTDVEARKHLEK-VIDVSQYR
A0A3D5JZU0      --------------KW------------KKH---YGGKQLTDVEARKHLEK-VIDVSQYR
A0A2E6HCR0      --------------EW------------KDD---NGGEPLTELVARKRLEK-VIDVSQYR
A0A1Z8WN04      --------------EW------------KDD---NGGESLSELRARKLLEK-VIDVSQYR
A0A2D7L1N4      --------------EW------------KDD---NGGESLSELRARKLLEK-VIDVSQYR
A0A2E2R937      --------------EW------------KDD---NGGESLSELRARKLLEK-VIDVSQYR
A0A520QQY4      --------------EW------------KDD---NGGESLSELRARKLLEK-VIDVSQYR
A0A2D5MR66      --------------EW------------KDD---NGGEALTELRARKRLEK-IIDVSQYR
A0A2E0PDQ1      --------------EW------------KDD---NGGELLTELRARKRLEK-VIDVSQYR
A0A2E2ZZP9      --------------EW------------KDD---NGGELLTELRARKRLEK-VIDVSQYR
A0A2A2RGF2      --------------RW------------DQK--YRLGQ--SKVKAYEVLTK-LIDPRQVR
A0A2G4I5Y6      --------------RW------------DQK--YRLGQ--SKLKAYQVLTK-LIDPRQVR
A0A3M1I883      --------------AW------------SKRLGLRDGELLNEQEAYQYLLR-NMEVKQSR
A0A1V6JZ45      --------------TW------------GQR--LKN--AVSEPEAYLLLRR-NLDVRQSR
A0A520RRW5      --------------KW------------MER--FKTDTPLTTNETFQVLKN-SIDVDQYR
A0A356NPK0      --------------KW------------MER--FKTDTPLTTNETFQVLKN-SIDVDQYR
A0A2D7B5P5      --------------KW------------MER--FKTDTPLTTNETFQVLKN-SIDVDQYR
A0A3D3XGB5      --------------KW------------MER--FKTDTPLTTNETFQVLKN-SIDVDQYR
A0A2V6F8A1      --------------RW------------GER--YNNGVALSKAETFDVLKG-KIDVRQTR
A0A2V5TNH4      --------------RW------------GGR--YNNNIPLKTPETFDILQG-KIDVRQTR
A0A2V5X5Q6      --------------RW------------GER--YNNNIPLKTPETFDILHG-KIDVRETR
A0A2V2DJ66      -------------------------LRKLMAPYKDMFTFGPRKTEEEILQM-NRRVIPER
R7L5A9          -------------------------LKRFIAPYHNMFTFGIRKSEEELLMD-NRSIIPQR
A0A4P5QM05      -------------------------------ELSPPGQTMPLQWVTEILSR-SMVVQEQR
A0A4Q3C001      -------------------------------YYSGDGPPLPKQTVLRLLNA-DLVLQEVR
B4DB23          -------------------------------EFSPPGQRLPLQQVYIQLRN-SMKLNEVR
A0A2V5URB2      QFTGQARHKNFAAELWSRATAWLNSLSSQPVTANAPDVYGINSQLIDAYQG-MVEIEPLK
A0A5R8KA81      ----------------------------DMTFPEVRDYIMTEPELVDALES-EIDITIRK
A0A5B5WU87      LTFIVEKTPRFSEAAL---------------NVPVIVRKTSVRNAAVGLRS-GLTVKKAN
R7DZW0          QAFIVEKTSKFDESSL---------------NVPVIVRRTSVKNAAMGLGS-GLTVRKAS
A0A2N8HID1      QAFIVEKTPKFDESSL---------------NVPVIVRRTSVKNAAMGLGS-GLTVRKAS
A0A2N8HS06      QAFIVEKTPKFDESSL---------------NVPVIVRRTSVKNAAMGLGS-GLTVRKAS
A0A3R5R2M8      FATVSIHPTSVMNADWNGQTVIIRHVPSQ-------------DTARALLANFSVARPDAK
A0A411SUQ6      FATISVHPTSLMTDAWNGKTVIVRHSPVL-------------ETANALLRGLTITRPDSK
A0A2N8HZF2      FAVISIHPTSLMTDAWNGKTVIVRHSPVL-------------ETANALLRGLTITRPDSK
A0A354E720      FATVSVHPTSLMTDAWNGKTVIVRHSPVL-------------ETANALLHGLTITRPDSK
B2UPB6          FATISVHPTSLMTDAWNGKTVIVRHSPVL-------------ETANALLRGLTITRPDSK
A0A2A2XXW5      ----------------------------------DDERYTKSVDKVTAVTK-DIKIVPIR
A0A2V6JLK8      --------------KW----------------ARD-GRPPSREIAYQMLRN-RLDVDEVR
A0A2W5Z1A5      --------------KW----------------ANHSAGPLSREQTYAILRG-KLEVDEVR
A0A2V6EA09      --------------KW----------------GKDLGRP-SREQTYKLLLS-RLDVEEVR
A0A2V6GQI7      --------------KW----------------GKDLGRP-SREQTYKLLLR-RLDVEEVR
A0A3C1HEJ2      ---------------------------DPRVVEPEIQGILSRAKLVARVSD-LIAPRLRP
A0A522ULD9      --------------EW-------------GKKFNEDKSPINRSLAFSILSG-ALRVQPYR
A0A1V6JU76      -----------------------------------DSRYRDSPDVARALAE-DIRINPIR
A0A1Q6UHJ9      -------------------------IVRFMAPFNDMFTLGPRKTEEELLAE-NRTIAPER
A0A2V2BXR0      -------------------------IVRFMAPFNDMLTLGPRKTEEELLAE-NRTIAPER
A0A2D8V0G3      -----------------------------------DEVFKGAENIVNAVRD-CITISPIR
A0A348S017      -----------------------------------EGRYAQSQNVINAVRN-DISISPVR
A0A3C1UUV7      -----------------------------------EGRYAQSQNVINAVRN-DITISPVR
A0A350I3V2      -----------------------------------EGRYAQSQNVINAVRN-DITISPVR
A0A520RGV5      -----------------------------------EGRYAQSLDVINAVRN-DITISPVR
A0A3D3XF90      -----------------------------------EGRYAQSLDVINAVRN-DITISPVR
A0A2D7B522      -----------------------------------EGRYAQSLDVINAVRN-DITISPVR
A0A356NIC2      -----------------------------------EGRYAQSLDVINAVRN-DITISPVR
A0A2N8HDG3      FATVTVYPTSNMTETVPGTTITVRRTPVN-------------AAADQLLAN-FTVMRPDA
A0A2U8DZK4      ---------------------------KLAAVLEIPGPLPVDFTYDYLIKKRIVSVESPK
A0A2T6DFL8      ---------------------------KIAALKDSPAAFPSAVTYAILTRK-MLRVESQR
A0A1D8AWD4      ---------------------------ILGKQLNDGVALPSAITYRYLISK-MLRVEAPR
A0A4Q1C9S2      ---------------------------ILGKQLNNGAPLPSAITYKYMLDK-MVRPDAPR
A0A178IH18      ---------------------------RIAALLGASAPYPTDVTYEYLTKK-MLRVEMPR
A0A2T6DT99      ---------------------------KLAASQGSSVPLPTDVTYLLLVNK-MIRIETPR
A0A1G3ZT33      ---------------------------VLGKMLNNGEPLPTSITAQYLLRK-MLRVESQR
A0A3E1E2T2      ---------------------------VLAPALDSPEPLPDAITYHYLLQK-MLRVESQR
B1ZMW1          ---------------------------RLAPLLGATGPLPSAMTYRYLLNK-MLAVESQR
A0A3D1TI55      --------------VW-------------GRQFNDNQEEMDLESTISRLRS-MVETVQVR
A0A3R8IT45      --------------------------LKKFMEPYEKGRFGDPLTPLEVLGQ-NRKIVPLR
A0A1H1MGC9      --------------------------LKAFLAPYQKSAASSPPSPAEIIFR-ERKIVPVR
A0A2A2PYE8      --------------------------LRAFLAPYER-AGTDITYVAEILAK-NRKIIPQR
A0A2T6CN73      --------------------------LREFLAPYDT-GAPEKPSVARLLKL-NRRVIPQR
A0A3E1ET42      --------------TW----------------------GLTFDEALTKLER-MIETETER
A0A2A2YDW8      --------------RW----------------------NVTEEDALMTLTG-IVQAQNIR
A0A352XLN9      --------------RW----------------------NVTEEDALMTLTG-IVQAQNIR
A0A3D0YP62      --------------SW----------------------GQDRKTVIDVLRQ-IVRTTQRR
A0A3D3DV47      --------------SW----------------------GQDRKTVIDVLRQ-IVRTTQRR
A0A2E5XJ49      --------------RW---------------------SGYDRDMALLKVKK-ILKTEQIR
A0A2E6SBY8      --------------RW---------------------SGYDRDMALLRVKK-ILKTEQIR
A0A2E5QMS4      --------------RW---------------------RGYDRDMALVKLKQ-ILKTEQIR
A0A2E7YXQ3      --------------RW---------------------RGYDRDMALVKLKQ-ILKTEQIR
A0A2E3H787      --------------RW---------------------RGFDRDMALLKLKS-ILKTEQIR
A0A2E7AGN1      --------------RW---------------------SGFDEDMALIKLKS-ILKTEQIR
A0A2E7AKY7      --------------RW---------------------SGFDEDMALMKLKS-ILKTEQIR
A0A3D4CU34      --------------RW---------------------SGFDEDMALIKLKS-ILKTEQIR
A0A2E8M146      --------------RW---------------------NGFDQNMALLKLKS-ILKTEQIR
A0A355S8S2      --------------RW---------------------NGFDQNMALLKLKS-ILKTEQIR
A0A2D6DVN8      --------------RW---------------------NGFDRNMAVLKLKS-ILKTEQIR
A0A3C1W2R2      --------------RW---------------------NGFDRNMAVLKLKS-ILKTEQIR
A0A2E3NAY6      --------------XW---------------------NNFDRNMALLKLKS-ILKTEQVR
A0A2E3II01      --------------RW---------------------NGFDRNMALLKLKS-ILKTEQIR
A0A368B8C5      --------------RW---------------------NNFDRNMALLKLKS-ILKTEQVR
A0A3R7RBB5      --------------RW---------------------NNFDRNMALLKLKS-ILKTEQVR
A0A2A2QX62      --------------RW----------------------NSDRESVRGTLRG-IVSAQNIR
A0A4Q3BWH6      --------------RW----------------------NTDLESVRGILKG-IVEAQDIR
A0A3N5WCF1      --------------RW----------------------NVDKEAALGILKG-IVGTQNIR
A0A4Q3C1K5      --------------KW----------------------GVDKDTAIKILKG-IVQTQNLR
A0A2G4G428      -------------------------KKEVLAPYQSGNIFSGPLSEQEVFSR-QRSIMPQR
A0A139TV24      FATITVYPTSHMPETIPGTTITVRRVPIN-------------AAADQLLAN-FTVKRPDA
A0A2N8HT11      FATVTVYPTSNMPETVSGTTITVRRIPVN-------------AAADQLLAN-FTVTRPDA
R7DS70          FATVTVYPTSNMPETVSGTTITVRRIPVN-------------AAADQLLAN-FTVTRPDA
A0A2N8HNL6      FATVTVYPTSNMPETVSGTTITVRRIPVN-------------AAADQLLAN-FTVTRPDA
A0A146GCJ0      --------------------------DPDFAPPRKDGSPYSEIELVDKLAQ-KIDVQLIR
A0A2T6D6H8      --------------------------NPEFAPPRSNGGKYTDIELADRLAS-KVSAKLRR
A0A5C9DC49      -----------------------------HPYFTGGTNTLTESQVMAAVGG-MLDARLRR
A0A139TUL1      FATVTVRTTSHFSS-------------GSIGRPIFVERLSVKEACAQMLGR-LSVTRPDS
A0A2N8HCB0      SATVKVCPTSYFSS-------------GSMGRTIFVERVSVKEAAAGMLGR-LSVTRPDS
A0A2N8HP04      FATVNVCPTSYFSS-------------GSMGRTIFVERVSVKEATDGMLGR-LSVTRPDS
A0A2N8HRJ0      FATVNVCPTSYFSS-------------GSMGRTIFVERVSVKEATDGMLGQ-LSVTRPDS
A0A366HAG0      --------------KW---------------------NLKSKQAAAGKLIG-NLDAQSSI
A0A3M1I8A3      ---------------------------DPRYSKE--------MDIVAALAK-DITVTPIR
A0A4V0XS84      ---------------------------DIRYSRA--------KDLIKVLSE-DLTVAPIR
A0A0R2XQ77      ------------RERFMAPYADVLSFTGP-------------LSPAALLAQ-NRRIMPQR
A0A2E9IN28      ------------RERFMAPYTDALSLSGP-------------LTPLEILGR-NRSIMPKR
D5ENH7          ------------RKKFMQPYEGAFSFSGP-------------LTASEILGK-YRKIMPQR
A0A351WE84      --------------VW-----------GQ--QYNDDKSPITKEDALATLSS-SIKIEQDR
A0A1V5QDZ6      --------------VW-----------GE--EVNDDGSPLPLERAHAMLSR-SLKVEQFR
A0A4Y8P964      ------------HPDWLGLKKPSITKHSK-NSSEEEETSSIINSYTKRILD-NLRIEPVK
A0A3D4HF88      ---------------------------RK--MLMEPYKGDEEVTINEVLYE-NRDVVPLR
A0A351MR11      -------------------------RKAVLEPYQSGNIFSGPLTSQEVFGR-QRGIAAQR
A0A5B5WI95      FATVSIHPTSLMNEEWDGKPIIINHLTVL-------------ETAHGLLKN-FSVTRPDV
A0A2N8I9W1      FAVISIHPTSLMTDAWNEKTVIVRHKPVL-------------ETANNLLHG-LTVTRPDA
A0A4Q5IH27      FAVISIHPTSLMTDTWNEKTVIVRHKPVL-------------ETANNLLHG-LTVTRPDA
A0A2N8IBZ6      FAVISIHPTSLMTDAWNEKTVIVRHKPVL-------------ETANNLLHG-LTVTRPDA
A0A2N8IJW9      FAVISIHPTSLMTDAWNEKTVIVRHKPVL-------------ETANNLLHG-LTVTRPDA
R6J100          FAVISIHPTSLMTDAWNEKTVIVRHKPVL-------------ETANNLLHG-LTVTRPDA
A0A1V6J089      --------------VW-----------GA--QLNEDKSAITPELALQILQR-SIRVEQDR
A0A3C1BZR1      --------------VW-----------GM--EFNEDKSPVAPELALQILSR-SLRVEQDR
A0A1H6KPB7      --------------QW----------------------QTDDATAASILRG-MIQVMPVR
A0A2E9ISN4      --------------EW----------------------KKKLTEPERYVEF-LVTSVPGS
B9XAX1          ------------NSFF----------------LPGNTNVLSEAKLVNALAG-MIVTKLRP
A0A5R8KKM9      --------------LW-----------SLPANGR--------QFAIGRLQG-HLEVNSSA
A0A139TS01      --------------EW-----------GM---TD--------DLAATNLAG-MIKVSPLR
A0A3E1EJT7      ------------LRLL---------------LEPYKSHAGEPPSPASIIYH-NRQIIPQR
A0A317ZP96      ------------RKRFMAPYTDALSLRGP-------------LTPTEVLGR-NRKIIPRR
A0A2D5WGA5      --------------KW----------------KPANGDPLSDVNARKILEK-SIDIRQYR
A0A2E7SSH2      --------------RW----------------KELYKWDLNDQQARKQLEK-VIDVSQYR
A0A349GXM8      --------------AW---------------ADR--------LGGRHRMNP-KIAISQVR
A0A4P5YP61      ------------NGEFLTIYERKKGLFDAVAGTAAPEKEISIDGIAGTLAA-ITESRMRR
A0A5R1Q5N3      ------------HPDWLGL-KKESFRKHSINPSEGIEPTSEINLYAEYLLK-NLQVTPVR
I0JYY7          ------------HPDWLGL-KKESFRKHSINPSEGIEPTSEINLYAEYLLK-NLQVTPVR
A0A4R7S1J2      ------------RPDLFGG-KLPSAEDAL-------------PQAVGILSG-ALKAAPRV
A0A2A2XV69      --------------TWKKL-Y------GI--AGK--------EQTIFRLRK-MIDVREIR
A0A651H7X9      ------------MRRF-----------MA--PYE-TGDASDPVTPIEIIGQ-NRRIMPLR
A0A4Y8P842      ------------HPDWI----------GL--KPKKTAPLPSSEKLAEIVQN-NLHVLPVR
B3DZK9          ------------HLDWL----------GL--KPKKNGPLPSSEKLSEIVQN-NLHILPVR
A0A5E6MPC4      ------------HPDWVGL-KPGWRKAAK--RAN-LEEEPYISPVAGLLVG-NLRIEPVR
A0A4V1SB02      --------------EIAQS-QKSNGQAGT--DID--------SVIVDTLNS-KLKVTLRR
A0A3C1VB86      --------------PE-----------GT--VVTNGSKTVTRENIISQFEK-NVKTSLRR
A0A146G2Q9      --------------KW-----------GM--PSR--------EQAYFRLVR-MINIQEIR
A0A2T6D3Y2      --------------KW-----------GM--PSR--------EQAYFRLVR-MINIQEIR
A0A2V2SDV4      --------------VW-----------GA--KYGPNGAPLQSTDTMKLLQA-RMGLQPVR
A0A2V5PK75      --------------DW-----------GK--KYH-GGVKLKTPDTIVMLKG-RMDLRPVR
A0A1V6DME1      --------------EW-----------GK--KYA-GGERLKTQETMTLLRN-RMDLNPVR
A0A3D3DIJ3      --------------EW-----------GR--KYA-SGERLRTPETIALLKQ-RIDLRTVR
A0A2D5VY59      --------------RW-----------MK--RYN-LKQPLTLNEAFNVLKK-SIEVDQYR
A0A2D8UZZ4      --------------RW-----------MK--RYN-LKQPLTLNEAFNVLKK-SIEVDQYR
A0A353DV86      --------------RW-----------MK--RYN-LKQPLTLNEAFNVLKK-SIEVDQYR
A0A2E5EPT8      --------------VW-----------GA--RYG-IGEFTP-QKTKLLLEK-RIDPTQVR
A0A5C9DS93      --------------RW-----------DQ--KYR-LGQSK--FKAYQVLIK-LIDPRQVR
A0A350EWA4      --------------FY-----------RD--ARK-LEVNLKPEEAYMLLKG-DLSVSQMR
A0A5B5WZ91      --------------EW-----------GM---TD--------ELAATNLAG-MIKVSPRR
A0A2N8HD92      --------------EW-----------GM---TD--------EKAASNLAG-MIKVAPVR
A0A2N8HIT2      --------------EW-----------GM---TD--------EMAASNLAG-MIKVAPVR
A0A354EBD3      --------------EW-----------GM---TD--------EMAATNLFG-MIKVAPVR
A0A355VEB2      --------------EW-----------GM---TD--------EMAATNLFG-MIKVAPVR
A0A2N8IMT3      --------------EW-----------GM---TD--------EMAATNLFG-MIKVAPVR
R6K1U5          --------------EW-----------GM---TD--------EMAATNLFG-MIKVAPVR
A0A2N8IWC2      --------------EW-----------GM---TD--------EMAATNLAD-MIKVAPVR
A0A2N8I441      --------------EW-----------GM---TD--------EMAATNLAD-MIKVAPVR
A0A2N8I3A6      --------------EW-----------GM---TD--------EMAATNLAD-MIKVAPVR
A0A410SCC4      --------------EW-----------GM---TD--------EMAATNLAD-MIKVAPVR
A0A3R5VEW0      --------------EW-----------GM---TD--------EMAATNLAD-MIKVAPVR
A0A411SSG2      --------------EW-----------GM---TD--------EMAATNLAG-MIKVAPVR
B2UKW3          --------------EW-----------GM---TD--------EMAATNLAG-MIKVAPVR
A0A1M6RLZ4      --------------RW-----------NL--PMQ--------E-VVSIMTK-SLNTNQER
A0A354T7G8      --------------RW-----------EL--PSR--------QAALAKLRA-NLETQSML
A0A2S7U4L6      --------------KM-----------QI--STD--------E-AILVLKG-GLSARQER
A0A512MBZ2      --------------KW-----------SL--PSR--------QAALGKLQG-NLNAQSMP
A0A2E8MEZ0      --------------RW-----------GL--DMD--------S-AIKTLEN-VVETIPIR
A0A4Q2YKS3      --------------RW-----------GK--DRD--------QIVAELKYK-IITTQNIR
A0A2E3EC33      --------------KW-----------GL--TSE--------EDAFXILKK-KVETQXVR
A0A2E4GN01      --------------EW-----------GV--SSE--------DDAFRXLKK-KVETQDVR
A0A1Z8XU55      --------------AW-----------GV--NSD--------EDAYRILKX-KVETQDVR
A0A2E1RQR9      --------------AW-----------GV--NSD--------EDAYRILKK-KVETQDVR
A0A2E3ISQ4      --------------SW-----------GV--PTN--------EDAYQILKR-KVETQDVR
A0A2D6W6F4      --------------SW-----------GV--PSD--------EDAYRILKR-KVETQDVR
A0A2D8Z5A8      --------------SW-----------GV--PSD--------EDAYRILKR-KVETQDVR
                                                                            

A0A2A2XVF1      GTR-LIDIIVE--DKDPV------MARDLAASFVKEFLRENFSQRLSVSRVATDFLQEES
A0A2V5UHJ2      STS-LVVIKFT--TPDPA------LSARLANAHASSYVRYGIDLRSQTNSEASEFLQEKL
A0A2V5PST3      KTR-LVEIAFV--TPNPA------LSQKLADAHIKAFIRMNLEGRFQLTKEARDFLDIKN
A0A2V5PXM3      GTR-LIDVKVE--HTSPE------MAALIANSL-------------------LNFLRNEE
A0A139SU05      NSF-ILRLTVG--HQDPE------AAAILAQRHVDQFLSYLLENISGVNDTAVDFLRERA
A0A1D8AZK8      NSF-LINISVT--NRDPE------GAALLANRYVEQFMRYLLENVGGKNEFAVDYLKTRA
A0A1V5QB01      KTA-FLAITVE--SLDPV------LGSDMANALADEYLDFKAEERLNTSQATVVSLTQQA
A0A139SPN4      NSF-ILRLTVG--HQDPE------AAAILAQRHVDQFLSYLLDNISGVNDTALDFLHERA
A0A1V6E7N1      NSF-LISVSVN--HQDPE------AAALIANRYIDQFMQQIMDSTMGKNEYATDFLRKRS
A0A2D9MYT1      LSR-LVDVSVE--SPNRN------EAALIANTVISKFLEQDNNRKRGKLANAVDFLREEA
A0A258ANJ7      DTR-LIDFNVT--GADPE------QVAALSNQAVLSLVSELESQKSKTLQGAIQALVAEG
A0A139TLN4      GKTNLINISVR--CNNPV------KAENVLHNLVRFYNEASLDEKKKRGMNTDKFIEERL
A0A290QGD9      MSL-IIEVQYR--HPDRV------LASDIANMFVDEFIAYNSRVRIDESMKAVDELRARV
A0A1D8AS58      LSL-VLQVQFS--HPDKL------MAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERA
I6AQC1          MSL-LVAIEYR--HPDRL------IAAKVANLFLEEFVQFNTRQRVDQTFGILEDLKLRA
W0ITH7          MSL-LVAIEYR--HPDRL------IAAKVANLFLEEFVQFNTRQRVDETFGILEDLKLRA
A0A1G3ZFT0      KLG-LLTLAYQ--DTNPH------LAARVVNEIAKVTQHKNTEKKSLEASKILSFLSKQL
A0A1Z8ZMT6      GTR-LIDISVN--HTDPD------VAQVIANQIIQQFINIREGVNEEGKKSDLQHLLTAA
A0A2E8MCT7      GLR-LIDISVN--HTDPD------VAQVIANQIVKQFINIREGVNEEGKKSDLQHLLAAA
A0A290Q2Z2      GSS-MIEVGVY--SQDAA------LAAAIANEIARVYSDDRIMFATSEQREGLTQLRKEL
A0A2A2RGK2      QTR-LIDVSIT--SRDPN------LSVKLANAYADEYIRYVFEKRSDAAKSATQFLVEEA
A0A2A2XXF7      NTR-LIDLMIT--SADPN------LSVKLANAYCDEYIRYVFERRSDASKSATQFLLEEA
A0A2A2R5D6      NSD-ILEIRVK--SDLPK------EASDIANAIMDVYIEMRRADLQTRESRGFKTLDDEI
A0A1J4XH17      SSL-MIMLAYN--HPDPE------IAAKVANMFAEEYINYNMTLNIDGSMKAIFDLKERA
A0A3C1VJ32      NTK-LISITVY--SDDKK------EAADLANSIAEAYRTYRIQTSQQQATTGLEVYQTQY
A0A2N9NTX7      NTS-LVEIWVT--SFNKE------EAAKLANEIAEAYQAHRLEERAELTTGGIKSLEERW
B9XK55          NTS-LIEIKIY--SNDKK------EAAAIANEVAIVYQKYRLDQKLDITGAGIKVFKQQV
A0A4P5YMI6      NTS-LIEIRVF--SEIPA------EAREIAQKIAEVYRDNRLNAKRSMSAGGIKKLQEKL
A0A2E6T482      NTS-IIELRAY--DRDKE------LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRM
A0A3C0DQZ7      NTS-IIELRAY--DRDKE------LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRM
A0A1Z9CBK5      NTS-IIELRAY--DRDRG------LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRM
A0A2D6ZI96      NTS-IIELRAY--DRDRG------LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRM
A0A358KGZ3      NTS-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERM
A0A2E9ZQX4      NTS-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERM
A0A3D5JZU0      NTS-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERM
A0A2E6HCR0      NTS-IIELRAY--DGDED------LAREIAQALAEQYKNYRSNLQKRRVEAGINKLKERM
A0A1Z8WN04      NTS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERM
A0A2D7L1N4      NTS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERM
A0A2E2R937      NTS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKXRVEAGINXLKERM
A0A520QQY4      NTS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERM
A0A2D5MR66      NTS-IIELRAY--DGDEN------LAREIAQALAEEYKNYRSKLQKGRVEAGIGKLKERM
A0A2E0PDQ1      NTS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERM
A0A2E2ZZP9      NTS-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERM
A0A2A2RGF2      NTS-IIEINVY--SKDKA------EAAEIANKIAEIYKENREAQRKLQAEKGLKILRDRL
A0A2G4I5Y6      NTS-IIEINVY--SKDKE------EAAEIANKIAEIYKENRESQRKLQAEKGIKILRARL
A0A3M1I883      NTK-LVEITVY--SPIPE------EAADLANLIAASYKNWRQHSRREHMTNAIAVLQQKL
A0A1V6JZ45      NTS-LIEIRAY--SENRD------EASAIANEVANVYKESRVEEKQRQTSAGISKLRAKL
A0A520RRW5      NTS-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEY
A0A356NPK0      NTS-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEY
A0A2D7B5P5      NTS-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEY
A0A3D3XGB5      NTS-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEY
A0A2V6F8A1      NTS-LIEIRVY--SDAKDK--PAQEAAEIANQIATVYRDTQLGLKQEMSQKGIEVLRKEL
A0A2V5TNH4      NTS-LIEIRVY--SDAKEKEKPAQEAAEIANEIANVYRDTRLELKQEMSRKGIQVLREEL
A0A2V5X5Q6      NTS-LIEIRVY--SDAKEKDNPAQEAAKIANEIANVYRDTRLELKQEMSRKGIKVLKQEL
A0A2V2DJ66      MSL-MIRVTYT--HPNAE------MAARIADLFVNEYITYTRMTRVQTLLDSIEELRTKV
R7L5A9          MSL-IVTVIFE--HPDNN------MAARIANLFATEFINYTHQKRVQALMGSIDELRTKV
A0A4P5QM05      NTT-LVDIGVY--HTKPE------LAAVIANTIAVTYRDKRIEELRKNTDQTLKEMKDEL
A0A4Q3C001      NTS-FIEIGVY--NTDPQ------TAANIANTIAVVYQNKRLEEQQGNVDRSLAQFRDEV
B4DB23          NTG-LIEVGAK--DTDAQ------RAANIANAIAVVYQEERQHELDKNVARGLEQLKDEV
A0A2V5URB2      RSR-LVRISIS--SADPV------LAASVANAHAIAYVRQGLKLGSQANEEARKFLETKL
A0A5R8KA81      GTR-LIEVSVE--DQVPE------RAQKIAGMLIEESIGQNIESRANAGTLANEFLAAES
A0A5B5WU87      GKNNLVNVSIR--CNNPV------KAEVILHSIVHFYNEASLKEKNTRGTKTNKFIGERL
R7DZW0          GKNDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRL
A0A2N8HID1      GKNDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRL
A0A2N8HS06      GKNDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRL
A0A3R5R2M8      DSS-LLEMTLT--ASNPQ------KAEDVLNHLIEVYNQISIDEKKQSALKTRKFIEGRL
A0A411SUQ6      ESS-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRL
A0A2N8HZF2      ESS-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKAALKTENFIQSRL
A0A354E720      ESS-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRL
B2UPB6          ESS-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRL
A0A2A2XXW5      LSR-LVEVQVT--HPKGE------QAQRIADTILQVFLQQNLDDKKSKALQGLKILEQEA
A0A2V6JLK8      NTD-LLQISVY--DGSPQ------LAADIANKIVSVYQDRRVEEEKEILNRAVTAMNEEV
A0A2W5Z1A5      NTN-LLQISVF--DSNPQ------LAADIVNKIIAVYQDKRVEEEKDILNRAVGSMNEEV
A0A2V6EA09      NTD-LLQISVF--DANPQ------EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQV
A0A2V6GQI7      NTD-LLQISVF--DANPQ------EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQV
A0A3C1HEJ2      ATR-LIDVTVQ--HSDPQ------LTEQIANSLAREFLQRRFEQQISASESATSFYRQKE
A0A522ULD9      DTS-LISIIVR--MEDAA------EAALVANEIAKVYREHRLSEKRSQMMRGMEALEGEI
A0A1V6JU76      LSR-LVDVVVE--HPNAS------KAAGIANALVEEFIEQNLVQKQKRTMDMLFFLRSQA
A0A1Q6UHJ9      MSL-IIRIAFE--HPDPD------MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKV
A0A2V2BXR0      MSL-IIRIAFE--HPDPD------MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKV
A0A2D8V0G3      LSR-LVEVSVE--HPSPL------QAAAIANKLMQNFLTRNLDKKKQRAFESYKWLQNEV
A0A348S017      LSR-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEV
A0A3C1UUV7      LSR-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEV
A0A350I3V2      LSR-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEV
A0A520RGV5      LSR-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEV
A0A3D3XF90      LSR-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEV
A0A2D7B522      LSR-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWXDTEV
A0A356NIC2      LSR-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEV
A0A2N8HDG3      KESSILQMTLT--STNPV------KAADTLNKLIAVYNDHSTAERRTTAVKTKDFIREQR
A0A2U8DZK4      TSS-IVEITID--TRDPA------LSAAIANEIVGVYTEDRINLATAAQKADLAELNNQL
A0A2T6DFL8      ASS-VIEINVD--AEDPQ------LAADIANEVARTYSADRIALATSDQSEGMAQLRQEL
A0A1D8AWD4      ASS-IIEIDVY--ARDQR------LAADIANAIARVYAEDRITLATSDQREGLAQLRKEL
A0A4Q1C9S2      ASS-IIEINVF--ARDNR------LAAEIANAIARVYAEDRIALATADQREGLAQLRKEL
A0A178IH18      NTS-LLEVNVF--SRDAA------LAAAIANEIARAYSEDRIAFATAEQRAGLDQLRREL
A0A2T6DT99      GSS-LIEIEVS--AQDPA------LAAAIANEIGTAYSADRIDFATSQQREGLAQLRKEL
A0A1G3ZT33      SSS-IIEIDVY--AQEPA------LAARIANEIARVYSENRINFATAGQREGMTELKKQL
A0A3E1E2T2      SSS-LIEISVY--SEDPT------LGAVIANEIARVYSDDRINLATSDQREGFVKLRGEL
B1ZMW1          SSS-LIEINVY--AQEPP------LAAAIANEIARVYSDDRIALATSEQREGLAHLRKEL
A0A3D1TI55      GTT-IIEVQVT--SRDSA------EAAAIANKIAEVFQETRLASVKKKYSDALVQMQEEM
A0A3R8IT45      LSL-IVGVEYT--HPDRL------IATKVANLFLEEFITFTSRQRIDQTFTILEDLKLRA
A0A1H1MGC9      LSL-VLQVQYA--HPDRH------VAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERA
A0A2A2PYE8      LTL-VVTVAYQ--HPDRF------VAAKVANLFAEAYLDHNISLRTQESNNAVEGLKGTV
A0A2T6CN73      LTL-MVWIAYK--HPNRF------VAAKVANHFARAYIDYNTQLRISEGVKAVEDLKGPV
A0A3E1ET42      GTE-IMTVIVS--SVRRD------EAAAIANEVREAYDAQRQEIEAERIRRLTQTLDAKI
A0A2A2YDW8      GTD-LIEITVL--HPGAE------DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAV
A0A352XLN9      GTD-LIEITVL--HPGAE------DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAV
A0A3D0YP62      GTD-LIEISVR--HRKKE------EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVEL
A0A3D3DV47      GTD-LIEISVR--HRKKE------EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVEL
A0A2E5XJ49      NTD-HIEIRIR--HQKPE------DAQLIAQEIAKSYQLVRNADERARAGEALDALEAEV
A0A2E6SBY8      NTD-HIEIRIR--HQKPE------DAQLVAREIAKSYQLVRNSDERARASEALDALEAEV
A0A2E5QMS4      NTD-HIEIRIR--HQNSE------DARDVAKEIAESYQXGRNADERNRAGEALDALEAEV
A0A2E7YXQ3      NTD-HIEIRIR--HQNSE------DARDVAKEIAESYQLGRNADERNRAGEALDALEAEV
A0A2E3H787      NTD-HIEIRIR--HQKQE------DARDIAKEIAESYQLGRNADERKRAEEALDALESEV
A0A2E7AGN1      NTD-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEV
A0A2E7AKY7      NTD-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEV
A0A3D4CU34      NTD-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEV
A0A2E8M146      NTD-HIEVRIR--HQNRD------DARNIAKAIAESYKEGRNEDERKRAGDALDALESEV
A0A355S8S2      NTD-HIEVRIR--HQNRD------DARNIAKAIAESYKEGRNEDERKRAGDALDALESEV
A0A2D6DVN8      NTD-HIEIRIR--HQNRD------DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEV
A0A3C1W2R2      NTD-HIEIRIR--HQNRD------DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEV
A0A2E3NAY6      NTD-HIEIRIR--HQNRD------DARDIAKAIAESYQEGRNEDERKRAGDALDALEAEV
A0A2E3II01      NTD-HIEIRIR--HQNRD------DARDIAKAIAESYQEGRNEDERKRAGDALDALESEV
A0A368B8C5      NTD-HIEIRIR--HQNRD------DARDIAKAIADSYQEGRNEDERKRAGDALDALESEV
A0A3R7RBB5      NTD-HIEIRIR--HQNRD------DARDIAKAIADSYQEGRNEDERKRAGDALDALESEV
A0A2A2QX62      GTS-LIEIRVR--YNDPK------DAQAIASAVSEAYRERRTALQSEVASQAMDQLGKAV
A0A4Q3BWH6      GTS-LIEIRVR--YNDPK------DAQKIAKEVAEAYRERRRKLQGDHANQTLDELRKAV
A0A3N5WCF1      GTD-LISIRVR--HTNKV------DARDIAEEVARAYKEYRAEIETRDADRQLQELNKAV
A0A4Q3C1K5      GTD-LIQIRVR--HTSKE------DARNVTDEVAKAYRDYRLEIENRDADKALYELNKAV
A0A2G4G428      QTL-VVNVEFT--HPNRE------LARQVTTLFCKAIQKNSEDERLVITNPLVEKYRMDI
A0A139TV24      KESSLLQMTLT--SSNPD------KATDTLNKLIEIYNEHSREERRAIAVKTKEFIRRQL
A0A2N8HT11      KESSILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQR
R7DS70          KESSILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQR
A0A2N8HNL6      KESSILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQR
A0A146GCJ0      GTR-LVQIVVE--DKNPE------KAQKIAATFVKEFFRENFDQKLALSRVANEFLQDEA
A0A2T6D6H8      GTR-LIELTVE--DKNPE------LAQKIAFSIVREFLRENFDQKLALSRVANEFLQEES
A0A5C9DC49      FTR-LIDVTAE--SGDPA------LAQTLAQAVVEEYIKQNSEDRTGVGQNAGQFLMAEE
A0A139TUL1      KESSLLELTLR--LSHPQ------KAEDVLNYLIEVYNDHSRREKQIASTRAEDFIVKRI
A0A2N8HCB0      KESSLLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQLAASRAEEFIVKRI
A0A2N8HP04      KESSLLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRI
A0A2N8HRJ0      KESSLLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRI
A0A366HAG0      KSD-FITLDYY--DEDPD------LAALIANTIADSYKETRLETDNARINKAIEGLNIQI
A0A3M1I8A3      MTR-LVEVSVE--HTDPR------KAKDIVDRLANEFIERNRLLKTGRMMSTLQVLRSQA
A0A4V0XS84      ATR-LIEIKAN--HTDPQ------KAAKIVNTLVSIFMKQNTDDQSSKSQETFKLLTDEA
A0A0R2XQ77      GTL-MIGVGYN--HPDPV------IAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRA
A0A2E9IN28      MSL-MIHIAYS--HPDPI------VAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRIRA
D5ENH7          MSL-MVSVTYT--HPDSQ------MAADIANLFADEFINYKLTENIDASMVAVEGLRIRA
A0A351WE84      DTS-LINISVT--QEDRE------LAARIANEMAAVYREQRLDVKRSELRRAIEVLDNEV
A0A1V5QDZ6      DTS-LISIQVY--REDPT------EAARIANSIAQVYHDQRLSMKRRELKRAIEALEGEL
A0A4Y8P964      NTR-LVKIKFD--SVNAE------AAAQIANAYAEAFIAFGLDRKLEANQHARQFLAKQL
A0A3D4HF88      ASL-LIAVTYT--HPDAR------IAAHVANLFADEYINYNLRLTIENSMKAVEDLKLRV
A0A351MR11      MTM-IVNVEFT--HPDRD------LSRQVCRLFCESIQKNSEDERLTVTNPLVEKARVEI
A0A5B5WI95      KESSLLEMTLT--ANNPQ------KAADVLNQLIAVYNQVSIDEKKLAAQKTKKFIEGRL
A0A2N8I9W1      KESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRL
A0A4Q5IH27      KESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRL
A0A2N8IBZ6      KESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRL
A0A2N8IJW9      KESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRL
R6J100          KESSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRL
A0A1V6J089      DTM-LMNISAT--SEDPK------QAAAIANEIANVYRERRLADKRREIQHAIDAMSNEV
A0A3C1BZR1      DTT-LMNISAT--SEDPK------LAAEIANEVANVYRDRRLLAKRREIQRAIDAMSNEV
A0A1H6KPB7      GKD-LVDVKVV--GSDPA------LVKLICDAVTECYKEGREAQENEVLDKAIATIQEEL
A0A2E9ISN4      NGT-MIDCLVD--SVAAE------YSKAYLVEMIQGYRSLRMEELMEVNQSALLGLKNEE
B9XAX1          ETR-LVDITVT--HPNAE------MAQKLANAVAQEFILESLDQRFSNTKAANELLYAEA
A0A5R8KKM9      RSE-IINITYY--DEDPQ------LAADIANAVAESYRETRIQVDRDLADNSIKEFNIQV
A0A139TS01      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVL
A0A3E1EJT7      LSL-MTAIEFR--HPNPK------IAARVANLIAVEYIAYNSRLRVEESLKAVDDLKDRA
A0A317ZP96      MSL-MINIAYS--HPDPI------VAAEVANLFAKEFIDYNLKLNIDSSMKAVEDLRIRA
A0A2D5WGA5      NTS-IIELRAY--DRDPN------LAQDIAQALAEEYKNHRTSLQKERVKTGIDTLTNRM
A0A2E7SSH2      NTS-IIELRAY--DGDKQ------LAQEIAQALAEAYEEYRQSLQQKRVQAGIDKLKERM
A0A349GXM8      GINPMVSVAVQ--SRNKD------YTAAFLSLLIDEHREEWQTVQRQARNSAGGMLEQEL
A0A4P5YP61      GTR-LIDVSVE--HPNAA------MAALLANSIFKQYVQLSYEQYVSSGLTASQFLVEEA
A0A5R1Q5N3      NTR-LVQIKFD--SVNAQ------AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQL
I0JYY7          NTR-LVQIKFD--SVNAQ------AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQL
A0A4R7S1J2      GTR-LLDITAT--HGDPI------VARDLAVATAKGVMKWDLEQRSQSVGVANEFLMQEA
A0A2A2XV69      NTE-LIQISVL--DQDRN------EASEIANRIAEEYQRRRIGEQQGTVNRSLIQLKDEV
A0A651H7X9      LSL-VISVQYR--HRDPV------LAARVADLFVEEFINLNTQMRIQESLRAVEDLRDRA
A0A4Y8P842      GTR-LIRICYD--SPNSF------GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQI
B3DZK9          GTR-LIRICYD--SPNSF------GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQI
A0A5E6MPC4      NTR-LVKIRCE--SPSAF------GAAQLANVYAQSFITFGLDRKLEANRYARKFLAGQL
A0A4V1SB02      NTR-LIDIVAE--ENSPK------KAQALANEVVNQFFLLQGSDKSGVSKDAFVALKAQE
A0A3C1VB86      NTR-LIDITVR--NTDPG------LAARLANSLVKNYLGQDALVQSSVNEEAGVFLRREA
A0A146G2Q9      NTE-LIHITVF--STDNK------EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEV
A0A2T6D3Y2      NTE-LIHITVY--STDNK------EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEV
A0A2V2SDV4      NTS-LIEIRVT--TDKPE------EAAKLANEIAQAYCDYRVEHRKQMTMGGVDALEKKF
A0A2V5PK75      NTK-FIEIVVY--SENKD------EAARLANAIAEAYQEHRQEQREKLSQGGIDAMEKRL
A0A1V6DME1      NTS-LITIRVF--SQDAE------EAARIANEIAETYKEYRLAQRRELTMGGIRILEDRF
A0A3D3DIJ3      GTS-LIEIVVY--SEKPE------EAARIANAIADAYKTHRQEQRAQLSRGGIKALEERF
A0A2D5VY59      NTS-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQY
A0A2D8UZZ4      NTS-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQY
A0A353DV86      NTS-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQY
A0A2E5EPT8      NTS-IIALTVY--SEDKK------EAAEIANTIAKVYAETREQNRITQVRKGIAKMREKL
A0A5C9DS93      NTS-IIEINVY--SKDKA------EAAEIANKIAEVYKASRDELRLRLVDQGLKTLREKL
A0A350EWA4      NTE-LIEITVF--NENKA------MARNIANEIAKVYREWRMNLSDERFQEGFDAINQQL
A0A5B5WZ91      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVL
A0A2N8HD92      ATD-LVDVIVS--GPDPK------LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVL
A0A2N8HIT2      ATD-LVDVIVS--GPDPK------LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVL
A0A354EBD3      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A355VEB2      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A2N8IMT3      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
R6K1U5          ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A2N8IWC2      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A2N8I441      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A2N8I3A6      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A410SCC4      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A3R5VEW0      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A411SSG2      ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
B2UKW3          ATD-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVL
A0A1M6RLZ4      GTD-LVEIAFV--HSNRE------DVKMITQAIADSYREMRIEDEEKRRTEASYELEKKI
A0A354T7G8      RSD-FVSIDYY--DQDSQ------LAANIANEIAKSYMEQRNNIETEKKQKALTVLQQQI
A0A2S7U4L6      GTD-LIEISLRMVKDNRQ------YVKPATEAIALAYSEMRINQETKRRDKTRVELAKKI
A0A512MBZ2      RSD-FVIIEFY--DQDAA------LAADVANAVASSYMTQRIEIDSSQKREALERMQKQI
A0A2E8MEZ0      GTD-FIEITVT--HANPE------DAKEIAEAVSQAYIERRNSTEEGRAQEALEALNQEL
A0A4Q2YKS3      GTD-LISIKVR--HVNKE------DARDVATEVSEAYRQYRNDLEGQEAEKAMEELSKAV
A0A2E3EC33      GTD-LIDIEVY--DTDAQ------LAADIANALANAYQARRQNEEKERADTALEKLDTQI
A0A2E4GN01      GTD-LIDIEVF--DTDAQ------LAADLANALAXAYQXRXQNEEKXRADKALEXLXTXI
A0A1Z8XU55      GTD-LIDIEIY--DTDPK------LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQI
A0A2E1RQR9      GTD-LIDIEIY--DTDPK------LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQI
A0A2E3ISQ4      GTD-LIEIEVY--DTDPN------LAADIANAVAKAYKIRRQRVEKERADTALALLDLQI
A0A2D6W6F4      GTD-LIDIEVY--DTDPN------LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQI
A0A2D8Z5A8      GTD-LIDIEVY--DTDPN------LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQI
                                                                            

A0A2A2XVF1      QKLKKKLEESEIKLQRYKEQNQAVS-----------------LEE----RQNITVERLRE
A0A2V5UHJ2      TELKERVQQSEAALNSYRKEKGIIS-----------------VDD----KSNVIIERLLD
A0A2V5PST3      AELKARLERAEAELNRFRQTHGVVS-----------------IEK----GENIVIDRLVD
A0A2V5PXM3      KRLKVKLEQSERAMQEYKEQTKSVS-----------------LED----RQNVVVEKLKE
A0A139SU05      EQLRLESEAKAQRQQEYMQRHNLIS-----------------LDN----STSIVDSRLLA
A0A1D8AZK8      EELRKESEIAEGRLQDYRRKHNLVS-----------------LDN----SINIISERLRT
A0A1V5QB01      NRVHEELKRAEERALEFARQNSVIA-----------------IQE----RGNVAARILGT
A0A139SPN4      EQLRLESEAKAQKQQEYMEKNNLIS-----------------LDS----STSIVDNRLLT
A0A1V6E7N1      DDLRKESEAAALQVQRFMEVHKLVS-----------------LDE----STNLVNARLQT
A0A2D9MYT1      TNLSTAVHTNYMALHNFKLEWDIIS-----------------LED----SQNTTLQALLK
A0A258ANJ7      QRLQDKLKKSEIAMHDYKRSNQAIS-----------------LDE----RKDLVLSKLKE
A0A139TLN4      GVINEEMGENDLAIENLKKESNILT----------------DLST----ALTEEYENSLN
A0A290QGD9      NDQRKKVEELATRLQTYRETHKMVS-----------------LDQ----RRDMVTETLKA
A0A1D8AS58      DQQKKRVEEMAIILQNYREKNQQVS-----------------LDQ----RKDIVTEKLKA
I6AQC1          ESQRKTVEDLNRQMQAYREKYNMGS-----------------LDK----TKDIQTRKLME
W0ITH7          ESQKKKVEDLNRQMQAYREKYNMGS-----------------LDK----TKDIQTRKLME
A0A1G3ZFT0      PLAKQDLTRAELALNRYHTTSGKID-----------------------------------
A0A1Z8ZMT6      KERESELETARRRAGTYTPALEAEK------------------------EMAVAEKAIQD
A0A2E8MCT7      KERESELETARRRAGSYTPALEAEK------------------------EMAVAEKAVQD
A0A290Q2Z2      ESQERTVSLQRDMVEQLRKDLGISG--------------VDLNAR----YSDMEIETLRQ
A0A2A2RGK2      DRLRKKLRVSEEAMQSFRERERAAS-----------------IET----MLSSAQSQVGE
A0A2A2XXF7      DRLRKKMRVSEEAMQSFRERERAAS-----------------IEN----MLASAQSQIAE
A0A2A2R5D6      AKQGEVVQRAKDYVEELRKSLNLNM--------------VGGGEN----ETQMIEEEWKR
A0A1J4XH17      KEQQKVVENIETQMAEYREKYGTVS-----------------LEQ----QADIDHQELTE
A0A3C1VJ32      LEESNRIEMLQANVDNLRRTLDINN------------GTASSPEP----ELTVEQLRSY-
A0A2N9NTX7      KEQEASVGKAQSNVDYLRDKLKISD----------PNSGAEMPGP----LLTTESLHRI-
B9XK55          QEQDDLIAKQEAKVDKLRKDLKVTD----------L-GGESATGP----QQTLEPMNVMH
A0A4P5YMI6      ETHEKNIREKQKVVEAIRKDTGITL----------I--TPEGAGA----YNTLATETLRH
A0A2E6T482      EEINKKITGLQGNVDRMRTELGISD----------A----AGEES----YSIIEPEIVRR
A0A3C0DQZ7      EEINKKITGLQGNVDRMRTELGISD----------A----AGEES----YSIIEPEIVRR
A0A1Z9CBK5      TTINEEIGAMQANVDXLRVQLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2D6ZI96      TTINEEIGAMQANVDXLRVQLGISD----------A----AGEDS----YSIVEPEIVRR
A0A358KGZ3      EKTNDEITAMQANVDDLRAKLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2E9ZQX4      KKTNDEITAMQANVDDLRAKLGISD----------A----AGEDS----YSIVEPEIVRR
A0A3D5JZU0      EKTNDEITAMQANVDDLRAKLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2E6HCR0      EKTDEEISVMQAKVDDLRVKLGISD----------A----AGEDS----YSIVEPEIVRR
A0A1Z8WN04      EKTNNEISLMQAKVDSLRVTLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2D7L1N4      EKTNNEISLMQAKVDSLRVTLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2E2R937      EKTNNEISLMQAXVDSLRVTLGISD----------A----AGEDS----YSIVEPEIVRR
A0A520QQY4      EKTNNEISLMQAKVDSLRVTLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2D5MR66      EKTNDEISVMQAKVDALRVKLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2E0PDQ1      EKTNEEISLMQAKVDSLRVKLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2E2ZZP9      EKTNEEISLMQAKVDSLRVKLGISD----------A----AGEDS----YSIVEPEIVRR
A0A2A2RGF2      ADQDALVRTALTNVNQIHQDKGLNV----------I-HEVGGSV------MSLETDTIRA
A0A2G4I5Y6      LDQDALVRTALTNVNQIHQDKGLNV----------I-HDGGGTI------MSLETDTIRS
A0A3M1I883      EEQNARVERLQKQLDQLRLELNIPD----------T-VAGTAGAY----SISTERERLST
A0A1V6JZ45      DEQAEAVAKLQDNVDQLRAELNIPD----------S--INDASVY----QTSLEREKVSA
A0A520RRW5      LTQQNKVQTKQKDLDKLREDLNISD----------I-YSAEGSSI----GMTTEPQIVMK
A0A356NPK0      LTQQNKVQTKQKDLDKLREDLNISD----------I-YSAEGSSI----GMTTEPQIVMK
A0A2D7B5P5      LXQQNKVQTKQKDLDKLREDLNISD----------I-YSAEGSSI----GMTTEPQIVMK
A0A3D3XGB5      LTQQNKVQTKQKDLDKLREDLNISD----------I-YSAEGSSI----GMTTEPQIVMK
A0A2V6F8A1      SQNDEKIKEAEAKVDELRKEYSISD----------I--SAEGPYA----ISTLEPQTVRS
A0A2V5TNH4      QQNEEKVKAAEAEVDQLGKEYKVSN----------G--SLEGA--------TLEPQTVRS
A0A2V5X5Q6      EQNDEKVKAAEIAVDQLRKEYKISD----------I--QPEGAYA----YSTLEPQTVRS
A0A2V2DJ66      AQQETKVKELDRRLVEYREKNGAIS-----------------LDQ----MDDVDRRELQE
R7L5A9          SQQEAKVKELDKKLVEYREKNGAVS-----------------LDT----LDDVDRTELRD
A0A4P5QM05      KTKEDEMARLFQEASRIRQDESISD---------------PDPDSSNAALSITAPTGIAT
A0A4Q3C001      EKQRKVVEDAAVLAAKIRQEDGIVD---------------PDIENPTALISGGD-RSIVS
B4DB23          DRRRKEMEDTSAVAMQIRAREGIVD---------------SDPDKENSVISGGEGGNVLQ
A0A2V5URB2      AELKDRVQKSEEALNHFRRAKGIIS-----------------LND----KENIVVDRLAD
A0A5R8KA81      KRLAKALADSELALQNYKDERQAVS-----------------LEE----KQNIVTEKLRD
A0A5B5WU87      AVISEEMRKNDLAVEKLKKETNILT----------------DLST----ALTEEYENSIN
R7DZW0          DVISEEMKKNDLAIEDLKKETDVLT----------------DLST----ALTEEYENSLN
A0A2N8HID1      DVISEEMKKNDLAIEDLKKETDVLT----------------DLST----ALTEEYENSLN
A0A2N8HS06      DVISEEMKKNDLAIEDLKKETDVLT----------------DLST----ALTEEYENSLN
A0A3R5R2M8      AELEKSLNKADKELTDFKAKSDIVK----------------DTET----TMSADFSSSQV
A0A411SUQ6      KELGASLSDVDKKLTEFKTKSDIVK----------------DADT----TMSADFSTSQA
A0A2N8HZF2      KELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQA
A0A354E720      QELGASLSDVDKKLTEFKTKSDIVK----------------DTDT----TMSADFSTSQA
B2UPB6          KELGASLSDVDKKLTEFKTKSDIVK----------------DADT----TMSADFSTSQA
A0A2A2XXW5      TGKEVELEALQGKLQKYRKDKGMVS-----------------LKD----AQNIDAATMRD
A0A2V6JLK8      GKQQKRVEEAGAEMAKIRDEEHIVD------------LNPEGTED----SQAPVNSIVVK
A0A2W5Z1A5      DKQQKKVDDAAVEVARIRDTEHIID------------LNPEGTED----SKTPLDTVVVK
A0A2V6EA09      AREQKAVSDAAAEVARIRDQEHIID------------LNPEGMED----TQTAVNSIVLK
A0A2V6GQI7      AREQKAVSDAAAEVARIRDQEHIID------------LNPEGMED----SQTAVNSIVLK
A0A3C1HEJ2      QELLETIKTLESLLQEFKKNHPGIS------------------EE----EQAILSKQIGE
A0A522ULD9      EKQQDKVNKAEEDLEHIRKDLGVSS----------------------VGGMQIDKMKLQA
A0A1V6JU76      NGLEVDVAKAEEDIQNYRAQVKFVS-----------------LDS----SYNIVAEALSQ
A0A1Q6UHJ9      SQQEAKVKELDKRLVEYREQYKAIS-----------------LEN----LDDVDRNELRD
A0A2V2BXR0      SQQEAKVKELDKRLVEYREQYKAIS-----------------LEN----LDDVDRNELRD
A0A2D8V0G3      NQLADDVRATRLSVFQFREDNQMPS----------LEESQNTLSQ----ALFLASDGFQK
A0A348S017      DGLQEEVKNSRLAVFRFREKNKMPS----------LEESQDTVSK----ALFAASQSHQL
A0A3C1UUV7      DGLQEEVKNSRLAVFRFREKNKMPS----------LEESQDTVSK----ALFAASQSHQL
A0A350I3V2      DGLQEEVKNSRLAVFRFREKNKMPS----------LEESQDTVSK----ALFAASQSHQL
A0A520RGV5      DGLQEEVKNSRLAVFRFREKNKMPS----------LEESQDTVSK----ALFAASQSHQL
A0A3D3XF90      DGLQEEVKNSRLAVFRFREKNKMPS----------LEESQDTVSK----ALFAASQSHQL
A0A2D7B522      DGLQEEVKNSRLAVFRFREKNKMPS----------LEESQDTVSK----ALFAASQSHQL
A0A356NIC2      DGLQEEVKNSRLAVFRFREKNKMPS----------LEESQDTVSK----ALFAASQSHQL
A0A2N8HDG3      AQVGADLKQVDQKMDDIKIKNDIIA----------------DTEA----SISADFNAAQT
A0A2U8DZK4      AAQEKIVIAQRDTVERLRAELSISG-----------------IDLTNPRNNSMEIERLRQ
A0A2T6DFL8      LKQEQAVTRQRDAVEKLRKELNISG-----------------VDL-NARYSDMEIETLRQ
A0A1D8AWD4      DKQELAVTTQRDHVEKLRKELDIAG-----------------VDL-SQRYSDMDIETLRQ
A0A4Q1C9S2      VKQEQAVTDQRDHVEKLRKELDIAG-----------------VDL-SQRYTDMDIETLRQ
A0A178IH18      AGQERAVATQRDLVEKLRAQLNISG-----------------VNLVTPQGGDIEIETLRQ
A0A2T6DT99      EKQEKVVTSQRDLVEKLRKDLNISG-----------------VDL-SARYSDMEVETLRQ
A0A1G3ZT33      AAQEEVVSKQRDLVEKLRRDLNISG-----------------VDL-NARYSDMEIERLRQ
A0A3E1E2T2      IAQEQVVMLQRDTVERIRKDLNISG-----------------VDL-NARYSDMEIETLRQ
B1ZMW1          EAQEQVVSAQRDTVERLRKDLNISG-----------------VDL-NARYSDMEIETLRQ
A0A3D1TI55      DQQKFKVRELEDNVEDLRLQNQIVF-----------------GAT----GAELSKERLDQ
A0A3R8IT45      ETQKKKVEELQFQMQAYREKYGL-T-----------------LDP----KKDILTKKLVE
A0A1H1MGC9      EQQKKKVEELAINLQAYREKNKMVS-----------------LDQ----RKDIVTEKLKA
A0A2A2PYE8      EEQQKRVERMARELQEYKEKNNMVS-----------------LDQ----RKDIVSESLKA
A0A2T6CN73      ETQRKLVERLASELQRYKEQHKMVS-----------------LDQ----RKDIVSESLKA
A0A3E1ET42      KSSENDLEAARIVMNEVARKHGIV-------------DNSYQGGQGFTAVVTTKPEEYAD
A0A2A2YDW8      LEHSDVVEEKRKQRDNLQRRA--PS----------V-VRDFLTGN----AGNGYQSMQAN
A0A352XLN9      LEHSDVVEEKRKQRDNLQRRA--PS----------V-VRDFLTGN----AGNGYQSMQAN
A0A3D0YP62      QNKSDRVAELRKRLMDIAEKVGVIW----------V-ESERGGET----IG-GELELRQL
A0A3D3DV47      QNKSDRVAELRKRLMDIAEKVGVIW----------V-ESERGGET----IG-GELELRQL
A0A2E5XJ49      RSQEDLVEDKRRHFHTIVKAVGVPY----------I-EGVFPSGR----MGQSEEEILKM
A0A2E6SBY8      RSQEXLVEDKRRHFHAIVKAVGVPY----------I-EGVFPSGR----MGQSEEEILKM
A0A2E5QMS4      RSQEDLVEDKRRHFHSIVKAVGIPY----------I-EGVYSSGR----MGQSEEYILKS
A0A2E7YXQ3      RSQEDLVEDKRRHFHSIVKAVGIPY----------I-EGIYSSGR----MGQSEEYILKS
A0A2E3H787      RSQEDLVEDRRRHFHAIVKAVGIPY----------I-EGIXTSGR----MGQSEENILKT
A0A2E7AGN1      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILKT
A0A2E7AKY7      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILKT
A0A3D4CU34      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILKT
A0A2E8M146      RSQEDLVEDKRRHFHAIVKAVGIPY----------I-EGVLTSGR----MGQSEEAILKS
A0A355S8S2      RSQEDLVEDKRRHFHAIVKAVGIPY----------I-EGVLTSGR----MGQSEEAILKS
A0A2D6DVN8      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRT
A0A3C1W2R2      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRT
A0A2E3NAY6      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRS
A0A2E3II01      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRT
A0A368B8C5      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRT
A0A3R7RBB5      RSQEDLVEDKRRHFHSIVRAVGIPY----------I-EGVLTSGR----MGQSEETILRT
A0A2A2QX62      VQQKDLVEDKRKLLSQIIRQEGIIY----------QGDSSVFQGT----SGFDKADEAET
A0A4Q3BWH6      LVQEDLVEDKRKLLSQIIRTENIIY----------WGDPSVSQGA----RGFTKADDAEN
A0A3N5WCF1      RDQEDKVEERRKVLATIVRNKGIIY----------RGQDAFY-ES----GGVDEDQGARN
A0A4Q3C1K5      RDQEDKVEERRKVLATIVRTKGIIY----------KGQDSFY-GQ----SGVDEDQEARD
A0A2G4G428      DSVEDKIRKLYDKRNELIKGQKLLS-----------------IAK----DTNTLTAERAA
A0A139TV24      EQIGEELKRLDSERDDIKFENDIIA----------------DTQA----SLSADFSTAQT
A0A2N8HT11      GQIGADLKEVDQKMDDIKIKNDIIA----------------DTEA----SISADFNAAQT
R7DS70          GQIGADLKEVDQKMDDIKIKNDIIA----------------DTEA----SISADFNAAQT
A0A2N8HNL6      GQIGADLKEVDQKMDDIKIKNDIIA----------------DTEA----SISADFNAAQT
A0A146GCJ0      DKLKVKLEASERKLQAYREDNKAVS-----------------LEE----RQNIIVEKLRE
A0A2T6D6H8      EKLKAKLETSERKLQAYREQNKAVS-----------------LEE----RQNIIVEKLRE
A0A5C9DC49      MRIKERLLKAERSVQQYLATNNISL------------------QQ----GQDILTEEFRT
A0A139TUL1      EKLGGQLGGVDKQVIDYKRHSRIVK----------------DMST----TLEATFSKLQE
A0A2N8HCB0      GKLGGQLGGVDKQVIDYKRNSRIVK----------------DMDT----TLDATFNRVQE
A0A2N8HP04      GKLGGQLGGVDKQVIDYKRNSRIVK----------------DMDT----TLDATFNRVQE
A0A2N8HRJ0      GKLGGQLGGVDKQVIDYKRNSRIVK----------------DMDT----TLDATFNRVQE
A0A366HAG0      AAKELQAKQSMERMIQLKKDLDLVT-------LPTSMDAKGAQDD----VMTPESAMLLD
A0A3M1I8A3      QQMEREVTELEEAVQQYREKQNFVS-----------------FDA----GSNPVAQSLSQ
A0A4V0XS84      KSMKVKVDRDEEAVHKFKEGHQVVS-----------------FDE----TENVVLLALKQ
A0A0R2XQ77      DQQKERVEELELKMAEYREDNNAVS-----------------LDS----QENIAGTQLST
A0A2E9IN28      DQQKERVEELELKLAEYREENNAVS-----------------LQS----DENIAGAQLAR
D5ENH7          DRQKERVEELELELAEYREEHNAVS-----------------LDS----QENIAREQLGS
A0A351WE84      QKQQEKVDQAESELERIRQEVGVSF-----------------LGQ----GFRADKVRLQQ
A0A1V5QDZ6      AKQQEKVEKSEEELERIRKDLGVSV-----------------LSQ----GVRADKLRLSQ
A0A4Y8P964      DSMRKKLALAEERLANFTEQTGIVK----------------FPGV----DRSPAEQELNR
A0A3D4HF88      NQQRSEVEALETRLAEYKERTGSIS-----------------VEE----REDIDLQEIMQ
A0A351MR11      ESLEERLNRLYLDKNELVGRERMLA-----------------IVK----DTNTLGSERGA
A0A5B5WI95      EELEKSLNKAGKELTDFKTKNDIAG----------------NAET----TISADFSSAQA
A0A2N8I9W1      KELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQA
A0A4Q5IH27      KELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQA
A0A2N8IBZ6      KELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQA
A0A2N8IJW9      KELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQA
R6J100          KELGAALSDVDKKITEFKTKSDIVK----------------DTDT----TMSADFSTSQA
A0A1V6J089      RKQQERVEEAEAELERIRQERGIAL--------------IGRGLM----SIRVESTRLNA
A0A3C1BZR1      RKQQERVEEAESELERIRQERGISL--------------IGRGNM----SIRVEATRLNM
A0A1H6KPB7      TRRENELLAKTDTLRKYMTTSDYIG---------LLSDTGNTIPT----TVNNEEAVLTE
A0A2E9ISN4      TRVLEDLEQAKQDLETFERENQILF-----------------EKE----RADMDIAFVNQ
B9XAX1          GKLKQKVEMSERNLQAYKESNKTVS-----------------LED----RQNIIVEKLKG
A0A5R8KKM9      AAKEQLAQQARNKMFAVKKDLGIIE--------LPGDNRATGQDV----IDTVESATLID
A0A139TS01      REQEDIVNDKMMALKKLIVENDYLP-------STMYRSGDNRSVM----TGAMEDEDFRN
A0A3E1EJT7      DQQRKRVDEIANSLLAFRQRGNLIS-----------------LVQ----SKDIVTEKLKA
A0A317ZP96      DQQKDRVEELEFKLADYREQKNAVS-----------------LDS----QENIAREQLGS
A0A2D5WGA5      EKINIEITGMQGRVDRLRTDLGISD--------------AAGEES----YSIIEPEIVRR
A0A2E7SSH2      EKTNEEISSMQSNVDALRAKLGISD--------------AAGEDS----YSIVEPEIVRR
A0A349GXM8      ARLDQKIRTAEDDLIEYQRLHDIAR-----------------VEA----RGTMESRHLSA
A0A4P5YP61      EKLKKKMLSSEKALQTYREKVGSAA---------------ISLDD----KKDIVGQKLKE
A0A5R1Q5N3      DSMRKKLALAEEKLATFTEQTGIVK----------------FPGV----DRSPAEQELNR
I0JYY7          DSMRKKLALAEEKLATFTEQTGIVK----------------FPGV----DRSPAEQELNR
A0A4R7S1J2      ERLRKKVELSEQALQKYRVENNAVS-----------------LEE----NQNLVVSQLQD
A0A2A2XV69      AKQSRRVDELRAEAQRIRIENEIQD------------LNPDSVVD----PMQAANEVLLS
A0A651H7X9      EQQRKVVEDLELRLQAFREDANMIS-----------------LDQ----RRDIVTEKLKM
A0A4Y8P842      ELMKKKVTESEAKLARFMEKTGIVK----------------LPGI----NSSPTEKELAQ
B3DZK9          ELMKKKVTESEAKLARFMEKTGIVK----------------LPGV----NSSPTEKELAQ
A0A5E6MPC4      ETLRKKVAQSEERLADFMAETGIVR-----------------------------VSQMDK
A0A4V1SB02      EDLRKKMAESDNALADYRQQHKAVS-----------------LDE----KSNVLADRVKD
A0A3C1VB86      DRLKKKLEASDQALQDYRKQVGSVS----------------------------LEQSQDV
A0A146G2Q9      EKQQAIVTKLQETMTRIRQETGIQD------------LNPDTADG----GTQAENSILLQ
A0A2T6D3Y2      EKQQAVVTKLQDTMTKIRQETGIQD------------LNPDTADG----GTQSENSILLQ
A0A2V2SDV4      TEQQGKVSEAQSNVDVLRFKLQISD------------PVVTENTP----GTLMTGDTLRR
A0A2V5PK75      KEQEEKVAKKAEEVEKLREELQVPD------------SMSLEAAP----VQLLSAETIHK
A0A1V6DME1      QDQEKKVQAAQREVDELRAKLEISD------------ADAAGTSP----TTLLEAEVLRR
A0A3D3DIJ3      AEQEAKVKAAQERVDNLRKELNISD------------AMASGDGP----SPLMTAETLRK
A0A2D5VY59      ADQNEKVRLKQADLDQLREELNISD-----------IYSAEGSSI----GMTTEPQIVLR
A0A2D8UZZ4      ADQNEKVRLKQADLDQLREELNISD-----------IYSAEGSSI----GMTTEPXIVLR
A0A353DV86      ADQNEKVRLKQADLDQLREELNISD-----------IYSAEGSSI----GMTTEPQIVLR
A0A2E5EPT8      GEASNSVVQAQADVQRVREELKFDV------------IMETPGKV----ALALDSERVRA
A0A5C9DS93      TEHHGFVEVAKSNVNQILKDKGIIL-------------TMDTPGM----IGTLDIDTMRA
A0A350EWA4      EKAESDLKESEAEVNRLRASLEITD------------IDEASSRN----EQFFDMQTIQQ
A0A5B5WZ91      REQEDIVNDKMMALKKLIAENDYLP-------STMYRSGDNR-VM----TGAMEDEDFRN
A0A2N8HD92      REQEDTVNEKMMALKKLIAESSYLP-------TT-WRNGENRNTL----TAGMEEEDFRN
A0A2N8HIT2      REQEDTVNEKMMSLKKLIAESSYLP-------TT-WRNGENRSTL----TAGMEEEDFRN
A0A354EBD3      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A355VEB2      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A2N8IMT3      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
R6K1U5          REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A2N8IWC2      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A2N8I441      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A2N8I3A6      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A410SCC4      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A3R5VEW0      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A411SSG2      REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
B2UKW3          REQEDAVNEKMMALKKLIAESSYLP-------TS-WRNGEHRSTL----TAGMEEEEFRN
A0A1M6RLZ4      QAQEDLVADHRNRLATMSQKTGIPY-----------AGDKNSIGA----GSNPAELNFRE
A0A354T7G8      SDQEELRRLAQVRSQEARRKAGIVGDWIAGGGSSLNPGGEMRSEK----DSMVISREQAL
A0A2S7U4L6      QKYEDIVEDYRTRLLEFSAKTGIYS-------------LDRSSGG----ATDVVRRDLQQ
A0A512MBZ2      AEQESLRDQARAKMLEAKKKAGIVGDWIAGGGPSITPGVSLATSK----DGMVASREQAM
A0A2E8MEZ0      QDQGDLVQDYRKALTVLIQQYGI---------PYFDGRDSGQVGQ----AEELMYRRAQE
A0A4Q2YKS3      REQEDIVAERRKALSNIVREKEII-----------YRGSESIFGN----TGVFEDDSARS
A0A2E3EC33      MAQMTRLEKARDMMINLMEELNIVD--LSLGEPTWLRGSQPNTGI----ASLVMTAKQKE
A0A2E4GN01      XAQMTXXEXSRDMMIGLMXELNIVX--LSLGEPTWLRGSQPXTGX----ASLVMTAKQKE
A0A1Z8XU55      KKQEGRLEAARNNMIELMEELNIVD--LSLGEPVWLRGSQPNTGT----ASLVLAAKQRE
A0A2E1RQR9      KKQEGRXEAARNNMIELMEELNIVD--LSLGEPVWLRGSQPNTGT----ASLVLAAKQRE
A0A2E3ISQ4      QQQEKRLEDARSVMIKLMEDLNIVD--LSLGEPVWLRGSQPNTGT----ASLVMAAKQRE
A0A2D6W6F4      KSQEGRLEKARNNMIELMEELNIVD--LSLGEPVWLRGSQPNTGT----ASLVMAAKQRE
A0A2D8Z5A8      KSQEGRLEKARNNMIELMEELNIVD--LSLGEPVWLRGSQPNTGT----ASLVMAAKQRE
                                                                            

A0A2A2XVF1      LSSKATEAKSERLRLESDIEQVRKVPANNT------------------DELLRIGSVATI
A0A2V5UHJ2      LNKGLTAAEGDRIAWEAQVRAARG------------------------RNADEVPSVRNS
A0A2V5PST3      LNRNLTTARAQRLEAESLNSVVQN------------------------KSTQYLSQVLTQ
A0A2V5PXM3      LNQKVTEAKSLRILHETSYNQALQFSNNP-------------------AALLFLPAVAND
A0A139SU05      VNGSLTQARLRLLEVESLAKQVDDYQEAG-------------------ANLLEITYIGNY
A0A1D8AZK8      INATLTSARLSRIDLENLLGQIERMQQAG-------------------GNLLEIGYITAY
A0A1V5QB01      LSSQAAQFRTQKMFLEAQQPLLSRASDEAVLAALGPAGSGIPGVGLMSIAAMGVETNAPA
A0A139SPN4      INGALTAARLRLLEVESIAKQVADYQESG-------------------DNLLEITYIGSY
A0A1V6E7N1      VSTELTRVRLARLELESQVKQIETYQAEG-------------------RNLFEISSIATY
A0A2D9MYT1      AQTDYDAAHSRAVEAQASADEAQRVFTET-------------------GEFGTIPDVAAD
A0A258ANJ7      LGSELNQQSKERLTLETQLQACKEGTLPR-------------------DELLSLPSIASH
A0A139TLN4      DKKDLRELTLEIKSIEYLKEYLEKEA----------------------EFDSRLVPINSK
A0A290QGD9      RNIIVTQTNARFKDAEVRWKQIQELRAAG-------------------RDLTELSFIAIQ
A0A1D8AS58      LNAYVTQTTSRLNEAEVRWRQVQERKATP-------------------ALLLELPFIASQ
I6AQC1          QGSLVTQSGARLSEATVRWQQVDERLKNN-------------------GDLLELPFIASN
W0ITH7          QGSLVTQSGARLSEATVRWQQVEDRIKAN-------------------GDLLELPFIANN
A0A1G3ZFT0      ------------------------------------------------TKLEIKNLIQEI
A0A1Z8ZMT6      LSIRYG------------------------------------------------------
A0A2E8MCT7      LSIRYG------------------------------------------------------
A0A290Q2Z2      MQNSLIALSVDAIGRKTRYERFKS----I-------------------PAEDRINLINSE
A0A2A2RGK2      VSNNQSLIQRRIEQIDSDLAVIRANTGEP-------------------EELLTLPSVAAE
A0A2A2XXF7      ILGVQNEIQKRIQQIESDLAVVRTNTGSV-------------------EELLFLPSVAAE
A0A2A2R5D6      KSALLDDVRAEYLGRQVRYERLNR----L-------------------STNEFLDAIVAM
A0A1J4XH17      INKTVTDARRDFDIAQSRKNLVDQYIKSG-------------------GKLWDLSFINSI
A0A3C1VJ32      -QAQKLESEQAYNVSLVQLQDLQTIQQT--------------------NQSKLRDVLPGV
A0A2N9NTX7      -EGLRIESSAELVKMETLLSKLEELQRT--------------------NPAALIQTIPIT
B9XK55          YNTLRIDAETQYIKEEKLLSQLKQLKSD--------------------E---LKQAIPTA
A0A4P5YMI6      LDSLRNTAHLEFIEKDTRLAALRKIPRN-----------------------EIKEVIVTV
A0A2E6T482      YESELITAKGIHTTQATLLEGLKAQSRE-----------------------ELRASILTA
A0A3C0DQZ7      YESELITAKGIHTTQATLLEGLKAQSRE-----------------------ELRASILTA
A0A1Z9CBK5      YESELITAKGLYTQQATLLQGLQEQSVE-----------------------ELRESIMTA
A0A2D6ZI96      YESELITAKGLYTQQATLLQGLQEQSVE-----------------------ELRESIMTA
A0A358KGZ3      YESELITAKGLYTQQATLLQGLQEQSLE-----------------------ELRESIMTA
A0A2E9ZQX4      YESELITAKGLYTQQATLLQGLQEQGLE-----------------------ELRESIMTA
A0A3D5JZU0      YESELITAKGLYTQQATLLQGLQEQSLE-----------------------ELRESIMTA
A0A2E6HCR0      YESELITAKGLYTQQATLLKGLKEQSFE-----------------------NLRESILTA
A0A1Z8WN04      YESELITAKSLYTQQATLLQGLKEQGDE-----------------------ELRNSILTA
A0A2D7L1N4      YESELITAKSLYTQQATLLQGLKEQGDE-----------------------ELRNSILTA
A0A2E2R937      YESELITAKSLYTQQATLLQGLKEQGXE-----------------------XLRNSILTA
A0A520QQY4      YESELITAKSLYTQQATLLQGLKEQGDE-----------------------ELRNSILTA
A0A2D5MR66      YESELITAKSLYTQQATLLQGLQEQSSE-----------------------ELRNSILTA
A0A2E0PDQ1      YESELITAKSLYTQQATLLQGLQDQDSE-----------------------ELRNSILTA
A0A2E2ZZP9      YESELITAKSLYTQQATLLQGLQDQGSE-----------------------ELRNSILTA
A0A2A2RGF2      LESQLIEIRGLFTKKQTSVVELKKLKPE-----------------------QLRNVLGPP
A0A2G4I5Y6      LESQLTDIRGIYIKKQTSFVELKKLKPE-----------------------QLKNALGPP
A0A3M1I883      LLQALQQARSDLVYWKSKLQELERIRDK--------------------GLQDLRDAILTV
A0A1V6JZ45      MAQELTRAHSEYVYFLTKLEDLKKLDRT-----------------------SMREAVLVT
A0A520RRW5      LEQERTVAEANLIRYETLFKELTSLTLE-----------------------ELRNTLLTA
A0A356NPK0      LEQERTVAEANLIRYETLFKELTSLTLE-----------------------ELRNTLLTA
A0A2D7B5P5      LEQERTVAEANLIRYETLFKELTSLTLE-----------------------ELRNTLLTA
A0A3D3XGB5      LEQERTVAEANLIRYETLFKELTSLTLE-----------------------ELRNTLLTA
A0A2V6F8A1      LEEQRIRAEAEFSGLAGMLNGLLQLRADK-------------------GDAELRKSILTA
A0A2V5TNH4      LEEQRIRVEAEFSGLAGLLNGLLKLREEK-------------------GNTELRKSILTA
A0A2V5X5Q6      LEEQRIRVEADYSGLAGLLNGLLKLREEH-------------------GDSELRKSILTA
A0A2V2DJ66      MNTILTTDKRTYDAAAIQWSLLQEYKRDG-------------------RDLCTLPFIADL
R7L5A9          INAILTNDKRIFDAASTQWTLMQEYKRDG-------------------KDLCTLPFISEF
A0A4P5QM05      GETQLAETRALVDRLRSQLMRVEK----L-------------------KPEELMEAARIL
A0A4Q3C001      SETAVNEARNKTEELRTKLRQIES----L-------------------KADELLEVLRTL
B4DB23          RQQQVNEQQIKVVELERQLEMINS----L-------------------SPEQLQDALKTL
A0A2V5URB2      LNKRLTEAEAERIGLEAQARLIKR------------------------RDYDSLPAVISN
A0A5R8KA81      LNVRLTQSKTDRIRLENDREQVKTAGNDL-------------------YKLLSIPSIANQ
A0A5B5WU87      DKKDLRELALEIKSIEYLKQYLEEEA----------------------EHDAKLVPINSK
R7DZW0          DKKDLRELELEIKSIEYLKDYLEQEA----------------------EHDARLVPINSK
A0A2N8HID1      DKKDLRELELEIKSIEYLKDYLEQEA----------------------EHDARLVPINSK
A0A2N8HS06      DKKDLRELELEIKSIEYLKDYLEQEA----------------------EHDARLVPINSK
A0A3R5R2M8      LEKEIFELETQIKLSSVLADNLKE----A-------------------GRNGGLISVDTG
A0A411SUQ6      LEKEIFDLETQIKLASTLADNLKE----S-------------------ERKHGLISVETG
A0A2N8HZF2      LEKEIFDLETQIKLAAILADNLKE----T-------------------ERKQGLISVETG
A0A354E720      LEKEIFDLETQIKLASTLADNLKE----S-------------------ERKQGLISVETG
B2UPB6          LEKEIFDLETQIKLASTLADNLKE----S-------------------ERKHGLISVETG
A0A2A2XXW5      LKIAYETLRSTADVAKQIAQQAQEWVAAG-------------------KDITDFAPLAKD
A0A2V6JLK8      QEAEVNDAETKVTTLSSKLAQIEN----L-------------------KGDDLMRMLPTL
A0A2W5Z1A5      QEAEVNDVEAKVATLQSQLSQIEH----L-------------------KGEDLMRMFAAL
A0A2V6EA09      QEEGVNEAEMTIEALGSRLEQIRK----L-------------------KGEELMRMLATL
A0A2V6GQI7      QEEGVNEAEMTIEALGSRLEQIRK----L-------------------KGEELMRMLATL
A0A3C1HEJ2      LNQRIAASEFNAQSLDRDLSRMTGLGQNV-------------------PLLVTMPVVSAD
A0A522ULD9      MQGDLIAARVDMLVRKSRLDQIQN----L-------------------DGENLLSASQFI
A0A1V6JU76      SQAQYAMAKAQAQTTQTIVEELDRHIQAG-------------------NPLETFPKIAAD
A0A1Q6UHJ9      INTILTSDKRAYDAASTQWNLVQEFKRDG-------------------KDLADLPFIAEL
A0A2V2BXR0      INTILTSDKRAYDAASTQWNLVQEFKRDG-------------------KDLADLPFIAEL
A0A2D8V0G3      ASDEAAQAVKVVETVDNLIAEAEADSRTL--------------------DLSVLPYIQNS
A0A348S017      ANDEAEQAQKAIDEVDKMIREAGESGQLL--------------------DLSQIPFVASS
A0A3C1UUV7      ANDEAEQAQKAIDEVDKMIREAGESGQLL--------------------DLSQIPFVASS
A0A350I3V2      ANDEAEQAQKAIDEVDKMIREAGESGQLL--------------------DLSQIPFVASS
A0A520RGV5      ANDEAEQAQKAIDEVDKMIREAGESGQLL--------------------DLSQIPFVASS
A0A3D3XF90      ANDEAEQAQKAIDEVDKMIREAGESGQLL--------------------DLSQIPFVASS
A0A2D7B522      ANDEAEQAQKAIDEVDKMIREAGESGQLL--------------------DLSQIPFVASS
A0A356NIC2      ANDEAEQAQKAIDEVDKMIREAGESGQLL--------------------DLSQIPFVASS
A0A2N8HDG3      LDNSIFELQTQMKLADGLKESLNA----L-------------------GQKAGLISLDTG
A0A2U8DZK4      MQSTLVALTVDANSLKTRYESFRD-----------------------------IPPDKRL
A0A2T6DFL8      MQNTLIALSVDAIGRKTRWERFKS-----------------------------IPAGERQ
A0A1D8AWD4      MQNSLIALRVDAIGRKTRWERFRN-----------------------------IPAADRR
A0A4Q1C9S2      MQNSLIALRVDAIGRKTRWERFRG-----------------------------IPTADRR
A0A178IH18      MQNTLVALRVDAIGRRARYENFKK-----------------------------IPEADRA
A0A2T6DT99      MQNSLIALSVDAIGRKTRYERFKS-----------------------------IPPEERL
A0A1G3ZT33      MQNSLIALRVDAIGRRTRWERFKN-----------------------------IPAGERV
A0A3E1E2T2      MQNSLIALSVDAIGRKTRWERFKD-----------------------------IPFEERV
B1ZMW1          MQNSLIALSVDAIGRRTRWERFKS-----------------------------IAPADRL
A0A3D1TI55      LQLELERARLDLWTAEAQLQKVES----L-------------------EGKQLEDAIPFL
A0A3R8IT45      QGSVLTQTQSRLGEAEVRKNQVEARIKAG-------------------GDLTELPFIAAN
A0A1H1MGC9      LNAYVTQTTSRLNEAEIRWRQVQERKATP-------------------AQLLDLPFISSS
A0A2A2PYE8      INAEKTRAQIAMNAAEGRINQIKEVRQRS-------------------GDLTELPFIASQ
A0A2T6CN73      INLEVARASIALNAAENRRNQVAELKARG-------------------GNLTELPFIATQ
A0A3E1ET42      SLRSQGVLEQQVIRLRSQLESLMK----L-------------------EGDQLIANAASL
A0A2A2YDW8      VESQVEAAKTTLAELDSMIASIDR----L-------------------SADEVIRYAANL
A0A352XLN9      VESQVEAAKTTLAELDSMIASIDR----L-------------------SADEVIRYAANL
A0A3D0YP62      AERQLYEAERERDQLKFQIDKLLA----V-------------------ADEDLPGLAA--
A0A3D3DV47      AERQLYEAERERDQLKFQIDKLLA----V-------------------ADEDLPGLAA--
A0A2E5XJ49      AVMQQFEHEKSKRQLENQINQLVN----L-------------------KNEELMNFAEGL
A0A2E6SBY8      AVMQQFEHEKAKRQLENQINQLVS----L-------------------KNEELMNFAEGL
A0A2E5QMS4      AEMQQFGAEERKAELENQIQQLLT----L-------------------RDDELIDFAEGL
A0A2E7YXQ3      AEMQQFGAEERKAELENQIQQLLT----L-------------------RDDELIDFAEGL
A0A2E3H787      AEMQQFAAEXKKXXLENQIERLLT----L-------------------KDAELIDFAEGL
A0A2E7AGN1      AEMQQFTAEEKKGQLENQIEQLLT----L-------------------RDEELIDFAEGL
A0A2E7AKY7      AEMQQFTAEEKKGQLENQIEQLLT----L-------------------RDEELIDFAEGL
A0A3D4CU34      AEMQQFTAEEKKGQLENQIEQLLT----L-------------------RDEELIDFAEGL
A0A2E8M146      AEMQQFTAEEKKGQLENQIEQLLT----L-------------------QDEELIDFAEGL
A0A355S8S2      AEMQQFTAEEKKGQLENQIEQLLT----L-------------------QDEELIDFAEGL
A0A2D6DVN8      AEMQQFTAEEKKGQLENQIAQLLT----L-------------------RDEELIDFAEGL
A0A3C1W2R2      AEMQQFTAEEKKGQLENQIAQLLT----L-------------------RDEELIDFAEGL
A0A2E3NAY6      AEMQQFTAEEKKGQLENQIAQLLT----L-------------------RDEELIDFAEGL
A0A2E3II01      AEMQQFTAEEKKGQLENQIAQLLT----L-------------------RDEELVDFAEGL
A0A368B8C5      AEMQQFTAEEKKGQLENQIAQLLT----L-------------------RDDELVDFAEGL
A0A3R7RBB5      AEMQQFTAEEKKGQLENQIAQLLT----L-------------------RDDELVDFAEGL
A0A2A2QX62      AAREYDRLDREKIQLESQIETLLK----Y-------------------DGAQLLAHASGL
A0A4Q3BWH6      AAKVYVETEQEKIQLESQIETLLK----Y-------------------DGPQLMNYASGL
A0A3N5WCF1      ALQIYHDIEQEKLQLESQISSLLK----Y-------------------DSDQLMVYAGGL
A0A4Q3C1K5      AMQTYSQLQQEKMQLASQINSLLK----Y-------------------DSDQLMVYAAGL
A0A2G4G428      LVRAREDTRKAIDEMEIIWRLIGEYKQTG-------------------KDLYDVAQVRSD
A0A139TV24      LDNSIFELQTQIMLANDLENNLKA----V-------------------SKKAELISLDTG
A0A2N8HT11      LDNSIFELQTQMKLADGLKENLDA----L-------------------GHKAGLISLDTG
R7DS70          LDNSIFELQTQMKLADGLKENLDA----L-------------------GHKAGLISLDTG
A0A2N8HNL6      LDNSIFELQTQMKLADGLKENLDA----L-------------------GHKAGLISLDTG
A0A146GCJ0      LNSKVTEAKSKRLQLEADIDQLKR------------------------VEKGNLDALLAI
A0A2T6D6H8      LNTKVTEAKSKRLQLEADIEQLKR------------------------VEKANVDELLSI
A0A5C9DC49      LSENCTAAKTERLVMETDYEMTKRVGSKV-------------------SELLTLVSIART
A0A139TUL1      IGTELFSTRTELIQVKVLAGLLAE----G-------------------GRERDMIPANIG
A0A2N8HCB0      IGTELFSTRTELIQVKVLARLLAD----R-------------------SRQQDMIPANIG
A0A2N8HP04      IGTELFSTRTELIQVKVLARLLAD----R-------------------SRQQDMIPANIG
A0A2N8HRJ0      IGTELFSTRTELIQVKVLARLLAD----R-------------------SRQQDMIPANIG
A0A366HAG0      TQRDVATLQKQVRDLKAQHDQMMT----L-------------------EGDELIRLAGEM
A0A3M1I8A3      VQARYADAKATAEIMQATIRELDAHLKAG-------------------RPAETFPSVAND
A0A4V0XS84      RQLDLEKAVSDSISKTQLANELGN----L-------------------VRAGLSAEGAQM
A0A0R2XQ77      LNTIKLENKNVYDNLETRMGLVETFRREG-------------------RNLWELSFIAEE
A0A2E9IN28      LNEIKLSNKNLYDQLETKWNLIESYRRQG-------------------KELWELSFISEQ
D5ENH7          LNQIKLESKNNYDQFETKWKLIDSYKLEG-------------------KNLWELSFISEQ
A0A351WE84      LEADRIASRVDMLVRKARLNQLES----L-------------------EGTELMNASSYV
A0A1V5QDZ6      MEADRIAARVDMLVRKAQLDQLVN----L-------------------SGEELMNASSYI
A0A4Y8P964      VSEAMSKARFEMIRREVYLEKAKS----A-------------------MEAGKLAAIPDS
A0A3D4HF88      LNQVLTTTKQVRDQSKHRWEQIQSFKAEG-------------------KPLQDLPFIAEM
A0A351MR11      LVKDREELRRQIDELAIIWEQIEQFKKEG-------------------KDLVLIPMVKSD
A0A5B5WI95      LEKEIFDLETQIKLAAVLADNLKK----T-------------------VRNDGLISVDTG
A0A2N8I9W1      LEKEIFDLETQIKLAAILADNLKE----T-------------------ERKQGLISVETG
A0A4Q5IH27      LEKEIFDLETQIKLAAILADNLKE----T-------------------ERKQGLISVETG
A0A2N8IBZ6      LEKEIFDLETQIKLAAILADNLKE----T-------------------ERKQGLISVETG
A0A2N8IJW9      LEKEIFDLETQIKLAAILADNLKE----T-------------------ERKQGLISVETG
R6J100          LEKEIFDLETQIKLAAILADNLKE----T-------------------ERKQGLISVETG
A0A1V6J089      LENERSAARVDMLVRKARMDQLED----L-------------------EGDKLMDAAAY-
A0A3C1BZR1      LEGERSGARVEMLVRKARMDQLEG----L-------------------EGDRLMDAAAY-
A0A1H6KPB7      RRNKLSALDDEITQLKTHINKLKS----L-------------------KDSELMDYVRQT
A0A2E9ISN4      LLARLKSVRLERVLLENQYEQLSDADILTVNEALAATRETEGRSQVTPEGAPAVDPGAET
B9XAX1          LNQKYTSAKADRIQMEADLKLIQS----L-------------------------------
A0A5R8KKM9      RERDIYKLTNEIQSLRAQISQLQT----L-------------------DGDALIRQAGEL
A0A139TS01      SKAQLMKFEKDEQELAAYVAEVQR----L-------------------PDDKLMDYVTNS
A0A3E1EJT7      LNMMGTQTNAHLKEAEVKWNQVQEWTKAG-------------------RSLSELPFITSQ
A0A317ZP96      LNTMKLNNKNILDNLETKWNLIENYKREG-------------------KDLWELSFIAEQ
A0A2D5WGA5      YESELITAKGVHTTQSTLLEGLKA----Q-------------------SDEELRASIL--
A0A2E7SSH2      YESELITAKGLYTQQATLLQGLQG----Q-------------------SPDELRESIM--
A0A349GXM8      LMERRNQLTTELMLLEAQYPALDGANAAVISDVARLTRATGEIKPSESSRDEEEAPVPGG
A0A4P5YP61      MSKKVTEAKSVRISLESDLAQIQQ-----------------------------LGTNIGA
A0A5R1Q5N3      VSEAVSKARFEMIRREVYLEKAKA----A-------------------MDAGKLAAIPDS
I0JYY7          VSEAVSKARFEMIRREVYLEKAKA----A-------------------MDAGKLAAIPDS
A0A4R7S1J2      ISSKLSQQTNDRVRLETDYAALLQMKSRP-------------------DEAVNLQIVANH
A0A2A2XV69      VEQQVSTERLRVSTLRAKYEQISK----L-------------------SDDQIMRSISTL
A0A651H7X9      LNMMLTEAAARRNEAAVRWNLVQQYREEG-------------------RPLTEISFIANN
A0A4Y8P842      VGDALSKARFEMIKKEVFYERAKN------------------------------GLDSGK
B3DZK9          VSDALAKARFEMIRKEVFYERAKN------------------------------GLDMGK
A0A5E6MPC4      SPAEQELGRLSEAIFRARLDLLRR---EV-------------------RLERAKEAFAGG
A0A4V1SB02      LNNQVGTATNQRTAIESDLAALKQ----I-------------------PTENVEELL---
A0A3C1VB86      ITPQLQDLNERLTQSKASLVQAQG----A-------------------YQDSLKMSTNTE
A0A146G2Q9      VEQQVSQESLRVAALRAKYDQVSK----M-------------------TDEQIMRSLTTL
A0A2T6D3Y2      VEQQVSQESLRVAALRAKYDQVSK----M-------------------TDEQIMRSLTTL
A0A2V2SDV4      FESLRIEGLRELVSQQTLLDKLLA----F-------------------SPKDVVNVLP--
A0A2V5PK75      VESLRIENEADFVKQSTLLNKLKS----L-------------------KYQELTQVLP--
A0A1V6DME1      LKAQQIEGEAAYVREATLLQELKT----T-------------------APEDLKSVLP--
A0A3D3DIJ3      IESLRIESQAEYVRQATRLDRLKNLGKEL-------------------GPEGLAQAIT--
A0A2D5VY59      LEQERTVAEAKLIRFQTLFNELEA----M-------------------TLDQLKNTILTA
A0A2D8UZZ4      LEQERTVAEAKLXRFQTLFNELEA----M-------------------TLDQLKNTILTA
A0A353DV86      LEQERTVAEAKLIRFQTLFNELEA----M-------------------TLDQLKNTILTA
A0A2E5EPT8      LEMLNIEMNAGLTSKKTQLEQLKS----L-------------------SP-KVLGNALMT
A0A5C9DS93      MEQENIQLATTYRRKQTRFDELKK----L-------------------PADQLRNALNYV
A0A350EWA4      FRNKHDLEKLEYEKMMKRLHGMEA----L-------------------TSIDQLKVALPT
A0A5B5WZ91      SKAQLMKFEKDEQELAAYVAEIQR----L-------------------PDDKLMDYVTNS
A0A2N8HD92      AKSQAMAFEKDEKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A2N8HIT2      AKSQAMQFEKDEKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A354EBD3      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A355VEB2      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A2N8IMT3      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
R6K1U5          AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A2N8IWC2      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A2N8I441      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A2N8I3A6      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A410SCC4      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A3R5VEW0      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A411SSG2      AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
B2UKW3          AKAQAMDFERREKELASYVQELQR----L-------------------PDDKLLDYVISS
A0A1M6RLZ4      NERLYQEALRDRDSLKSIVQRLGD----L-------------------DNEALISAMAGL
A0A354T7G8      MLA-----DQDTLTLQAEIDEIGK----L-------------------SIEELIARASGL
A0A2S7U4L6      ENMLYDEAVKARDELERQVKDLVG----L-------------------DDETLISHVSGL
A0A512MBZ2      LQS-----DLEVQNLTSELEQLDK----L-------------------SPDELVARASGL
A0A2E8MEZ0      KLD---TLEQTRDQIQIQIRKLID----T-------------------PNEDLIRTAAGL
A0A4Q2YKS3      AADAFAKLEQQKIELESQIKSLLN----Y-------------------RTEQLMVYASGL
A0A2E3EC33      FQA-----EGAIQNLRTTIKSLTD----L-------------------EGEELIKSAVDL
A0A2E4GN01      FXA-----EXAIQXLXTTIXSLTD----L-------------------KGEELIKSAVDL
A0A1Z8XU55      FAA-----EEAIQNLRSTISSLTQ----L-------------------EGEELIKSAVDL
A0A2E1RQR9      FAA-----EEAIQNLRSTISSLTK----L-------------------EGEELIKSAVDL
A0A2E3ISQ4      FAA-----EEAIQNLRSTIKSLTQ----L-------------------EGAELIKSAVDL
A0A2D6W6F4      FAA-----EEAIQNLRSTIKSLTQ----L-------------------EGAELIKSAVDL
A0A2D8Z5A8      FAA-----EEAIQNLRSTIKSLTQ----L-------------------EGAXLIKSAVDL
                                                                            

A0A2A2XVF1      PQVAE-ARRQLSDSNMEIAAMQDRYG--------------------ERHPKFIAALAKAE
A0A2V5UHJ2      AVIGS-LKAELGKFEAEYASLAKEFK--------------------AGYPPLDNVKTRLE
A0A2V5PST3      GMIPT-LRSTLLTLEAEKIKQSTVFK--------------------PDHPRMIELNQQIK
A0A2V5PXM3      PTVTD-IRGNVGRLESDLANLRQRYK--------------------EKHPKYIQTASQLV
A0A139SU05      NTVAP-LRGQMTTLLQEQARLAERYL--------------------ERHPRMIEVTNAII
A0A1D8AZK8      GNIAA-LKTQLAELQNQQSLLAERYL--------------------ERHPKMISVANSID
A0A1V5QB01      PAVGG-LEGLVEYGVVQQRGWQEQRRVKSLLEARLAEYRTKFR---DAHPLVQQTMRELK
A0A139SPN4      GTVAP-LRTQLSTLLQEQARLAERYL--------------------ERHPRMIETTNAII
A0A1V6E7N1      DQIPA-LNAQIAELTRTQTVLGERYL--------------------ERHPLMIELANKLR
A0A2D9MYT1      AEVKK-MRGDLALALAELASLRERYL--------------------EKHPKIIEKRSSIE
A0A258ANJ7      PKVSG-ILSQIASQKSALAVLAERYK--------------------PKHPKYEAVQVVIH
A0A139TLN4      IADMG-IRDQIGVFNDTLLKKTSLKVNAG-----------------DNNPIVRELEANLA
A0A290QGD9      PIIGE-LKKQQAEQKVVVAQLSERYR--------------------AKHPRMIDATRMLS
A0A1D8AS58      SLIVQ-LVQQVAAQKIVLAQMRERYR--------------------DKHPRMIEAHNSLT
I6AQC1          PLVSQ-LASQIAMQTITIKQLRERYK--------------------EKHPKMIEASNALT
W0ITH7          QLVAQ-LASQVAMQTITVKQLRERYK--------------------EKHPRMIEANNALT
A0A1G3ZFT0      MVIEKQLINLRMTKHEMFYQYT------------------------KSHPSMINLKRRIA
A0A1Z8ZMT6      ----------------------------------------------LKHPKIISGTDQIN
A0A2E8MCT7      ----------------------------------------------PKHPKIISATDHID
A0A290Q2Z2      LIQDPNIQNLLQAYLIADQNVTKFRARLG-----------------AAHPELIGATDNRA
A0A2A2RGK2      PKVAQ-YSESLNARQRDLTIVAQRYR--------------------SKHPTYVAIKTQID
A0A2A2XXF7      PKVAQ-YSESLNARQRELTLISQRYR--------------------AKHPAYISVKTQID
A0A2A2R5D6      GIEDA-------NLTSLRAKKYAAESDLEQMRKSGLE---------GNHPRIKSREAELA
A0A1J4XH17      PQVEQ-LLSDLATKNIEISSLEKRYG--------------------AKHPKMIEATRAKE
A0A3C1VJ32      VSDAE-LGSLLAQYHEAQRKIAALKVDYS-----------------PANLDVTRVQTLID
A0A2N9NTX7      APDSY-LNSLMEQVTVADQRLVMVQKDYG-----------------PENDETKKARESVS
B9XK55          APDAI-LIQLLQDLIGAETKLVTLLADYG-----------------DKHPEVLRTQKLVN
A0A4P5YMI6      YPDEL-LATLLQKQTLTIQELAAKSKDLG-----------------AQHPEVIRVNSLLE
A0A2E6T482      HPDAQ-LDALIRELHTGEQTVANQSIDLG-----------------EQHPRIKGLKKVVA
A0A3C0DQZ7      HPDAQ-LDALIRELHTGEQTVANQSIDLG-----------------EQHPRIKGLKKVVA
A0A1Z9CBK5      NPDAQ-LDALIREYQTGQTTLANKSIDLG-----------------EGHPTIKSLKAALE
A0A2D6ZI96      NPDAQ-LDALIREYQTGQTTLANKSIDLG-----------------EGHPTIKSLKAALE
A0A358KGZ3      NPDAQ-LDALIREYQTGQTTLANKSIDLG-----------------EGHPTIKSLKAAME
A0A2E9ZQX4      NPDAQ-LDALIREYQTGQTTLANKSIDLG-----------------EGHPTIKSLKAAME
A0A3D5JZU0      NPDAQ-LDALIREYQTGQTTLANKSIDLG-----------------EGHPTIKSLKAAME
A0A2E6HCR0      YPDAQ-LDALVREYQTGQTTLANKSIDLG-----------------EGHPTIKSLRAALQ
A0A1Z8WN04      YPDAQ-LDALVREYQTGQNSLANKSIDLG-----------------EGHPTIKSLRAVLS
A0A2D7L1N4      YPDAQ-LDALVREYQTGQNSLANKSIDLG-----------------EGHPTIKSLRAVLS
A0A2E2R937      YPDAQ-LDALVREYQTGQNSLANKSIDLG-----------------EGHPTIKSLRAVLS
A0A520QQY4      YPDAQ-LDALVREYQTGQNSLANKSIDLG-----------------EGHPTIKSLRAVLS
A0A2D5MR66      YPDAQ-LDALVREYQTGQTTLANKSIDLG-----------------EGHPTIKSLRAALQ
A0A2E0PDQ1      YPDAQ-LDALVREYQTGQTTLANKSIDLG-----------------DGHPTIKSLRAALQ
A0A2E2ZZP9      YPDAQ-LDALFREYQTGQTTLANKSIDLG-----------------DGHPTIKSLRAALQ
A0A2A2RGF2      VVNDEILARRLEEHSAAEKEFVSKGKDLG-----------------PNHPDYVRMQALIV
A0A2G4I5Y6      VVNDEILSRRLEEYSAAEKEFVSKGKELG-----------------PNHPDYVRMQAVIV
A0A3M1I883      MPSEALLPKRIDDLDVVEQNLSKLLKDYT-----------------PENPEVQRYMALKD
A0A1V6JZ45      MPTEARLGELLGALSLAQQEVARLREDFS-----------------NDYPEMKRKLALVE
A0A520RRW5      MPGNLRLTSLLNEFDRGHQQLSQMKAIHG-----------------PDHPQMQASNSLLL
A0A356NPK0      MPGNLRLTSLLNEFDRGHQQLSQMKAIHG-----------------PDHPQMQASNSLLL
A0A2D7B5P5      MPGNLRLTSLLNEFDRGHQQLSQMKAIHG-----------------PDHPQMQASNSLLL
A0A3D3XGB5      MPGNLRLTSLLNEFDRGHQQLSQMKAIHG-----------------PDHPQMQASNSLLL
A0A2V6F8A1      MNDEL-LSKLMMDLATTEANLAKLKETLG-----------------PQHPDFKGVAAMQA
A0A2V5TNH4      INDEL-LSKLMMDLSTTEANLAKLKETLG-----------------PENSDFKAMAAVQA
A0A2V5X5Q6      INDEL-LSKLMTDLSTTEANLAKLNAGLG-----------------PRNPEFIAMAAMQA
A0A2V2DJ66      PIISK-LVSDRSQYQVSVSTLEKRYK--------------------EKHPRMIEARKALD
R7L5A9          QQIAK-LLTDRSTQQVFIASLEKRYK--------------------EKHPSMIEARKTLD
A0A4P5QM05      GITDS-T------VEKTLPLLQDAKAEEAKFFSAGLG---------ENHPRMKSLRAQRE
A0A4Q3C001      NIDEP-T------VRENLPLLQQAAAEEAKLLASGLG---------EAHPKIASLRQMSA
B4DB23          GIDDT-T------VSRNLPLLQDAAAEHARLTNLGLG---------VNHPRIKALDAQMA
A0A2V5URB2      SLIQS-LRAQVVQLESEHAKLAAQFL--------------------PGYPRLAQVKAQLQ
A0A5R8KA81      RAVAE-LRSQISLAESEMANLSQRYR--------------------PKHPRFIQMQDRLK
A0A5B5WU87      IADMG-IRDQIGVFNDTLLKKTSLKVNAG-----------------DNNPIVRELEANLS
R7DZW0          IADMG-IRDQISVFNDTLLKRTSLKVNAG-----------------DNNPIIRELEANLN
A0A2N8HID1      IADMG-IRDQISVFNDTLLKRTSLKVNAG-----------------DNNPIIRELEANLN
A0A2N8HS06      IADMG-IRDQISVFNDTLLKRTSLKVNAG-----------------DNNPIIRELEANLN
A0A3R5R2M8      LTDNG-LSRQIENYNEAWLEYRKIAGSAG-----------------SRNPIAAGLRDRME
A0A411SUQ6      LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPIAVSLRDRMN
A0A2N8HZF2      LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPIAVSLRERMN
A0A354E720      LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPITVSLKDRMN
B2UPB6          LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPIAVSLRDRMN
A0A2A2XXW5      EQVAY-LRKQVNDNSSKLAGLRTKYR--------------------ERHPRVIQPATQLQ
A0A2V6JLK8      DVQDP-T------VQKILPNYQDTVAQEALLLNSGLG---------EDHPKVKSVRAARQ
A0A2W5Z1A5      NIQDP-T------TLKILPNYQDAVAQEASLLNSGLG---------ENHPKVKALRAQKQ
A0A2V6EA09      NIQDP-T------IQKILPNYQEAVAQDAFFLNSGLG---------ENHPKVKALRATKA
A0A2V6GQI7      NIQDP-T------IQKILPNYQETVAQDAFFLNSGLG---------ENHPKVKALRATKA
A0A3C1HEJ2      PTVSA-AMIAVLTQENAMDLVKRDLK--------------------PKHPDYIKAQTQLA
A0A522ULD9      VGDVS-LNSLRQQVTDTQVSLKLMLENLG-----------------ENHPDVKRLRAGLE
A0A1V6JU76      GKVNS-LQLQLSGQENELAGLLKRYK--------------------DKHPAVIQARSKIE
A0A1Q6UHJ9      PQISK-LLTDKSSQQVFVASAEKRYK--------------------EKHPRMIEARKALD
A0A2V2BXR0      PQISK-LLTDKSSQQVFVASAEKRYK--------------------EKHPRMIEARKALD
A0A2D8V0G3      PIIQQ-LRVSLAAAEAELASLEVKYL--------------------EKWPAVIVAKEQIR
A0A348S017      EIIKT-IRANLVMAKTDLAALQVKYL--------------------EKWPAVIEAKERIV
A0A3C1UUV7      EIIKT-IRANLVMAKTDLAALQVKYL--------------------EKWPAVIEAKERIV
A0A350I3V2      EIIKT-IRANLVMAKTDLAALQVKYL--------------------EKWPAVIEAKERIV
A0A520RGV5      EIIKT-IRANLVMAKTDLAALQVKYL--------------------EKWPAVIEAKERIV
A0A3D3XF90      EIIKT-IRANLVMAKTDLAALQVKYL--------------------EKWPAVIEAKERIV
A0A2D7B522      EIIKT-IRANLVMAKTDLAALQVKYL--------------------EKWPAVIEAKERIV
A0A356NIC2      EIIKT-IRANLVMAKTDLAALQVKYL--------------------EKWPAVIEAKERIV
A0A2N8HDG3      IADSG-VSRQIEAYNTAYLEYQKVAGSAG-----------------GQNPIVVTLTKKMD
A0A2U8DZK4      SLVNA-QLIEDPGTQRLQQIYLEAEQNVTKLSARLG----------EAHPEMIVARENLS
A0A2T6DFL8      SLVNS-ELIPDQNIQNLLQAYLVADQKVTQLQGRLG----------EAHPDLIAAVDNRA
A0A1D8AWD4      NLVNS-ELIQDTNIQNLLQAYLISDQTVTRLMARLG----------AAHPDLIAAIDNSA
A0A4Q1C9S2      NLVNS-ELIQDTNIQSLLQAYLVAEQNVTRLMGRLG----------SAHPDLIAAVENGA
A0A178IH18      NLVNS-ELITDTNIQNLLQAYLVADQNVTRLRSRLG----------EAHPELITATDNRA
A0A2T6DT99      NLVNS-ELIQDPNIQNLLQAYLVADQNVAKLKTRLG----------EAHPELIAAMENRA
A0A1G3ZT33      TLANS-ELIQDTNIQNLLQAWLVADQTVARLKSRLG----------EAHPDLIAAVDNRA
A0A3E1E2T2      SLVNS-ELIPDINIQNLLQAYLLADQNVTKLKARLG----------EAHPDLISAIDNRA
B1ZMW1          SLVNS-ELIQDTNIQNLLQAYLVADQNVTRLQSRLG----------EAHPDLIAAVDNRA
A0A3D1TI55      VNDPS-YNTLNQQLVEAEIAYRAAEENYG-----------------PKHPEMVKFQTTID
A0A3R8IT45      HLVAQ-LSQLVSMRKIEVKQLRDRYK--------------------DKHPKMIEANNALA
A0A1H1MGC9      QLIGQ-LVQQVSAQKIVMSQLREHYR--------------------DKHPKMIEAVNSLA
A0A2A2PYE8      PQVVQ-LGQLLAERKIAIATLRERYR--------------------DKHPKMIEALNSFQ
A0A2T6CN73      ATIVE-LLKQLAAQKVQLEQLGARYR--------------------AKFPKMIEAQNSYD
A0A3E1ET42      DVQND-T------IKALYPEYQKSVIEESRLLNSGFG---------KNHPKIRGLRESIN
A0A2A2YDW8      EVAGQ-D------LKSLFPEYQEQVRMLSGMQVQGLG---------PRHPNVLAQESTVD
A0A352XLN9      EVAGQ-D------LKSLFPEYQEQVRMLSGMQVQGLG---------PRHPNVLAQESTVD
A0A3D0YP62      DLPDV-G------FREAYNKFEDAKAELQTAKASGLG---------NKHPDIVMRTTRIE
A0A3D3DV47      DLPDV-G------FREAYNKFEDAKAELQTAKASGLG---------NKHPDIVMRTTRIE
A0A2E5XJ49      KLPGS-A------VPELHRAWMAGKRSIATMEASGLG---------RKHPNIRMALIAQD
A0A2E6SBY8      KLPGS-A------VPELHRAWMAGKRSIATMEASGLG---------RKHPNIRMALIAQD
A0A2E5QMS4      KLPGS-Q------VPVLRARIQESKLNMAAMEASGLG---------RKHPSMEMSLIAQN
A0A2E7YXQ3      KLPGS-Q------VPVLRARIQESKLNMAAMEASGLG---------RKHPSMEMSLIAQN
A0A2E3H787      QLPGS-Q------VPVLRGRLQESKVNIAAXEASGLG---------RKHPQVEMGLIAQA
A0A2E7AGN1      QLPGS-Q------VPVLRSRFQESKVNIAALQASGLG---------RKHPSVEMALIAQE
A0A2E7AKY7      QLPGS-Q------VPVLRSRFQESKVNIAALQASGLG---------RKHPSVEMALIAQE
A0A3D4CU34      QLPGS-Q------VPVLRSRFQESKVNIAALQASGLG---------RKHPSVEMALIAQE
A0A2E8M146      QLPGS-Q------VPVLRGRYQESRVNIAALEASGLG---------RKHPSVEMAYIAQS
A0A355S8S2      QLPGS-Q------VPVLRGRYQESRVNIAALEASGLG---------RKHPSVEMAYIAQS
A0A2D6DVN8      QLPGS-Q------VPVLRARYQEGKVNIAALEASGLG---------RKHPSVEMAYIAQE
A0A3C1W2R2      QLPGS-Q------VPVLRARYQEGKVNIAALEASGLG---------RKHPSVEMAYIAQE
A0A2E3NAY6      QLPGS-Q------VPVLRARYQESKVNIAALEASGXG---------RKHPSVEMAYIAQE
A0A2E3II01      QLPGS-Q------VPVLRARYQESKVNIAALEASGLG---------RKHPSVEMAYISQK
A0A368B8C5      QLPGS-Q------VPVLRARYQESKVNIAALEASGLG---------RKHPSVEMAYISQE
A0A3R7RBB5      QLPGS-Q------VPVLRARYQESKVNIAALEASGLG---------RKHPSVEMAYISQE
A0A2A2QX62      SLPDN-V------IPVLLPQFQSAKREYDSAMSSGLG---------ERHPKMVSLATNLV
A0A4Q3BWH6      SLPDN-I------IPVLLPQYQEQKRTYEAMKSQGRG---------ERHPMMVSQATTLE
A0A3N5WCF1      NLPDN-I------IRTLYPQYQEAKRQLDGLKISGLG---------DRHPTILVAVDQIE
A0A4Q3C1K5      DLPDN-L------IRNLYPLYLEAERTLESLKIKGLG---------DRHPTILAAKDQIA
A0A2G4G428      ERVAS-FGSKISDLRVAVRTMEEKYT--------------------DEHPTLIQARAQLK
A0A139TV24      IADSG-VSRQIEAYNTAYLEYQKIAGSAG-----------------SQNPIVVSLTKKMD
A0A2N8HT11      IADSG-VSRQIEAYNAAYLEYQKVAGSAG-----------------GQNPIVVTLTKRMD
R7DS70          IADSG-VSRQIEAYNAAYLEYQKVAGSAG-----------------GQNPIVVTLTKRMD
A0A2N8HNL6      IADSG-VSRQIEAYNAAYLEYQKVAGSAG-----------------GQNPIVVTLTKRMD
A0A146GCJ0      NSVSN-LPQVALIREQLLNAEGDLAGLKERYL--------------PKHPKYIAASMRIA
A0A2T6D6H8      NSVSQ-LPHVAVIREQLVSAEAELAALKDRYL--------------PKHPKYIAGVTRIA
A0A5C9DC49      PEVQS-LKEKIQAQETSLANLKLRYR--------------------EKHPAMIQAHTELN
A0A139TUL1      IQDAG-IAKQIELFNDNFLQYKKLSASAG-----------------KQNPMVSSLAENMK
A0A2N8HCB0      IQDAG-IAKQIELFNDNFLQHKKLFASAG-----------------RQNPMVSSLAENMK
A0A2N8HP04      IQDAG-IAKQIELFNDNFLQHKKLFASAG-----------------RQNPMVSSLAENMK
A0A2N8HRJ0      IQDAG-IAKQIELFNDNFLQHKKLFASAG-----------------RQNPMVSSLAENMK
A0A366HAG0      KVENE-T------IRRMGPTYQELLLKQQSLATAGLG---------RKHPTMRGIAGSLE
A0A3M1I8A3      SRVIE-LQKRLTGYRTDLGAMLQRYG--------------------EKHPAVVTLRSQIA
A0A4V0XS84      AMLQQ-YGGRLTGIQELKKSLTEKESQLANLTQRYR----------DEHPTIVRLRDEVR
A0A0R2XQ77      SRVAG-LLDRISGVKIGISSSSKRYR--------------------EKHPVMIEQLQILQ
A0A2E9IN28      PRVSS-LLQRISGTRISISSLSKRYR--------------------EKHPAMIQLLQTLQ
D5ENH7          PRVAS-LLQNISATKIEIASLSKRYR--------------------EKHPMMIQQLQTLQ
A0A351WE84      VMDQS-IASIRQQLIDTEVALKLMLENMG-----------------VNHPDVKRLQAGVD
A0A1V5QDZ6      VSDPA-LQAIRAQLIDSEVTLKLMLENYG-----------------AKHPEVLRVQAGVD
A0A4Y8P964      PFTVD-LKKNLLKEQAKYHELEDIYK--------------------EEYPKMSRIKAEIE
A0A3D4HF88      PLVQD-LQSQLSELKVSQSSAAKRYR--------------------EGHPRMISINQSID
A0A351MR11      DRVAA-LYNRVSELQVTIETLEKKYT--------------------ESHPTLRISREQLD
A0A5B5WI95      LADNG-ISRQIEGYNEAFLEYQKIAGSAG-----------------SQNPIAVGLRERMD
A0A2N8I9W1      LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPITVSLRDRMN
A0A4Q5IH27      LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPITVSLRDRMN
A0A2N8IBZ6      LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPITVSLRDRMN
A0A2N8IJW9      LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPITVSLRDRMN
R6J100          LPDSG-IARQIEHYNEAYLEYQKIAGSAG-----------------SQNPITVSLRDRMN
A0A1V6J089      -------IVQDPTLLSIRQQYIDSQVSLQLMLKNGVVG--------ENHPDVLRLRGAQD
A0A3C1BZR1      -------IVQDPTLMGIRQQLIDSQVSLQLMLKNGVMG--------ENHPDVLRLKGAVE
A0A1H6KPB7      DLLAE-TTPGSLSVRELYTRSQTEESTLSKMHMDGYG---------EKHPALLSMVQEHE
A0A2E9ISN4      PPEAA-KNYGAYDHLNTGIQWQETQVRLDELQNEYKQLAAVFK---DTHPRMIDLKGEIT
B9XAX1          ----T-NQPEAILTLPSILQDPAVMETRRRVVEQEAQVATLLLRYKPNYPKMLQAQRQLD
A0A5R8KKM9      RVENE-T------IRTIGPAYQGLLMRQESVAGSGLG---------PKHPTMISLGKEIE
A0A139TS01      DLLNA-EILAADSLRKTYQEYMEKDKERENLKAQNLG---------PKHPKMVALQETAN
A0A3E1EJT7      AKVGQ-LLVQVTTQKLSVTQLRDRYK--------------------DKHPRLIEAVNALN
A0A317ZP96      ERVAS-LLERISGARISISSLSKRYR--------------------EKHPVMIQQIQTLQ
A0A2D5WGA5      -------TAHPDAQLDALIRELHTGQQTLANQSIDLG---------EQHPRIKGLKKVVS
A0A2E7SSH2      -------TAHPDAQLDALIREFQTGQTTLANKSIDLG---------EGHPTIKSLKAALD
A0A349GXM8      ETKSA-KEDAAQQTDETIQGFQNLRVRLMRLEADQAELLKVLK---DDHPRLKAVRDEIK
A0A4P5YP61      LLGIA-SVANDPTVRDIKSNLSKFESEFATIKQRYL----------PKHPKYMGTLSALT
A0A5R1Q5N3      PFTVD--------LKKILLKEQAKYRELEDIYK-------------EEYPKMSRLRTEIE
I0JYY7          PFTVD--------LKKILLKEQAKYRELEDIYK-------------EEYPKMSRLRTEIE
A0A4R7S1J2      PTLNG-ISTALAARRSEFAALQSRYK--------------------SKHPKYTAAQSDIA
A0A2A2XV69      DVQDP-T------ITQMLPQFQEVASEEARLLNSGLG---------VNHPTVKSMRAKKE
A0A651H7X9      PIVND-LRARLAAKEIEMAQLRDRYR--------------------DLHPTMIEARNSIQ
A0A4Y8P842      SVTIP-DNQYTMDLKKNLLKEQAKYRELEEIYK-------------EDYPKMVRLKAGIE
B3DZK9          SLTIP-DNQYTMDIKKNLLKEQAKYRELEEIYK-------------EDYPKMVRLKAGID
A0A5E6MPC4      KAGVP-ENPYTVELKKLLLKEEAKYREMEEIYK-------------PEYPRMVQVHAEIQ
A0A4V1SB02      -------------KLNSLSALPDVLRARTAVMEKEAAFATVLERYKSKHPKYGEAQAQLS
A0A3C1VB86      DLLAY-PQIAIEPDMVQISTDLARLENDFAVIRQRYR---------EAHPKYILAASSLA
A0A146G2Q9      EIEDP-T------ITQLYPQFQEAASEEARMLNAGLG---------ANHPNVKALRAKKE
A0A2T6D3Y2      EIEDP-T------ITQLYPQFQEAASEEARMLNAGLG---------VNHPNVKSLRAKKE
A0A2V2SDV4      -------TVIPDATLTSWLEQRNMLQQRFIALTNILG---------ERHADVVTVQSQLD
A0A2V5PK75      -------TTVADSLLSSLLEQKNMTEQALVIRQKEYG---------DKHVEVIKLQRQLD
A0A1V6DME1      -------TAVADPQLAELLQQLNLVEQERIRLARDLT---------DDHPAVVTVTRQIK
A0A3D3DIJ3      -------TDAPDTLLTSLLDQLTMAEQRLIALEADYG---------PENTEVLKCKGLAE
A0A2D5VY59      -------MPGNLRLTHLLNEYDTTRQALARLSAIH-G---------PEHPERKSLYTLLE
A0A2D8UZZ4      -------MPGNLRLTHLLNEYDTTRQALARLSAIH-G---------PEHPERKSLYTLLE
A0A353DV86      -------MPGNLRLTHLLNEYDTTRQALARLSAIH-G---------PEHPERKSLYTLLE
A0A2E5EPT8      VLPNE-IN-----LPRLYEQLATAQQELVA-KGKELG---------PKNPEIERMTKVIL
A0A5C9DS93      APDEL-LTKRLDELSLAEKEFIS--------KSKDLG---------PLNPEYARMKDVIA
A0A350EWA4      SFPDS-ALIVN--FAGMFQSEADAERQLAGLLGQ-FG---------RDHPTVMSAQAELD
A0A5B5WZ91      DLLNA-EILAADSLRKTYQEYMEKDKERETLKSQNLG---------PKHPKMVALQETAN
A0A2N8HD92      DLLNA-ESVGAKALRETYAEFSEKLKEKENLKAQNIG---------PKHPKMLALVETER
A0A2N8HIT2      DLLNA-ESVGAKALRETYAEFSDKLKEKENLKAQNIG---------ARHPKMLALLETER
A0A354EBD3      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------PKHPKMLALLETER
A0A355VEB2      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------PKHPKMLALLETER
A0A2N8IMT3      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
R6K1U5          DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
A0A2N8IWC2      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
A0A2N8I441      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
A0A2N8I3A6      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
A0A410SCC4      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
A0A3R5VEW0      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
A0A411SSG2      DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
B2UKW3          DLLNA-ETVGADALRKTYAEFSDKLKEKENLKSQNIG---------ARHPKMLALLETER
A0A1M6RLZ4      NLPEI-KV-----VQNLNEMYLDASRERGSLIAAGLG---------ANHPRVKMSRTRVE
A0A354T7G8      KLDNP--S-----LASNTTEYNKLIVQREGLMNAGMG---------RRHPNVESLSSQID
A0A2S7U4L6      NRPES-AV-----LALTFQQYQDAKRERAGVIAQGLG---------ENHPQVKHHDSQIS
A0A512MBZ2      RLDNP--N-----LTSMTAEYQKLQITREGLSQQGLG---------RKHPLVQTADKQLA
A0A2E8MEZ0      ELPEN--Q-----VTSYYTGYRAADEQVSAMIASGLG---------PNHPEVKAMRLRAD
A0A4Q2YKS3      DLPEN--I-----VKTLYPQYLEMQNNLDAAKTQGFG---------DRHPTVLELSGRVA
A0A2E3EC33      GIKNE--T-----LSSGWSSYQALELSRAALVESGVG---------NKHPKIINIDSQLA
A0A2E4GN01      GIKND--I-----LSNGWSSYQTLELSRAALVESGVG---------KKHPKILNIDKQLK
A0A1Z8XU55      GVKNE--T-----LTSGWTEYQSLELNRAALVDSGVG---------IKHPKILNIDSQLN
A0A2E1RQR9      GVKNE--T-----LTSGWTEYQSLELXRAALVDSGVG---------XKHPKILNXXSQLN
A0A2E3ISQ4      GVKNE--T-----LNSGWSEYQTLELSRAALIDSGVG---------VKHPKIVNIDSQLK
A0A2D6W6F4      GVKNE--T-----LNSGWSEYQTLELSRAALIDSGVG---------VKHPKIVNIDSQLN
A0A2D8Z5A8      GVKNE--T-----LNSGWSEYQTLELSRAAXIDSGVG---------VKHPKIVNIDSQLN
                                                                            

A0A2A2XVF1      SLKKSLRESAGKAGDILNRQYEAACQTE----SKLTVALKEQE-VAALDLNKMAIPFNV-
A0A2V5UHJ2      ETRRHLNSEIDKEVKGIEAGFAAARNKE----SELRVAMEDQK-KATLNLKDSAVQYAI-
A0A2V5PST3      EATQSLNTEINNVVRGIRENYVAARAKE----QALEVETGKQQ-QAALNLKEVGVQYAV-
A0A2V5PXM3      EWKNTLTNAVLNVPQVVRSLYESARTAE----AALETALREQE-SAALELSSQALHYSS-
A0A139SU05      ITQEHLDLAVQGAIADLKTSLIEVKKTI----AQLENEYAENE-KEALSLRNMRVDFES-
A0A1D8AZK8      VIAAQIQNDIAQSLSDLRTQYTKVKETE----ASYQKEYKEAE-MGQLRLGELSVEFKS-
A0A1V5QB01      EVQDALNIELQFALRQYYAQLEALSIR-----EQASKRVEQEWEEEALEVSRKQQEYQN-
A0A139SPN4      TTQEHLDFAVQGAIADLHASLTEVNKTI----SQLETEYTAAE-QEALNLRNMRVDFES-
A0A1V6E7N1      VAQEQLRTQVSLAIADLKSRLAKTADSE----RTFEQEKQLQE-TEFFKLRDLRGEYNS-
A0A2D9MYT1      ALQESLKNAENRIFDSIMNKAKLAKATD----VQLAGVLTIRK-SEQQSMNQKSIEYNN-
A0A258ANJ7      NQEQQLTTILDDAFHLLQSSWEHARELE----HRLQEQLKKQE-SEALDLEQLAVQYNV-
A0A139TLN4      SLKDALKRSVNNYYTSLLVKKKNVEEQH----EGTRAHIRAVS--------GKERAVNQ-
A0A290QGD9      QIDAELAKATAEAASIVEGDYQSALRNA----DEARSGLVEQE-TQSLGIDRAGVEYES-
A0A1D8AS58      QTEKELGRAIDSMAATVEADFQTARRND----EDARANLARQE-KESLDLDRDAVEYSN-
I6AQC1          QAQLELQKAVKIAAELVKSEYEAALNSN----KEARAILAQIE-KESFEIDKAAVDYQM-
W0ITH7          QAQLELQKALKIAAELTKSEYQTAFNAD----KEARGALAQIE-RDSLNMDKIGVDYQM-
A0A1G3ZFT0      MLHEEKKELL----------------------------------NEVKKLPLMDQMMLN-
A0A1Z8ZMT6      LKTKILLSAMKDVLSS-----DLETDYW----RGFQDQIDDIENEENFKDLRNAMKLRAS
A0A2E8MCT7      LKTKILLSAMMDVLSN-----DLETDYW----RGFQDQIDDIKNEENFRELRNAMKLRAS
A0A290Q2Z2      KIKEQLDAQLRGYESALEIAYKEADARV----AELKNQLAQAKVDQILSARDRMRPFEE-
A0A2A2RGK2      LTKADLKRVLKDAVTLLANSRNRLEVQS----TEMKTAREAAE-KRLLEVTHKSIEYND-
A0A2A2XXF7      LTKADLRRVLNDAVNLLESARNRLEVQA----NETKIAREKAE-GRLIEVTAKSIEYND-
A0A2A2R5D6      KIDEQINANAAGKRRALEIDVQVTKARV----TQLEKEVGVLTDQVRMQKTTELAKFRE-
A0A1J4XH17      QTEIELKSALDSSINKVYANYDHARDFL----IQSEKRLAQKE-KGIINLSKIKVEYST-
A0A3C1VJ32      TLDGQIIDRVAGIMVTLQSQVNSKKASL----DSLVQQVEEAK-QKDHDNATKNQPYYD-
A0A2N9NTX7      DLKQKIKDRVDGIMLGLQAKVASVRESL----DQMKKEVDEAT-KTDISKASESAPYWK-
B9XK55          ELNAKIDDRVKGIMVGMDARVASLLAVV----KNSEDKVNEAK-SNDLVLAESSRPYFI-
A0A4P5YMI6      KITAQVADRVDGILRGKEADLAAARARD----EELTRAVEEAK-VKNREAAEKMRDYLT-
A0A2E6T482      TLEGQIDDRIKGVLAGLELRVKSSKAQV----EELQRDVDEAK-QRESDMREKGREYFD-
A0A3C0DQZ7      TLEGQIDDRIKGVLAGLELRVKSSKAQV----EELQRDVDEAK-QRESDMREKGREYFD-
A0A1Z9CBK5      SLDQQIDNRIKGILAGLELRVQSSLAQV----XELQKAVDDAK-AKEAKVQEEGREYFD-
A0A2D6ZI96      SLDQQIDNRIKGILAGLELRVQSSLAQV----XELQKAVDDAK-AKEAKVQEEGREYFD-
A0A358KGZ3      SLNQQIDNRIKGILAGLELRVNSSLAQV----RELQKSVDDAK-AKEAKVQEEGREYFD-
A0A2E9ZQX4      SLNQQIDNRIKGILAGLELRVNSSLAQV----RELQKSVDDAK-AKEAKVQEEGREYFD-
A0A3D5JZU0      SLNQQIDNRIKGILAGLELRVNSSLAQV----RELQKSVDDAK-AKEAKVQEEGREYFD-
A0A2E6HCR0      SFDSQIQNRIQGILAGLELRVSSSLAQV----NELQMAVDDAK-SKEAKVQEEGREYFD-
A0A1Z8WN04      TFEGQIQNRIKGILAGLELRVKSSLAQV----NELQKAVDSAK-SKEAKVQEEGREYFD-
A0A2D7L1N4      TFEGQIQNRIKGILAGLELRVKSSLAQV----NELQKAVDSAK-SKEAKVQEEGREYFD-
A0A2E2R937      TFEGQIQNRIKGILAGLELRVKSSLAQV----NELQKAVDSAK-SKEAKVQEEGREYFD-
A0A520QQY4      TFEGQIQNRIKGILAGLELRVKSSLAQV----NELQKAVDSAK-SKEAKVQEEGREYFD-
A0A2D5MR66      SFEAQIENRIQGILAGLDLRVKSSLAQV----KELQKAVDNAK-SKEAKIQEEGREYFD-
A0A2E0PDQ1      SFEAQIENRIQGILAGLELRVKSSLAQV----NELQKAVDNAK-TKEAKIQEEGREYFD-
A0A2E2ZZP9      SFEAQIENRIQGILAGLELRVKSSLAQV----NELQKAVDNAK-TKEAKIQEEGREYFD-
A0A2A2RGF2      KLNQQVEDRVSGIMLNLETDLKAQAAAL----ALTETKLEEAK-VRNRTAAEKNRTYQM-
A0A2G4I5Y6      KLSQQVDDRVNGIMLSLETDLKAQAAAL----ELTETKLEEAK-VRNRTAAEKNRTYQM-
A0A3M1I883      TLQKQITNRLNGILEGMRAQVASFKARY----DEISNQVAQAE-RAVAEEAARFSQYFD-
A0A1V6JZ45      QIDQQVEARLTGILTGLENQVISLKARR----DELQKAVDDGK-KLVVEEAKRSREYWS-
A0A520RRW5      TLNDQIKKEITGVLRGLQTQVNAARNQL----TELTSAVESAK-ASDAEKTAEYRPYFT-
A0A356NPK0      TLNDQIKKEITGVLRGLQTQVNAARNQL----TELTSAVESAK-ASDAEKTAEYRPYFT-
A0A2D7B5P5      TLNDQIKKEITGVLRGLQTQVNAARNQL----TELTSAVESAK-ASDAEKTAEYRPYFT-
A0A3D3XGB5      TLNDQIKKEITGVLRGLQTQVNAARNQL----TELTSAVESAK-ASDAEKTAEYRPYFT-
A0A2V6F8A1      HLDEEINRRINGILGGLKVRVDAFKANL----DTLAKSVDDAR-KKDADMTEKYRPYFE-
A0A2V5TNH4      NLDTNINQRIEGMLAGLKLKVDAFRLHL----DSLAGAVDHAR-TNDAFMTEQYRPYFK-
A0A2V5X5Q6      NLDTNINQRINGILGGLKLKVDAFKLNL----DTLASAVDHAR-TNDAFMTEQYRPYFK-
A0A2V2DJ66      QVDKELAAALDSAYEKVRSTYLTMKNNY----EMSQQRLNKKR-EEILQLGRKAIVYKA-
R7L5A9          QIEKELALAVDAAYAKVQASYETARQNY----EQSQKRLAEKK-EEILSLGKKAIIYKS-
A0A4P5QM05      VYAKILSDQLDSIKRSLNTRLGIEEATL----KTFETNVDKTH-KVQIDEKTRMSRYVE-
A0A4Q3C001      VYRQNLDNALEAIRRAQATNLKVSEDTL----AALEQKLEQTR-SAQIIDKNSSSRYTE-
B4DB23          TYQKILGDQLNTIKITQANRLRLEKDKL----SGLQEMSKASR-TDDIKEKASLVEYVD-
A0A2V5URB2      ETRSKLAQQIRSVVEGINSAYLAAAGKE----RALKLQMDKQK-SDALALKDASVEYAI-
A0A5R8KA81      DLQRSQLENIALAAEGMENAYNSALATE----QKVAQGLAEQE-RLALDLGKIAIEYNA-
A0A5B5WU87      SLKDALKRSVNNYYTSLLVKKKNIQDQH----EKTREHIRNVS--------SRERDVNY-
R7DZW0          SLKDALKRSVNNYYTSLLVKKKNVQDQH----EQTREHIRNVS--------SRERAVNH-
A0A2N8HID1      SLKDALKRSVNNYYTSLLVKKKNVQDQH----EQTREHIRNVS--------SRERAVNH-
A0A2N8HS06      SLKDALKRSVNNYYTSLLVKKKNVQDQH----EQTREHIRNVS--------SRERAVNH-
A0A3R5R2M8      STRAAANKALANYRNNLDIKLKELNAKR----DSLAERMARTA--------TREQELTP-
A0A411SUQ6      STRAAANKALSNYRSNLDLKLNQLINKR----NSLTERLTETA--------IKEQEIIP-
A0A2N8HZF2      STRAAANKALSNYRSNLNLKLNQLISKR----NSLTERLTETA--------IREQEIIP-
A0A354E720      STRAAANKALSNYRSNLDLKLNQLIDKR----NSLTERLTETA--------IKEQEIIP-
B2UPB6          STRAAANKALSNYRSNLDLKLNQLINKR----NSLTERLTETA--------IKEQEIIP-
A0A2A2XXW5      ADTQKLRDESERALQGIFQMAELEKSRE----VEALRKYTESV-ERVFALDEAKISYDI-
A0A2V6JLK8      VYTRQLEQQVGIIRQGLERNLKTAQGTR----DELRKRLEQIN-AKQLQTKNLSANYAR-
A0A2W5Z1A5      VFARQLQEQVGIVRSALEKNLKTAEKTR----DELRARLNEIN-EKQLSTKNLSANYTR-
A0A2V6EA09      VYAKQLEEQMASIRSALEKNLKTAQTTR----ERMDKRLAEIN-TRQLATKTLSANYVR-
A0A2V6GQI7      VYAKQLEEQMASIRSALEKNLKTAQTTR----ERMDKRLSEIN-TRQLATKTLSANYVR-
A0A3C1HEJ2      AAQSQLTNAVLKVVGAYATKLSAAKAEE----QELKAGLSGLE-SRRRDLDAAAGEYGI-
A0A522ULD9      ELRQRLADGLAGMKKGLEADYQVAKAKY----NVLEQELTTVKKTDIDAEREKYLPYNK-
A0A1V6JU76      ETHRSVQGAAQQVAEILRSEARLAKASE----QILAANVKEWE-DQQMEWNKAKMQYDV-
A0A1Q6UHJ9      QINKELASAIESAEQKVQAAYEAARQNY----EQSQKRLLEKK-EQILDLGRKAIVYKS-
A0A2V2BXR0      QINKELASAIESAEQKVQAAYEAARQNY----EQSQKRLLEKK-EQILDLGRKAIVYKS-
A0A2D8V0G3      KLTDEIQQQAGQELKILREQARFANERA----DRARVTYDEAQ-VAMNRLNELKVEYDN-
A0A348S017      KLTEEIQKVAQDEIDLLREQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN-
A0A3C1UUV7      KLTEEIQKVAQDEIDLLREQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN-
A0A350I3V2      KLTEEIQKVAQDEIDLLREQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN-
A0A520RGV5      KLTEEIQKVAQDEIDLLREQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN-
A0A3D3XF90      KLTEEIQKVAQDEIDLLREQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN-
A0A2D7B522      KLTEEIQKVAQDEIDLLREQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN-
A0A356NIC2      KLTEEIQKVAQDEIDLLREQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN-
A0A2N8HDG3      ATRSAAARSLDNLRNNQKLQLQELTKKR----ENIGKRLTATS--------GKARELTP-
A0A2U8DZK4      KIKTQLEAQLTGYEFTLKSKAEEAEARV----TELKKQLEEAKASQIENASKRMRPFEE-
A0A2T6DFL8      KIKEQLDAQLRGYENSLEIAYKEAEARV----AELKSQLAQAKVDQILSARDRMRPFEE-
A0A1D8AWD4      KIQQQLDSQLRGYESSLEMAFKEAEARV----TELERQLAQAKVDQILSARERMRPFEE-
A0A4Q1C9S2      KIQQQLDSQLRGYESSLEMAYKEAEARV----TELERQLAQAKVDQILSARERMRPFEE-
A0A178IH18      KIREQLDAQLRGYENGLEISCKEAEARV----AELEKQLEEARARQITSSTDRMRPFEE-
A0A2T6DT99      KIREQLDGQLRGYENALEIAYKEADARV----AELKNQLGQAKVDQILSARERMRPFEE-
A0A1G3ZT33      KISEQLDALLTGYEKSLEISCKEAEARV----TELESQLAQARVDQILSARERMRPFEE-
A0A3E1E2T2      KIKEQLDAQLRGYENALEIAYKEAEARV----TELKRQLSQAKVDQILSARDRMRPFEE-
B1ZMW1          KIREQLDGQLRGYESALEIAYQEADSRV----AELKNQLAQAKVAQILSARERMRPFEE-
A0A3D1TI55      ELRRAKEQKLVAIKEGLASRYDVAQRRV----ENLEQEMDLLRNQDLERHREAFLPFER-
A0A3R8IT45      QAELELKRAVDSAAASVISEYETAKNAD----TEARAILEQIK-TESLSTDKEGVAYQM-
A0A1H1MGC9      QTERELSRAIDSTAAMFEADFQTAKRND----EEARANLVRQE-SESLELDRYAVEYSN-
A0A2A2PYE8      QTERELKRAVENVSAQVESDFQAASRTF----KNLEEDLAKRT-EDSLQLDRAALEYND-
A0A2T6CN73      QIKRELDRAIASACAQVESDYQSALNTY----RQNQEELKRRT-QDSLAVDHAALDYEN-
A0A3E1ET42      TTRKTLETAVSGFKDSLKVQISQAEQTL----AKGQELTDTKK-LSTVEDRAKQSEYAT-
A0A2A2YDW8      SLFKQLQASVVSFKDSLKIKRETKNVEL----VELNNRLVEVK-DMSKENIIAMTQIQN-
A0A352XLN9      SLFKQLQASVVSFKDSLKIKRETKNVEL----VELNNRLVEVK-DMSKENIIAMTQIQN-
A0A3D0YP62      ELKKGLEKRAVNVRQSLTHKLGIIEGRV----NKMREVRDKKQ-DEGTDRARAFQEFNI-
A0A3D3DV47      ELKKGLEKRAVNVRQSLTHQLGIIEGRV----NKMREVRDKKQ-DEGTDRARAFQEFNI-
A0A2E5XJ49      KLEEDLRSAVVTLKDLLRTQLELVDGQL----EKLRQVVEESR-FDAVDKALQSQDYVE-
A0A2E6SBY8      KLEEDLRAAVVTLKDLLRTQLELVDGQL----ENLRKVVEESR-FDAVDKALQSQDYVE-
A0A2E5QMS4      KMQEDLGGAVVVLRELLKTQLRLVNGQL----AKIKERVEERR-FDAVDKALQSQDYVE-
A0A2E7YXQ3      KMQEDLGGAVVVLRELLKTQLRLVNGQL----AKIKERVEERR-FDAVDKALQSQDYVE-
A0A2E3H787      KIEEDLKAAVVVLRELLKTQLSLVXGXL----EKIKDRVEDRR-FDAVXKAXQSQDYVE-
A0A2E7AGN1      KLQEDLKASVVVLRELLKTQLDLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A2E7AKY7      KLQEDLKASVVVLRELLKTQLDLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A3D4CU34      KLQEDLKASVVVLRELLKTQLDLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A2E8M146      KLQEDLKSSVVVLRELLKTQLSLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A355S8S2      KLQEDLKSSVVVLRELLKTQLSLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A2D6DVN8      KLSEDLKSSVVVLRELLKTQLNLVNGQL----DKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A3C1W2R2      KLSEDLKSSVVVLRELLKTQLNLVNGQL----DKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A2E3NAY6      KLKEDLKSSVVVLREXLXTQLNLVDGQL----EKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A2E3II01      KLSEDLKSSVVVLRELLKTQLNLVNGQL----EKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A368B8C5      KLSEDLKSSVVVLRELLKTQLNLVDGQL----EKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A3R7RBB5      KLSEDLKSSVVVLRELLKTQLNLVDGQL----EKIKDRVEDRR-FDAVDKALQSQDYVE-
A0A2A2QX62      AMEKQLDEAVANLRETLKVKLELSKEQL----ARLKSRKESTN-EDAIGKGIANQTFID-
A0A4Q3BWH6      GMERDLTEAVANLRETLKAKLSLSQEQL----ARLKTRMDTKE-DDAVKQGIANQTFVD-
A0A3N5WCF1      NMKRQLDEGVVNLRATLQAQLDLAVNRL----KSVEVMKDESR-DEAIKRGLDAQDYVD-
A0A4Q3C1K5      GMKKQLDEGVVNLRATLQAQLDMATDRL----KNVENLKDDTR-EDAIKRGLDNQDYVD-
A0A2G4G428      QTEAELQNAIVTSVNRIQVAIQNAHANY----AAIISNLDKKD-DEIARLTVANNELER-
A0A139TV24      ATRAAAFRSLSNLRDNLNLRLQELTRKR----EDITRRLAATS--------GKARKLTP-
A0A2N8HT11      ATRSAASRSLDNLRNNLELKLQELTRKR----QDIAKRLTATS--------GKARELTP-
R7DS70          ATRSAASRSLDNLRNNLELKLQELTRKR----QDIAKRLTATS--------GKARELTP-
A0A2N8HNL6      ATRSAASRSLDNLRNNLELKLQELTRKR----QDIAKRLTATS--------GKARELTP-
A0A146GCJ0      NLRQSLATEATQASETLSRLYEAAKDSE----VKLEAALQEQE-AKALELNKVAIPYNV-
A0A2T6D6H8      NLKQALDSEVKQAGETLSRLYEASRESE----MKLETALQEQE-ERALELDKVAIPYNV-
A0A5C9DC49      SLRQQFEDEVLKAPVRLSQQLKAAQERE----RGLEQVLKEQE-KKLNQMQSQRFELDR-
A0A139TUL1      EMRESIVRSISNYCDVLRVRMGELERER----DELNRGLSDMA--------SKDEGLVP-
A0A2N8HCB0      EMRESIGRSIANYCNALEVRMSELEKER----DELNRLLSDMA--------SKDEGLVP-
A0A2N8HP04      EMRESIGRSIANYCNALEVRMGELEKER----NELNRLLSDMA--------SKDEGLVP-
A0A2N8HRJ0      EMRESIGRSIANYCNALEVRMGELEKER----NELNRLLSDMA--------SKDEGLVP-
A0A366HAG0      QTRALLLEAAQDYRKNLGVRITTVERQL----EEAEKHNKDTR-AKSLDSQAGHHEYLA-
A0A3M1I8A3      ETEKELQQTVKDVIETLRKSAELRQIEL----ANLEENLRYWE-QKQQEWNKAKTTYDV-
A0A4V0XS84      SLRSAFERESQALGDGVRADARIAQSIE----AAFRKALAEQE-QKLLTMNKLKIQHDS-
A0A0R2XQ77      ESEVELVTAVKDSINKLSSAFAESKNNF----ELASQRLAEKE-AELIELSKTRVEYSS-
A0A2E9IN28      ESEQELAIAVKNSVDKIYASYSEAKSNF----ELASQRLAEKE-QELIDLSKTRIEYNS-
D5ENH7          ESEVELGEAVQNSVDKVYASYIEAKSNF----ELASQRLAEKE-SELIGLSKVRVEYNS-
A0A351WE84      ELKKKLNESLVGLKIGLNADYEVAKAKF----DALEAELQAAKHSDIEDEKKKFLPFDR-
A0A1V5QDZ6      ELRKKLENALNGMKTGLRANYEVALQRY----EVLEKELEATRASDIDSERDRFLPFDK-
A0A4Y8P964      GLNKEINEEKEATIEKLEADYEAAKKHY----ESLEEEWKEAM-VKVKKEGRLLSQYAL-
A0A3D4HF88      ETQSELTAAVNSAVQKVHAAYVISDTNY----NHAKAEISRKE-KDLIGLAKTKVEFNA-
A0A351MR11      VTKRELKTAIEMSVNRLAGLRSSSQQRL----IAAERSLSGKE-AEIARLQGANIELER-
A0A5B5WI95      STLSAANKALANYRSNQNLKLEELKKKR----ETLSERLTKTA--------TKEQEFTP-
A0A2N8I9W1      STRAAANKALSNYRSNLNLKLNQLISKR----DSLTERLTETA--------SREQEIIP-
A0A4Q5IH27      STRAAANKALSNYRSNLNLKLNQLISKR----DSLTERLTETA--------SREQEIIP-
A0A2N8IBZ6      STRAAANKALSNYRSNLNLKLNQLISKR----DSLTERLTETA--------SREQEIIP-
A0A2N8IJW9      STRAAANKALSHYRSNLNLKLNQLISKR----DSLTERLTETA--------SREQEIIP-
R6J100          STRAAANKALSNYRSNLNLKLNQLISKR----DSLTERLTETA--------SREQEIIP-
A0A1V6J089      ELRRQLDSALAGLKAGVKADYEVARQKY----EALDSELASIKATDIESESENYLPFDR-
A0A3C1BZR1      ELRRQLASALEGLKAGIKADYEVARQKY----EALDEELSLIKTSDIESEGENYLPFDR-
A0A1H6KPB7      NTKQKLTEGLVGLKDALEQTLSLKEEGR----KSIKRAFDEVT-EIVRNKTQSDILVMS-
A0A2E9ISN4      KAQSSLAHQNELALKRFEAHYEALKLQE----AGIESVLNNWR-SEQFLSVANQSEYKQ-
B9XAX1          DLKDALRSLASKAPKLVQSAYDGALARE----NNLEAALKEVQ-MESLDLDRKGIEYNV-
A0A5R8KKM9      TARTLLLDAANDYRNNLAFRITTGERQL----AEAQKTYQEQR-SKSLEADTNNQEYLH-
A0A139TS01      ILKEKLNKELVGLRSSLRSKLEMVTASR----VKWAKIVAQKE-EDLRKHVMKMPVYEQ-
A0A3E1EJT7      QTEQELQASLATAAESIKAEYENAVQTD----EGARKALADQE-TKSLEIDKYAVEYDN-
A0A317ZP96      EAEMELESAVKNAVDKIYAGYIEAQKNY----EIATKRLVEKE-KELIELSRTRVEYNS-
A0A2D5WGA5      TLEGQIDDRIQGVLAGLELRVKSSKAQV----EQLQRDVEEAK-RRESDVREKGREYFD-
A0A2E7SSH2      SLNQQIDNRISGILAGLELRVNSSLAQV----QELQKSVDDAK-AKEAKVQEEGREYFD-
A0A349GXM8      SIQDQLASMAEVQMRNLRDRHRALSIQL----NAIETAEYKWQ-AKNLTASQRQAEYSR-
A0A4P5YP61      EWRNALTNAVMKIPQTIEISYRGAKSSE----ETFEAALKEQE-ALELVLNKQKLEFDT-
A0A5R1Q5N3      GLNKEISEEKEATIEKLEADYEAAKRHY----ESLEEEWKEAM-VKVKKEGRLLSQYAL-
I0JYY7          GLNKEISEEKEATIEKLEADYEAAKRHY----ESLEEEWKEAM-VKVKKEGRLLSQYAL-
A0A4R7S1J2      NLEARFREALPQVSVSLEASLLASLESAKVNEKKLQEALAEQE-KKSFELDALSIEYNV-
A0A2A2XV69      VMATQLVTQIASLRASMEANIRIGEDSI----TQLEQRLRESQ-AKQQTSKTRASGYYE-
A0A651H7X9      QTRTELNQAVEQAAARVHSEFQTAERSV----AEARAALSNQE-SEALNLGRLAVSYDS-
A0A4Y8P842      GLNQQLTDEKQAVVEKLEAEYEAAKKNF----ESLEEEWKRTL-SKLRDENTLLAKYAM-
B3DZK9          GLNQQLAEEKQAVVEKLEAEYEAAKKNF----ESLEEEWKKTL-LKLKDENSLLAKYAM-
A0A5E6MPC4      GLQDELNQEKEASVADLDAEYEAAKRNY----AGIEQEFQKAM-EKVRGETKALSRYTI-
A0A4V1SB02      EAKSKLRTAVANAGDALRQQYRSLTETE----EKLTEQLKKAE-ADALDFDKIAYPYNA-
A0A3C1VB86      GLKGQLAANALKARARIQESLRIAYQNVLTAKQGLETQMHEVE-TNAMKLSDSAVRFNV-
A0A146G2Q9      VMQRQLAEQTAILRKTLETNLAIAEQGL----KSLQDKLDKVR-SDWQTSKTSSIGYYE-
A0A2T6D3Y2      VMQRQLAEQTAILRKTLETNLTIAEQGL----TSLQEKLTKVR-ADWQTSKTSSIGYYE-
A0A2V2SDV4      DLNAKIAAKATGILQGVQTRVAAVKDSL----AKLEHEVDQAM-TNDLVKAVQSQPYFE-
A0A2V5PK75      DLQDKIAKRVEGIITSLEARVAAVQTNL----ALLQAQVDKAT-ANDIGNSKRWRPYFD-
A0A1V6DME1      DIETKIAQRADGIIRGLEKRVASMKAYL----DSLTRNVEEAM-RVDIEKAEKSRPYFE-
A0A3D3DIJ3      DLHKKIKSRVEGIMLGLDTRVISLSNSL----VNLQQEVGRAT-TNDVTQANLTRPYFE-
A0A2D5VY59      EIETQVTSEITGVLRGLQSQVNAAQNEL----NELTAAVENAK-ANDALKTAKYRPYFT-
A0A2D8UZZ4      EIETQVTSEITGVLRGLQSQVNAAQNEL----NELTAAVENAK-ANDALKTAKYRPYFT-
A0A353DV86      EIETQVTSEITGVLRGLQSQVNAAQNEL----NELTAAVENAK-ANDALKTAKYRPYFT-
A0A2E5EPT8      EIQLQIEGRVKGIMSGLEAEAKALQSGY----DNRMTQLDKAR-EQNRTAAENGQRYMD-
A0A5C9DS93      KIETQIEARVVGLMKGLETDLLADKATL----AERTQKLEEVK-KQSREIAESRRVYQL-
A0A350EWA4      KARETIKSRVEAMLIGQKNDALALSNNL----VELERTIAAKE-AEFRQKSSNIMPYIS-
A0A5B5WZ91      ILKEKLSKELVGLRSSLKSKLEMVAASR----MKWEKIVAQKE-EDLRHHVMKMPVYEQ-
A0A2N8HD92      ILSDKLNKELIGLRSSLKSKLEMVSASR----KHWEETVALKE-KALQDHVLKVPMYEQ-
A0A2N8HIT2      ILGEKLNKELIGLRSSLKSKLEMVSASR----KHWEATVAQKE-EALQKHVLQVPMYEQ-
A0A354EBD3      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A355VEB2      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A2N8IMT3      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
R6K1U5          ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A2N8IWC2      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A2N8I441      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A2N8I3A6      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A410SCC4      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A3R5VEW0      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A411SSG2      ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
B2UKW3          ILGDKLNKELIGLRSSLKSKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ-
A0A1M6RLZ4      ALRKQLDEKVTEVRDVLKDKLDLENQRV----QRLSKSKDSAK-GERLATAYDYTLFNA-
A0A354T7G8      KLKTFIEAEARAHVQGLQNRLDGAKRKR----DSFQTYNDDAK-KELQDMQSLYNEYKT-
A0A2S7U4L6      ILRETLDAKVRRVRDLLKVLLEQAGAKI----ARLQISKDASQ-SDAKNTAEDYTRFQS-
A0A512MBZ2      KSKELILAETQSYIEGLKNRFDAAKMRR----ETLQTYSKEAD-KEQISKGATYNDYKI-
A0A2E8MEZ0      GALENAGKEVMSLKEVLETRLNLVDKQV----EKMKQMVREKK-DGTVDLSMRQHQYNS-
A0A4Q2YKS3      NMKKQLDEGVVNLRDVLRARLEMATAQL----AQVEILKGEKK-GEAVRQGIDTQDYVD-
A0A2E3EC33      LRMKQLLDAVDVHKKALETQLSMAEQQF----QNSKETKERTE-KASLKERKDNVRYIE-
A0A2E4GN01      LRMMQLLDAVEVHKKALQTQLSMAEQQF----QNSKETKERTE-KASLKERKDNVRYIE-
A0A1Z8XU55      LRMKQLLGAVETHKKALSTQLTMAEQQF----ENSRESKERTE-KMSLQERKQNVRYIE-
A0A2E1RQR9      LRMKQLLGAVETHKKALSTQLTMAEQQF----ENSRESKERTE-KMSLQERKQNVRYIE-
A0A2E3ISQ4      LRMNQLLDAVETHKKALTTQLSMAEQQY----ENSKESKERTE-KMSLQERKQNVQYIE-
A0A2D6W6F4      LRMNQLLDAVETHKKALTTQLAMAEQQY----ENSKESKERTE-KMSLQERKQNVRYIE-
A0A2D8Z5A8      LRMNQLLDAVETHKKALTTQLAMAEQQY----ENSKESKERTE-KMSLQERKQNVRYIE-
                                                                            

A0A2A2XVF1      -LQREVESDRVLYESVIKRMKETAVTGAVDQAP-YTL--IEEPLVASL--PSKPNRTRTL
A0A2V5UHJ2      -LAREVDTNKQLYDGVLQRLKEIGVAAEVRTSN-IYV--MGKALPPGS--PSYPDKRRSM
A0A2V5PST3      -LQEEVNVNKNLYDSILKRLNETTISNDIAVSN-MQI--TQSAERPEF--PNSPNIPIDL
A0A2V5PXM3      -LSREVDSDRALYEAVLNRIKETALTKEIKPGK-VRV--IQHAEVPEL--PAKPEKLRVI
A0A139SU05      -LQNEAAVARANYMQILDRLNQTTTTKYLEKVP-IRL--LDRAQVSGR--PYTPNFPKIV
A0A1D8AZK8      -LENQATVAKNNYIEILNRLNQVTTSKNLENIP-VKP--LDRALPAGA--PFTPNIRSII
A0A1V5QB01      -IQRNFGRLQSLYDLAFNRLKEIDISVGIEPES-VQI--MERARPASS--PVTPRKLQSI
A0A139SPN4      -LQNEALVARSNYMQILDRLNQTTTTKYLEKVP-IRL--LDRAQVASH--PYTPNFPKII
A0A1V6E7N1      -LKNQADVAQKNYIDILDRLNQTTTTKSLEKLP-LQP--LDRAVPAGA--PFTPDLARII
A0A2D9MYT1      -LSRTATQSETMYNLALQRXKETELQEKDIVQN-MHV--IDLATAQMH--AIKPKKLLTA
A0A258ANJ7      -LKREMESDQAVYESVLTRIKQVDVSKGMETPP-IWV--HQLAMVPGD--PVSPNAKKVV
A0A139TLN4      -IAREQRVRESLYIFLLNKREENSLALAATEDN-ARI--VDAVRGGDG--PLAPNVPKIL
A0A290QGD9      -LDRELKIEEQVLQHLMGRMRETTMSSTLDTQN-ARV--IDRAFPSQPEQYVKPVILLNL
A0A1D8AS58      -LERDLAINEHLLNTLLSRMRETSMSSTIETQS-ARV--VDRASPALKP--ASPNVLLNL
I6AQC1          -IERDFLVNSSILDNTIKRIRELDITSTIEGQN-IQISPISRAVPAREDQYVEPRIVLNL
W0ITH7          -LEQDFLINREILDRTIGRIREIDLTSTIEGQN-VQIRPISRAVPAREDEYVEPRIVLNL
A0A1G3ZFT0      -LLRDVKMKNALNTILLSKIQEMKIIQAGLLSD-VRI--LSYAKIPDS--AVPIERAKLY
A0A1Z8ZMT6      LLTNSVETKNELYNTLLSRVGVLKTDAEGVE---AEV--IKHEDAPRAWAPFSPNRKKIM
A0A2E8MCT7      LLTNSVETKNELYNTLLSRVGVLKTDAEGVE---AEV--IKHEDAPRAWAPFSPNRKKIM
A0A290Q2Z2      -AARKLEDETRLLSTLKVTLRQREIDFQVPKRS-IEI--LNYAEPARR--AAKPSWPLNI
A0A2A2RGK2      -IKREQETDQALYNSVISRLKEVDVSKQLTESP-VRI--HETAVGAG---PIRPSATKKW
A0A2A2XXF7      -IKREQETDQALYNSVLSRLKEVDITKQLTESP-VRI--HEPAVGAA---PIRPSATKTW
A0A2A2R5D6      -AKKEQDRQQLLYDQFVIRKKQSVVDKQITNDP-ATI--ISKAEPNDM--PFRPNLTINL
A0A1J4XH17      -LSRDFEVNQGLYQSMVLRLNTEMAQIDLKKPS-ARI--IDFAVAPGH--PAKPKKVIIL
A0A3C1VJ32      -EKRKLDQLLDSHKLLYTKIVIDTIDAQIPKTTMVEV--IDRAEPGKA--PVKPNKTLNI
A0A2N9NTX7      -AKRELEEQEHFRAILDLKIISEKVDLSLPKTTMVEI--VDRAVAPLF--ASSPNKTLNI
B9XK55          -EKSQLDHLKKFREILEFRAAQEQVDRALPKTTMVQI--VDTAEEIDK--PVRPNKALNI
A0A4P5YMI6      -AVRDVEQLERMRDSLKFKIQQEDIDMDMPKTSMVEI--TDAAELPVK--ATRPNIPLNI
A0A2E6T482      -AKRELANTTRIRDTILLRIMQEEVDLELPTESTVEI--IDDADXPDK--AIKPNIPLNI
A0A3C0DQZ7      -AKRELANTTRIRDTILLRIMQEEVDLELPTESTVEI--IDDADVPDK--AIKPNIPLNI
A0A1Z9CBK5      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADTPLN--PVRPNKPLNI
A0A2D6ZI96      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADTPLN--PVRPNKPLNI
A0A358KGZ3      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI--IDKADTPLR--AVRPNVPLNI
A0A2E9ZQX4      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI--IDKADTPLR--AVRPNVPLNI
A0A3D5JZU0      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI--IDKADTPLR--AVRPNVPLNI
A0A2E6HCR0      -AKRRLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIPLNI
A0A1Z8WN04      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIALNI
A0A2D7L1N4      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIALNI
A0A2E2R937      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIALNI
A0A520QQY4      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIALNI
A0A2D5MR66      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNITLNI
A0A2E0PDQ1      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNITLNI
A0A2E2ZZP9      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNITLNI
A0A2A2RGF2      -ALTDLEDLKRLRATMNAKIIVEESDVAMSRSNSVRV--TDFAEAAIK--AAYPKMVLNV
A0A2G4I5Y6      -ARDDLDDLKRLRATMNAKIIVEESDIDMSRSNAVRV--TDFAEAAIK--AAYPKMPLNV
A0A3M1I883      -LKRQWENEQRIRDTLLLRTLQETIDSALPTESVVEV--TDPAVPALK--PVRPDLFLNL
A0A1V6JZ45      -SKRELENKQKIRDAILMRMLQEEVDAELPKESMVRI--VDPAEPALR--PVRPNIPLNI
A0A520RRW5      -AKRDLENLSKISDMIMIRILQETVDAALPTDSIVEI--YDPAEPNPD--PVRPKIFLNI
A0A356NPK0      -AKRDLENLSKISDMIMIRILQETVDAALPTDSIVEI--YDPAEPNPD--PVRPKIFLNI
A0A2D7B5P5      -AKRDLENLSKISDMIMIRILQETVDAALPTDSIVEI--YDPAEPNPD--PVRPKIFLNI
A0A3D3XGB5      -AKRDLENLSKISDMIMIRILQETVDAALPTDSIVEI--YDPAEPNPD--PVRPKIFLNI
A0A2V6F8A1      -AKRRLDNLQKLRDAVHLRVLQETVDAALPKTSIVEI--TDHAEPGRK--PVSPDFKLNI
A0A2V5TNH4      -AKRRLDDLTKLRDAVHLRILQETVDAALPKTSIVEI--TDQAEPGRK--PVSPSFKLNI
A0A2V5X5Q6      -AKRKLDDLQKLRDAVHLRILQETVDAALPKTSIVEI--TDNAEPGRR--PVSPNFKLNI
A0A2V2DJ66      -LERERKVAEGMHAEFIAAMNVRLAQVSLITDT-AKV--IDKAGISPL--PSSPNYILNF
R7L5A9          -LERERMVAEGMHASLISAMNVRTAQVSLINEG-ASI--IDRAAPALR--PSSPNYVLNI
A0A4P5QM05      -KKSAYLMTKTLLFEIRRQYDKAKMNNILTQIP-VKI--WQRAQPGLY--HEKPSVILYT
A0A4Q3C001      -AKTKYLNAKKILEAAELRYSTARMERGVDIDP-ARI--KEKAEPPMG--YAKPPVKLYL
B4DB23          -AKNKYIQARKLYESVELSYVTQKMNNSVKGDS-AKI--WEKAEKAEY--PSEPNVPAYM
A0A2V5URB2      -LARETNTNSQLYDGVLERFKEINVAGEIPASN-ISI--LDRAEIPRQ--PSQPQKRRNL
A0A5R8KA81      -LARDVESNQALYASVQKRLKETDITRTIEFAP-WRV--VETPQVAED--PSKPRKMRTW
A0A5B5WU87      -IDREQRVRESLYVFLLNKREENSLALAATEDN-ARM--VDGVRGGAG--PLAPNVPKIL
R7DZW0          -IEREQRVRESLYVLLLNKREENSLALAATEDN-ARM--VDGVRGGNG--PLEPNVPKIL
A0A2N8HID1      -IEREQRVRESLYVLLLNKREENSLALAATEDN-ARM--VDGVRGGNG--PLEPNVPKIL
A0A2N8HS06      -IEREQRVRESLYVLLLNKREENSLALAATEDN-ARM--VDGVRGGNG--PLEPNVPKIL
A0A3R5R2M8      -LVREHKVKEELYLILLSKEQENAMALAATEAS-ARV--LESAHGPDI--PIAPQTVQYL
A0A411SUQ6      -LIREHKVKEELYLMLLSKEQENALAMAVTESN-ARV--LETAHGSNL--PISPKTIKYV
A0A2N8HZF2      -LVREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--LETAHGPNI--PISPKTIKYV
A0A354E720      -LIREHKVKEELYLMLLSKEQENALAMAVTESN-ARV--LEAAHGPNL--PISPKTIKYV
B2UPB6          -LIREHKVKEELYLMLLSKEQENALAMAVTESN-ARV--LETAHGSNL--PISPKTIKYV
A0A2A2XXW5      -MEQQLKRVEGFYQTILTKAKDFDIGAKDLLQN-MKV--QDPAFAPLK--PVSPNKPLIF
A0A2V6JLK8      -AKNAYIKEKTLFDGVRTRAQTQTMEMAMPRFA-VSV--KQVAEAPSY--PARPRVGLNL
A0A2W5Z1A5      -AKNNYIKEKLLLDSVRQRAQTQTMEMAMPRVA-VSV--KQVAEPPTF--PARPRVGLNL
A0A2V6EA09      -AKNAYIKERLLLDGIRMRAQTQTMELAMPRIA-VSV--KQVAEPPNF--PARPRVVLNL
A0A2V6GQI7      -AKNAYIKERLLLDGIRMRAQTQTMELAMPRIA-VSV--KQVAEPPNF--PARPRVVLNL
A0A3C1HEJ2      -IQNKLKFNRELYERIVKERQVTKVVQTLNKDP-VAI--EQRATVPER--PIKPNRKQVM
A0A522ULD9      -AERKLDTERAVLNALKARLAQQGIELQIPRTP-VEV--IDPAEPSNV--PVSPNLFFNV
A0A1V6JU76      -LMRKAQSSKALFDTVLAKMKEIELVQRDKGNN-IRV--IDYAYAATM--PVKPRVLLTL
A0A1Q6UHJ9      -IEREKQVAEGMHAAFIASMNVRLAQVNLINEG-ANI--IDKASPGIR--PVRPNIPMNI
A0A2V2BXR0      -IEREKQVAEGMHAAFIASMNVRLAQVNLINEG-ANI--IDKASPGIR--PVRPNIPMNI
A0A2D8V0G3      -LVMEKEQSEQLYTAMLAKTKEMDLNTKDMMQN-LEV--VDLAYEPFN--PIKPRKALTL
A0A348S017      -LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTL
A0A3C1UUV7      -LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTL
A0A350I3V2      -LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTL
A0A520RGV5      -LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTL
A0A3D3XF90      -LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTL
A0A2D7B522      -LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTL
A0A356NIC2      -LVMQKMQSEELYTSMLAKTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTL
A0A2N8HDG3      -LDREHRVKEELYLTLLSKELENDLTLALTESS-ARV--LEAAHGSDS--PIAPNTRKSV
A0A2U8DZK4      -AMQKLDEATRLYTTFKLTLRQREIDYNQPKRP-VEI--LSKAEPKLE--PERPSWPINI
A0A2T6DFL8      -AAQKLEDETRLLTTLKLTLRQREIDFQVPKKT-IEI--LNTAEAPRF--PIRPSWPLNL
A0A1D8AWD4      -ATGKLDDEQRLLTTLKLTLRQREIDFQVPKKT-IEI--LNTAEPARF--ASRPNWPLNI
A0A4Q1C9S2      -ATTKLEDEQRLLTTLKLTLRQREIDFQVPKKT-IEI--LNTAEPASY--ASKPNWPLNI
A0A178IH18      -AVRKLDDETRLLSTVKLVLRQREIDYQVPKRT-IEI--LNTAEPARR--AARPSWPLNL
A0A2T6DT99      -ALQKLEDDTRLLSTTKLTLRQREIDFQVPKRT-IEI--LNVAEPARR--ASRPNWSLNL
A0A1G3ZT33      -AATRLDDEARLLTTLKLTLRQREIDFQVPKRT-IEI--LNQAEPARR--PSRPNWPLNI
A0A3E1E2T2      -AAQKLEDETKLLTTLKLTLRQREIDFQVPKRT-IEI--LNTAEPARR--PSRPSWPLNS
B1ZMW1          -AAQKLEDETRLLTTLKLTLRQREIDFQVPKRT-IEI--LNTAEPPRY--PSRPNWTLSI
A0A3D1TI55      -ALRDRDAAKQVLTALEHRVAQEVIELEIPSTP-VEV--VETAVEPRS--PFSPSWTLNI
A0A3R8IT45      -LERDFMMNEQLFLKTVERIKETELTNTIEAQN-VQVMPLARAVQPREDEYVEPRIVLNL
A0A1H1MGC9      -LVRDYDINEHLLNSILGRMRETSMSSTIETQS-ARV--VDRAA--PALKPFSPNIPLNL
A0A2A2PYE8      -REREYRTNEKILDAIVARSRETSMTSGITTQN-ARI--VDKAAPSPESKPISPNVPLNL
A0A2T6CN73      -MQRELKIQEDILTTITARRTETSMSSNIATQN-ARI--IDLAQESPEGRPISPNVPLNL
A0A3E1ET42      -EKTKFEMQRQLLQQVKEHSMKTAVDKEVPRKP-IEV--LQVATPEPR--PSKPNMMLLF
A0A2A2YDW8      -VHDEFTTQQKLLDEMKQKLTTDRINLRQPQNI-IQL--HEEPVVARF--PSSPKVNIAL
A0A352XLN9      -VHDEFTTQQKLLDEMKQKLTTDRINLRQPQNI-IQL--HEEPVVARF--PSSPKVNIAL
A0A3D0YP62      -ARKDYETAQGIKDQMQIKYDIEKTKLAIPPTN-III--HQIPEINDI--AVSPNIPLNL
A0A3D3DV47      -ARKDYETAQGIKDQMQIKYDIEKTKLAIPPTN-III--HQIPEINDI--AVSPNIPLNL
A0A2E5XJ49      -AKQDYETAKAMLSQMKITNSARRIALKIPKNP-ITI--LEEPKQAKD--AVYPKVSLFL
A0A2E6SBY8      -AKQDYETAKAMLSQMKITNSARRIALKIPKNP-ITI--LEDPKQAKD--AVYPKVSLFL
A0A2E5QMS4      -AKQDYETAKAMLSQMKLTNSARRIALKIPKNP-ITI--LEDPKMSKN--PVYPKVTLFL
A0A2E7YXQ3      -AKQDYETAKAMLSQMKLTNSARRIALKIPKNP-ITI--LEDPKMSKN--PVYPKVTLFL
A0A2E3H787      -AKQDYETAKAMLSQMKLTNSARRIALKIPKNP-ITI--LEDPKLGKX--PVYPKVTLFL
A0A2E7AGN1      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITL--LENPKIGMD--PVYPKVTLFL
A0A2E7AKY7      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITL--LENPKIGMD--PVYPKVTLFL
A0A3D4CU34      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITL--LENPKIGMD--PVYPKVTLFL
A0A2E8M146      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--LEHPKIGMD--PVYPKVTLFL
A0A355S8S2      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--LEHPKIGMD--PVYPKVTLFL
A0A2D6DVN8      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFL
A0A3C1W2R2      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFL
A0A2E3NAY6      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--LEDPKIGMD--PVYPKVTLFL
A0A2E3II01      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFL
A0A368B8C5      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFL
A0A3R7RBB5      -AKQDYETAKAMLSQMKLTNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFL
A0A2A2QX62      -AKNEFESALRLLETLQAKEIVERMQDKVTDDP-III--HEEPVVSQV--PVSPNVTLNL
A0A4Q3BWH6      -AKNDFETAQRLLEQLKVKLISEEMQTKITEDP-IIM--HEEPMISQV--PVSPNVTLNL
A0A3N5WCF1      -AKREFETDQQLLETMKLKQMGETISRKIPGES-VEV--HDPPVISNS--PVSPNVTLNL
A0A4Q3C1K5      -AKRDFETDQELLQQMRLKQIDRNIREKMTNDS-IVM--HEEPQIAQG--PVSPNVTLNL
A0A2G4G428      -VDKEIKSQEDFLSRQKQSFEEAKIRSSTTGTT-TSI--KVLDSPSVADRPTNKNFYLNA
A0A139TV24      -LNREHGVKEEYYLTLLTKEQENELALETTPSS-ARV--LETAHGSNA--PIAPNTRKFV
A0A2N8HT11      -LDREHRVKEELYLTLLSKELENDLTLALTESS-ARV--LESAHGTDY--PISPNTRKSV
R7DS70          -LDREHRVKEELYLTLLSKELENDLTLALTESS-ARV--LESAHGTDY--PISPNTRKSV
A0A2N8HNL6      -LDREHRVKEELYLTLLSKELENDLTLALTESS-ARV--LESAHGTDY--PISPNTRKSV
A0A146GCJ0      -LQRDVESDRALYESVTKRLKETAITQGIEQAP-YRV--IEEPMVPNV--PSKPRIKLIL
A0A2T6D6H8      -LQRDVESDRALYESVTKRLKETAITQGVEQPP-FRI--IEEPMVPSA--PAKPRVKVIL
A0A5C9DC49      -LQGDLSSQRKLYDAVIQRLREIDLTGGMKKND-VRI--IEPANLPSS--PIRPNKRMIL
A0A139TUL1      -LLREQKVMEELYLMLLKKREENALALATTEPS-ARI--LEPAFGSNS--PVAPKLPLMT
A0A2N8HCB0      -LLREQKVMEELYLMLLKKREENALALATTEPS-ARI--LEPAFGSNA--PVAPKLFLMT
A0A2N8HP04      -LLREQKVMEELYLMLLKKREENALALATTEPS-ARI--LEPAFGSNA--PVAPRLPLMT
A0A2N8HRJ0      -LLREQKVMEELYLMLLKKREENALALATTEPS-ARI--LEPAFGSNA--PVAPRLPLMT
A0A366HAG0      -AKREWETLQQDTAKLKDTKAQKEIERDGSKTP-ITV--YQPAEPDTT--PSKPNVKLNL
A0A3M1I8A3      -LQRKADASRALFNMVLSRLSEAEVMQRDTANN-INI--VDPATIPTE--FVKPNIPVVL
A0A4V0XS84      -LNRELQQSKLLYEKITSRLKEIEVTGNIKDKN-FTV--VDLADAPLK--PIKPSVGLTL
A0A0R2XQ77      -LEREMDVQQGFLQALVGRMTQERAAVNLKNPN-SRV--IDQAFPPLRH--SSPNIAMNL
A0A2E9IN28      -LLRDLSVQQNFFQALNSRMTTEKAQVNLKNPN-ARI--VDEAFPPSEDNPSSPNVTMNL
D5ENH7          -LLRELEVQQSFFQALNSRMTQEQAQVSLKEAS-ARI--VDKAFAPLRH--SSPNILMNL
A0A351WE84      -AERNVIIQRDILNALRARITQQGIEVEVPRTP-VEV--VEPAEPANK--PSSPLVMLNI
A0A1V5QDZ6      -AEREVLVQRQILDALRARIAQEGIAVEVPRTP-VEI--VDPAVPPSR--PVSPNLFLNI
A0A4Y8P964      -LKREADTDREMYTSLLKRLKETDITSALNSGN-IEV--VETSAIPKI--PIKPQKTRNI
A0A3D4HF88      -IKTDLEANRDLHRAMVLRLNTEIAQVNLKNPT-ARI--VDKATPPIY--PSHPKILLNL
A0A351MR11      -IEKEIRLGEDFLNRLKLSYEDAKLRTSTTGTS-TSV--RILDTPVVSERPINKNYYLNV
A0A5B5WI95      -LIREHKVKEELYLNLLSKEQENAMALAAAESS-ARV--LETAHGSDL--PIAPKTEQYI
A0A2N8I9W1      -LIREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYI
A0A4Q5IH27      -LIREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYI
A0A2N8IBZ6      -LVREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYI
A0A2N8IJW9      -LVREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYI
R6J100          -LVREHKVKEELYLMLLSKEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYI
A0A1V6J089      -AERNVAVNRDILTALRARITQTGIEVEVPRTT-VDI--VEEADPPDR--PSSPLVVLNI
A0A3C1BZR1      -AERNVSVNRDILTALRARITQTGIEVEVPRTA-VEI--IEEAEAPQR--PSSPLVVLNI
A0A1H6KPB7      -AIRDYRTEKSRYEDLENEYINQTMNRRASRPI-IQI--HTQAREAKV--PSSPNVKMNL
A0A2E9ISN4      -LSSKVAHFERKYNLVYGRLLENTGTTEP-----FFL--RKIQAPQASEKPIKPQVIKII
B9XAX1          -LMREVQSDLALYDSVLKRLKETDLSKGLEKAS-IAV--VEPAMLPGA--TVKWSLLLVI
A0A5R8KKM9      -AKEEWEGLNRDLWKLRDTLAQQQIERDIPATP-FTI--HKSADEPET-APAKPNVKVNL
A0A139TS01      -TSREYDTALDQLKTLDARYKDEIARLRVPRES-VEM--YDNPLLPTA--PYKPDVTLNL
A0A3E1EJT7      -LNRDFRVNEQLLESMMSRMRETSVTSSIETES-ARI--IDRAYEPGN--PVSPKVFFNL
A0A317ZP96      -LLRDLEVEQNFYQALNSRMTTEKAQVNLKNPN-ARI--VDEAYPPADDNPSSPNVVMNL
A0A2D5WGA5      -AKRELANTTRIRDTILFRIMQEEVDLALPKSSTVQI--IDDADLPEK--PVKPNIPLNI
A0A2E7SSH2      -AKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI--IDKADIPLR--PVRPNKPLNI
A0A349GXM8      -LRSEVGRLAAHYNTLYTRLHDMRVSEELKSEH-FVP--EDITTRED---PVWPDPLKIL
A0A4P5YP61      -LSREVESDRGLYENVMKKMKESQISKELQSDK-LRV--IQPAIAPER--PSKPQKVKIM
A0A5R1Q5N3      -LKREADTDREMYTGLLKRLKETDITSALNSGN-IEV--IETSPIPKV--PVKPQKIRNI
I0JYY7          -LKREADTDREMYTGLLKRLKETDITSALNSGN-IEV--IETSPIPKV--PVKPQKIRNI
A0A4R7S1J2      -RKREMESDKAVYESVISRLKEVDLTKGMDQSK-LKL--HQLPSAPGY--QIWPQPSRII
A0A2A2XV69      -AKNNYIQAKKILEAAEMRLSTETMQRTMPQDP-TVI--WERAEPAEY--PSRPRVLLNM
A0A651H7X9      -LANEAQVNELIYQSIVARMRETTMTSTLESGN-ARV--VDSAMVPLR--PASPNVRLNL
A0A4Y8P842      -LKREADANQQMYMGLLKRLKETDITSALNSGN-IEV--VETSPIPKK--PVKPKKMLNL
B3DZK9          -LKREADANQQMYMGLLKRLKETDITSALNSGN-IEV--VETASIPKK--PVKPKKMLNL
A0A5E6MPC4      -LKREADTDREMYVGVLKRMRETDITSAINASN-VEV--LEHASVPQS--PSRPKKGRNL
A0A4V1SB02      -LKRDAETNRSLHDSIMTRMKEIDITSTLAKSP-YKV--IEEPLINAA--PVRPNPKKIM
A0A3C1VB86      -LTRELRSDQALFDSVIGRLGETSVAGQITAER-IRV--IQPALVPEL--PASPKIKLIF
A0A146G2Q9      -AKNNWLQARKVLEAAQTRLATEKMEQTIPQSP-TTI--WESAEISLV--PAKPNVVLNM
A0A2T6D3Y2      -AKNNWLQARKVLEAAQTRLATEKMEQTIPQSP-TTI--WETAEISLV--PAKPNVVLNM
A0A2V2SDV4      -AKRKVEEAETKLKLLTMKIYTEKLDNELPKTA-MAF--ITTHAVPDA-HAVRPNKPFNI
A0A2V5PK75      -KKRELDEQQRFRQILTMKIASEKIDQKLPKTL-MVE--IMDKAEPGT-KPVKPNKALNI
A0A1V6DME1      -AKQRLEEVMRFRSILNLKLAQERIDVDLPRTA-MVE--IVDTAKPGL-RPVRPNKPLNI
A0A3D3DIJ3      -AKRALEELQRFRQVLDAKIAFEKIDVELPKTL-MVE--VVDRAMPGL-RPVRPNKPLNI
A0A2D5VY59      -AKRDLENLSKISDMIMIRILQETVDASLPTES-IVE--IYDPAEPND-EPVRPKKVLNI
A0A2D8UZZ4      -AKRDLENLSKISDMIMIRILQETVDASLPTES-IVE--IYDPAEPND-EPVRPKKVLNI
A0A353DV86      -AKRDLENLSKISDMIMIRILQETVDASLPTES-IVE--IYDPAEPND-EPVRPKKVLNI
A0A2E5EPT8      -VQKKLERLERIRDTIELKIESEEIDADIGRTA-AVE--VIDPAEPAI-RPAKPKVALNI
A0A5C9DS93      -AGQELERQQRLRETVENKIKVEELDRDIKRTT-AVR--VTDFAEPAV-KPASPKVVLNI
A0A350EWA4      -AKEEYLRRRNVRDSVAMKIAQEKINYALNSTF-IVG--VINPAEEGL-RPVRPNKTLNI
A0A5B5WZ91      -TSREYDTALDQLKTLDARYKDEIARLRVPRES-IEM--YDNPLLPSA--PYKPDVTLNL
A0A2N8HD92      -ASRDYDAALDQLKDLSSRYTDEIARLRVPRDA-VEM--YDLPEYPAV--AYKPSITINL
A0A2N8HIT2      -ASRDYDAALDQLKDLDSRYKDEIARLRVPREA-IEM--YQLPTYPAA--PYKPNVTINL
A0A354EBD3      -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINL
A0A355VEB2      -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINL
A0A2N8IMT3      -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINL
R6K1U5          -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINL
A0A2N8IWC2      -ASRDYDAALDQLKELDSRYKDEIARLRVPREV-IEM--YQLPTYPVA--PYKPNVTINL
A0A2N8I441      -ASRDYDAALDQLKELDSRYKDEIARLRVPREV-IEM--YQLPTYPVA--PYKPNVTINL
A0A2N8I3A6      -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINL
A0A410SCC4      -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINL
A0A3R5VEW0      -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPAA--PYKPNVTINL
A0A411SSG2      -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPAA--PYKPNVTINL
B2UKW3          -ASRDYDAALDQLKELDSRYKDEIARLRVPREA-IEM--YQLPTYPAA--PYKPNVTINL
A0A1M6RLZ4      -LVQEYEQARAVLSQIKINLTNELLKDNLMVDP-IRF--SKVPSEPAADEYVSPNWTLNM
A0A354T7G8      -AKDEVTYLEDLLVKMRSRFFEEKAGIELVKSP-ATI--YAEAEPE--GKPAKPNVPLHL
A0A2S7U4L6      -YQDEYKDSVNNLNTLRTSNVIEELQENMSIEP-IEF--YSYPQEPEVADYVSPNWILNM
A0A512MBZ2      -AMDDVTYIEALLLKFRESYSENNASLQLVKSP-ATI--YAKAEAE--GRPSKPNISLNL
A0A2E8MEZ0      -AKEEYEQSRMMYREMSVKQQQQRVLLKMPRTP-ITL--HERAKKAKA--PAYPNVTLNL
A0A4Q2YKS3      -AKREFETDLELLQTMKLKYITEKASGKLNGES-IAV--HE--EPVIAASPVSPNVTLNL
A0A2E3EC33      -AKKEYELCKEMLNGMQSQLAKEKIDAAGQRTP-MVI--HEIAEAADPGNPARPNIKLHL
A0A2E4GN01      -AKKEYELSKEMLNGMQSQLAKEKIDAAGQRTP-MVI--HEKAEASDPDNPARPNIKLHL
A0A1Z8XU55      -AKKEYELSKEMLNGMQSQLAKETIDKEGQRTP-LVI--HEQAEPSDVDKPARPNIKLHL
A0A2E1RQR9      -AKKEYELSKEMLNGMXSQLAKETIDKEGQRTP-LVI--HEQAEPSDVDKPARPNIKXHL
A0A2E3ISQ4      -AKKEYELSKEMLNGMQSQLAKETIDSAGQRTP-LVI--HEEAEPQDVDKPARPNIKLHL
A0A2D6W6F4      -AKKEYELSKEMLNGMQSQLAKETIDSAGQRTP-LVI--HELAEPQDVDKPARPNIKLHL
A0A2D8Z5A8      -AKKEYELSKEMLNGMQSQLAKETIDSAGQRTP-LVI--HELAEPQDVDKPARPNIKLHL
                                                                            

A0A2A2XVF1      AMALIMAFFFAIGAVIFFDSLNSSLRSVDEAESFLHLPALVGIPNRTLKGFSQLKQTLER
A0A2V5UHJ2      LLGVLLGLAAGIGLAFFLEQLDNTLKSPEEAERYLRLPSLAMVPDFVSVNGTNGSYVSRL
A0A2V5PST3      TMYAAMGLFIGAGLAFFLEYLNSRLETPEHVWRAVDLSTFGVVP----------------
A0A2V5PXM3      LLGLLAGLGSGLLLALFLNSLDRSLKTVDQTEEYLGIPVLSAIPKF--------------
A0A139SU05      RMCVMMFCVVFFGTAFGLDFIDDRIKSAWDIENFLGTSLLGIVPDL--------------
A0A1D8AZK8      KTSIGLGLLVFAAVAIGLSFIDDRVKSAWDIEGFIGAHLLGIIPEL--------------
A0A1V5QB01      FIAALIGLGVGLGLVFGLEYIDDSLRYPEEVTDLLGLPFFGLVPAA--------------
A0A139SPN4      RVCVMMFLVVFFGTAFGLDFIDDRIKSAWDIENFLNTSLLGIVPDL--------------
A0A1V6E7N1      RTSSLLFVALFLAVAIGLNFIDDRIKSTWDVEHYIGTTLLGIVPDL--------------
A0A2D9MYT1      FLGIIGGLGAGFGLAFFVNFLDDSIKSQEDIETYLKLPFLGYVP----------------
A0A258ANJ7      GSSTAGGFMLGLAIIGLIVIQDRSIRSVDDARQKLRVPVLGMIANQ--------------
A0A139TLN4      LVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESLTDIPVYGVLPRK--------------
A0A290QGD9      GLGLVGGLGLGLAVAIFVAFIDDRVKSSFDIEGQMGLHLLGIIPQV--------------
A0A1D8AS58      ALGFLGGLALGTAFAFFVAYVDDRVKSSFDIESVIGLPLVGIIPEI--------------
I6AQC1          AGGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLLGVIPQI--------------
W0ITH7          AGGFILGIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLLGVIPQI--------------
A0A1G3ZFT0      GGSIIIGLIASIILIFGRKFIFPRIEDPYWTETRFNIPNLAIIPYS--------------
A0A1Z8ZMT6      IKNTLLGLCGGLALAFMFQFVDNKIHGVADVEQTFGISILSAIQKL--------------
A0A2E8MCT7      VKTTMLGLCGGLALAFMFQFVDNKIHGVADIEQTFGISILSAIQKL--------------
A0A290Q2Z2      AFAVLFGGVLGIGTAVLIEFFDTSFRNVAELEGRLGKPVLGVIPHS--------------
A0A2A2RGK2      IQSLLGGAAIGVGLALLMFFMDTSMKTVDQVESVTGVGVIAAIPKL--------------
A0A2A2XXF7      IQNLLGGLAIGIGIAIAIFMLDTSIKTVDQVEQFTGVNVIAAIPKL--------------
A0A2A2R5D6      IASGVAGLVLGIVLAFFIEYLDTSVKTMDDVEKLLDLPVLAVIP----------------
A0A1J4XH17      ALGLMGGIASGLGAVFAIAFFDDRIKTAFDIESVVGLPLLGVIPRM--------------
A0A3C1VJ32      TLGLIFGLIMGVGLAFFIEYLDTSVKTIDDVERTFQAPVLGVIP----------------
A0A2N9NTX7      ALGVIVGLVVGIGLAFFIEYLDTSVKTIDDVERSLQSPVLGVIP----------------
B9XK55          ALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERTLQAPVLGVIP----------------
A0A4P5YMI6      ALGVIVGMIMGVGLAFFIEYLDTSVKTIDDVEAALQTSVLGVIP----------------
A0A2E6T482      SLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERSLGAAVLGVIP----------------
A0A3C0DQZ7      SLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERSLGAAVLGVIP----------------
A0A1Z9CBK5      ALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIP----------------
A0A2D6ZI96      ALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIP----------------
A0A358KGZ3      SLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIP----------------
A0A2E9ZQX4      SLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIP----------------
A0A3D5JZU0      SLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIP----------------
A0A2E6HCR0      ALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIP----------------
A0A1Z8WN04      SLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIP----------------
A0A2D7L1N4      SLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIP----------------
A0A2E2R937      SLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIP----------------
A0A520QQY4      SLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIP----------------
A0A2D5MR66      VLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIP----------------
A0A2E0PDQ1      ALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERALNTAVLGVIP----------------
A0A2E2ZZP9      ALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERALNTAVLGVIP----------------
A0A2A2RGF2      ALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERALSAPVLAVIP----------------
A0A2G4I5Y6      ALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERALQAPVLAVIP----------------
A0A3M1I883      VLGVVFGLVMGVGLAFFIEYLDTSVKTIDDVERSLEATVVGVIP----------------
A0A1V6JZ45      ALGIMVGLVMGVGLAFFIEYLDTSVKTIDDVERSLSAPVLGVIP----------------
A0A520RRW5      ALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVLGVIP----------------
A0A356NPK0      ALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVLGVIP----------------
A0A2D7B5P5      ALGVVVGLVVGIGXAFFIEYLDTSVKTIDDVEQALDAPVLGVIP----------------
A0A3D3XGB5      ALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVLGVIP----------------
A0A2V6F8A1      ILGILVGLIVGVGLAFFIEYLDTSVKTIDDVERALQAPVLGVIP----------------
A0A2V5TNH4      ALGIIVGLIVGISLAFFIEYLDTSVKTIDDVERALQAPVLGVIP----------------
A0A2V5X5Q6      ALGIIVGLIVGIGLAFFIEYLDTSVKTIDDVERALQAPVLGVIP----------------
A0A2V2DJ66      VGGFILALFGGIAMAFAVAFLDDRAKSAYDVETVIGLPLLGVIPRI--------------
R7L5A9          ILGIIAGIIGGICMAFLVAFLDDRAKSAYDIEAVIGLPLLGVIPRI--------------
A0A4P5QM05      IIAAIFGIVAGIGLAFFVEYLDTSVKTVDDIERHLSLPVLAVIP----------------
A0A4Q3C001      TLAALIGLVVGVGLAFFIEYLDTSVKTLDDVERFLQIPVLAVVP----------------
B4DB23          GMAAIIGLVLGVGLAFFIDYLDTSVKTLDDVERYLQIPVLAVIP----------------
A0A2V5URB2      MLGALLGLMGGLGLALLLEHLNNTLRTPDEVERYLRLPNLAIVPDF--------------
A0A5R8KA81      LIGLGVGLVFGLALAFGIHAFDDTLRTVDQAEAATDVPVIAALPQS--------------
A0A5B5WU87      LVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESLTDIPVYGVLPRK--------------
R7DZW0          MVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRK--------------
A0A2N8HID1      MVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRK--------------
A0A2N8HS06      MVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRK--------------
A0A3R5R2M8      AAGILGGGALCFFALLGIAMLNNKVKNKYDLPAQVRQPVIAELPKM--------------
A0A411SUQ6      AGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQM--------------
A0A2N8HZF2      AGGTAGGVLLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQM--------------
A0A354E720      AGGTAGGALLSILAFMGVAMLNNKVNNKHDLPSVNRQPVIAELPQM--------------
B2UPB6          AGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQM--------------
A0A2A2XXW5      VGSVVGGLAVALGLALFFNFLDDSIKSQEDVENILHLPFLGYIPNI--------------
A0A2V6JLK8      TLGMLVGLVIGIGLAFFIEYLDTSVKTMDDVESLLGVPVLAIIP----------------
A0A2W5Z1A5      ALGGLIGLGIGLGLAFFIEYLDTSVKTMEDVETLLGVPVLAIIP----------------
A0A2V6EA09      ALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENLLGLPVLAIIP----------------
A0A2V6GQI7      ALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENLLGLPVLAIIP----------------
A0A3C1HEJ2      LMGALAGLVSGLAVAFGLAATDSSLKSVEQAENFLKVPLLGAIPQM--------------
A0A522ULD9      LVGIIAGIVTGISLAFFLEYLDTSIKTVDDVEKYLGLPVLGAIP----------------
A0A1V6JU76      FLGAFGGLGLAIGLAFFVNFLDDSIKSQDDVELYLHLPFLGYIP----------------
A0A1Q6UHJ9      TLGILGALAGGVMVAFIVAFMDDRAKSAYDIESVVGLPLLGVIPRI--------------
A0A2V2BXR0      TLGILGALAGGVMVAFIVAFMDDRAKSAYDIESVVGLPLLGVIPRI--------------
A0A2D8V0G3      LLGLVGGLGMGFAFAFFANYLDDSVKSQDDIESYLKLNFLGYIP----------------
A0A348S017      ALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIP----------------
A0A3C1UUV7      ALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIP----------------
A0A350I3V2      ALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIP----------------
A0A520RGV5      ALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIP----------------
A0A3D3XF90      ALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIP----------------
A0A2D7B522      ALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYXP----------------
A0A356NIC2      ALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIP----------------
A0A2N8HDG3      LTAAAGGAIVCILGFLGLALLNNKVKNKKDLNAITSLPVVAELPAM--------------
A0A2U8DZK4      TFAILFGVVLGIGTALLIDMFDASFRSVADVERRLQRPVLGVIPSS--------------
A0A2T6DFL8      TFAFVFGAVLAVGVAVVLEYFDTSFRNVADVEARLGLPVLGVIPFA--------------
A0A1D8AWD4      LFACVFGTILGVGAAVLLEYFDTSFRNVADVEGKLSLPVLGVIPHM--------------
A0A4Q1C9S2      LFAFVFGSILGVGAAVLLEYFDTSFRNVADVEGKLGLPVLGVIPHL--------------
A0A178IH18      TFAFLFGAVLGVGAAVLIEFFDASFRGVADVERRLQRPVLGVIPAS--------------
A0A2T6DT99      VFAVLFGTILGVGTAVLVEYFDTSFRNVAEVEARLQRPVLGVIPNA--------------
A0A1G3ZT33      FFALLFGSLLGVGAAVLVEYFDTSFRNVADVEDHLKLPVLSVIPLS--------------
A0A3E1E2T2      AFAVLFGSILGVGAAVLLEYFDTSFRNVADVETRLKLPVLGVIPFH--------------
B1ZMW1          ALALVFGSLLGVGAALLLEYFDTSFRTVGDVETRLKLPVLGVIPRQ--------------
A0A3D1TI55      LASIFGGLFLGVALAYFIEYMDTSVKTIDDVERFLGLPVLGIIP----------------
A0A3R8IT45      AAGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLLGVIPQI--------------
A0A1H1MGC9      ALGFLGGLALGTAFAFFVAYIDDRVKSSFDIESVVGLPLIGIVPEI--------------
A0A2A2PYE8      GLGIAGGLGLGLAFAFFVAFIDDRVKSSYDIEGVVGLPLIGIIPQI--------------
A0A2T6CN73      GLGVIGGLGLGLAFAFFVAFIDDRVKSSFDIEGVVGLPLIGIIPEI--------------
A0A3E1ET42      SIGAGLGLVLGLLLAFFLEYLDTSVKSLDDVERYLGVPVLAVIP----------------
A0A2A2YDW8      ILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A352XLN9      ILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A3D0YP62      ALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERFLQVPVLAVIP----------------
A0A3D3DV47      ALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERFLQVPVLAVIP----------------
A0A2E5XJ49      GLGAAVGLIFGVAIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP----------------
A0A2E6SBY8      GLGAAVGLIFGIAIAFFLEXLDTSVKSLEDVERYLQVPVLAVIP----------------
A0A2E5QMS4      SLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP----------------
A0A2E7YXQ3      SLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP----------------
A0A2E3H787      SLGAAVGLIFGVAIAFFLEYLDTSVKTLEDVERYLQIPVLAVVP----------------
A0A2E7AGN1      SLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A2E7AKY7      SLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A3D4CU34      SLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A2E8M146      SLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A355S8S2      SLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A2D6DVN8      SLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A3C1W2R2      SLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A2E3NAY6      SLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVVP----------------
A0A2E3II01      SLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A368B8C5      SLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A3R7RBB5      SLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A2A2QX62      ALGTVVGLIFGIAVAFFLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A4Q3BWH6      TLGAIVGMIFGIGVAFFLEYLDTSVKSLEDVERYLQVPVLAVIP----------------
A0A3N5WCF1      VLGAVVGLIFGVGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP----------------
A0A4Q3C1K5      VLGAVVGLIFGVGIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP----------------
A0A2G4G428      IIGLAMGAIFGLGLIILLGTFDDRIKSPKEVEIALGIPILGTIPQI--------------
A0A139TV24      LGGAAGGAALCLFAFMGVAILNNKVKNRHDLDAITTLPVIAELPAM--------------
A0A2N8HT11      LTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAM--------------
R7DS70          LTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAM--------------
A0A2N8HNL6      LTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAM--------------
A0A146GCJ0      LVSLVAGLGLGVALVVVIDLLDASLRTVDEAESYLGLPALTAVPEQ--------------
A0A2T6D6H8      AAGLLLGVMAGVGLVFVLDLLDHSLRTVDEAESFLDLPALAAIPEK--------------
A0A5C9DC49      IYSLAMGFGLSFGLVWLIAQLDTSIKSVDQAESLLGLPVLGAVPKN--------------
A0A139TUL1      LGGMAGGAFLCLLSLMVSNALNTNVKDKNDLVGLVSLPLAGELPLL--------------
A0A2N8HCB0      VGGMTGGALVSLLALLAGNALNTKVRDKKDLAGLTDLPLAGALPLL--------------
A0A2N8HP04      MGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELPLL--------------
A0A2N8HRJ0      MGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELPLL--------------
A0A366HAG0      LLGGIIGLMFGFGMAFFLEYLDTSVRTMDDLERTLSVPVLAVVP----------------
A0A3M1I8A3      TAGVLGGILLGIGLALFVNYLDDSIKSQDDVELHLQMPFLGYVPSI--------------
A0A4V0XS84      LLGILGGLAVAIGLAFFVDYVNDTIKTQEDIEAHLQVPFLGYVPSI--------------
A0A0R2XQ77      AAGFFGGLAVGAGLIFAVAFLDDRVKSVFDIEGTIGLSMLGVVPRI--------------
A0A2E9IN28      AAGFFGGIAVGVGLIFVVAFLDDRVKSAFDIEGTIGLPMLGVVPRI--------------
D5ENH7          AAGIFGGLVVGAGLVFLVAFLDDRVKSAFDIEGTIGLPLLGVVPRI--------------
A0A351WE84      LLSIFLGFGAGIGLAYFIEYLDTSVRTVDDVEQFLGLPVLGVIP----------------
A0A1V5QDZ6      LLSVLLGLGAGVGLAYFIEYLDTSVKTVDDIERYLGLSVLGIIP----------------
A0A4Y8P964      LFALVFGSLASCGLALGLAKLDTRIRSKEEIEKEFGLPVLGSVPDV--------------
A0A3D4HF88      FLGFSGGIMLSLIFVGLLAFFDDRVKTAYDVEGILNLPLIGVVAKL--------------
A0A351MR11      FVGIGLGLASGVGLVVLLGVFDDRVKSAVDIEGGLGLPLVGTVPRT--------------
A0A5B5WI95      AAGTLGGAALCFFAFLGLGMMNNKVKNKHDLTGQTRQPIIAELPRM--------------
A0A2N8I9W1      AGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQM--------------
A0A4Q5IH27      AGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQM--------------
A0A2N8IBZ6      AGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQM--------------
A0A2N8IJW9      AGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQM--------------
R6J100          AGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQM--------------
A0A1V6J089      FLSVVLGLMAGTGLAFFVEYLDVSIKTVDEVEKYLGLPVLAVIP----------------
A0A3C1BZR1      FLSVVLGLLAGTGLAFFVEYLDVSIKTVDEVEKYLGLPVLAVIP----------------
A0A1H6KPB7      ILGAVVGVVFGIGVAFLLNYMDTSVKTLEDVERNLNLPVLGVIP----------------
A0A2E9ISN4      AASLFLGAAFGAGAILGLEYLKPNPINVTHLEREYHIDLLGQIR----------------
B9XAX1          GGAVVTGLLMSLCMIYLMSLFDSSIRTVDQAEFVLGLPVLAAIPVA--------------
A0A5R8KKM9      ALGAVVGLMFGFGLAFFLEYLDTTVKSIDEVERLLGVPVLAVIP----------------
A0A139TS01      AVGAVAGLLLGMGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A3E1EJT7      TLGVLAGLVAGFSVAFLIATLDDRIKTISAVETLVDLPLLGVIPEV--------------
A0A317ZP96      AAGFFGGLAVGTALVFAVAFLDDRVKSAFDIEGTIGLPMLGVIPRI--------------
A0A2D5WGA5      ALGMVVGLILGVGLAFFLEYLDTSVKTIDDVEHALGAAVLGVIP----------------
A0A2E7SSH2      ALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIP----------------
A0A349GXM8      MAALAGGLGLGFGLAFLAQVVDNKVQTIKDVENILGVRFLGGIPYW--------------
A0A4P5YP61      AAAVLVGLMGGLMLALLLNQIDSSIKSVDQAEEFLQLPVLSAIPQI--------------
A0A5R1Q5N3      LFALVFGSLTSCGLALGLAKLDTRIRSKEEIEKQLGIPVLGSIPDI--------------
I0JYY7          LFALVFGSLTSCGLALGLAKLDTRIRSKEEIEKQLGIPVLGSIPDI--------------
A0A4R7S1J2      SSGVGGGFALAAGVIFLLFFMDRTIKSVDQAEKILRLPVLATINKA--------------
A0A2A2XV69      ILGVVVGIGFGVGLAFFIEYLDTSVKTLQDLESILKIPVLAVIP----------------
A0A651H7X9      GLGLLGGLGLGLGVAFFIAILDDRVKSAFDIESVVGLPLIGLIPRL--------------
A0A4Y8P842      LLALFGGSIGGIGLALGLAMLDNRFRGKEEIEKFLKIPVLGVIPDI--------------
B3DZK9          LLGLFGGSVGGIGLALGLALLDNRFRGKDDIEKFLKIPVLGVIPDI--------------
A0A5E6MPC4      LLGFLGGGLGGLGLAVGLARFDTRLRGKEEVERTLGLPVLGQVPDT--------------
A0A4V1SB02      SIAGLLALLLGSGLVLLMDRLDSSIRTVDEAENILELGVLAAVPDG--------------
A0A3C1VB86      ALALFGGLAVGLGISFVLNSMDTSFRTVDEVEHYLALPVLGAIPKL--------------
A0A146G2Q9      VLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESFLKVPVLAVIP----------------
A0A2T6D3Y2      VLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESFLKVPVLAVIP----------------
A0A2V2SDV4      ALGIIVGLVVGVGLAFFIEYLDTSVKTIDDVERSLNSPVLGVIP----------------
A0A2V5PK75      ALGIIIGLVVGIGLAFFIEYLDTSVKTIDDVERSLQSPVLGVIP----------------
A0A1V6DME1      ALGVIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQSPVLGVIP----------------
A0A3D3DIJ3      ALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQCPVLGVIP----------------
A0A2D5VY59      ALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIP----------------
A0A2D8UZZ4      ALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIP----------------
A0A353DV86      ALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIP----------------
A0A2E5EPT8      ALGVVLGAVMGIGMAFFIEYLDTSVKTIDDVEHTLQAPVLAVIP----------------
A0A5C9DS93      ALGAFVGLLLGVGLAFFIEYLDTSVKTIDDVERALSAPVLAVIP----------------
A0A350EWA4      ALGVIVGLVVGVGLAFFIEYLDTSVKTIDDVERALQAHVLGVIP----------------
A0A5B5WZ91      AVGAVAGLLLGVGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A2N8HD92      AVGASVGLLLGIGLALFLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A2N8HIT2      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A354EBD3      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A355VEB2      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A2N8IMT3      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
R6K1U5          AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A2N8IWC2      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A2N8I441      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A2N8I3A6      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A410SCC4      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A3R5VEW0      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A411SSG2      AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
B2UKW3          AVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP----------------
A0A1M6RLZ4      ALGAVAGLVFGVGIAFALELMDTSVKTLEDVERFLQVPVLAVIP----------------
A0A354T7G8      ALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERHLGVPVLAVVP----------------
A0A2S7U4L6      ALGSVAGMIFGIGIAFSLELMDTSVKSLEDVERYLQVPVLAVVP----------------
A0A512MBZ2      ALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERFLGVPVLAVVP----------------
A0A2E8MEZ0      LLGAGVGLIFGIGIAFLLEHLDTSVKSLEDVERYLQVPVLAVIP----------------
A0A4Q2YKS3      VLGAVVGLIFGVGIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP----------------
A0A2E3EC33      VLGATVGLVFGIGMAFFLEYLDTSVKSMDEVEHFLELPVLAVIP----------------
A0A2E4GN01      VLGAAVGLVFGIGMAFFLEYLDTSVKSLDEVEHFLELPVLAVIP----------------
A0A1Z8XU55      VLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP----------------
A0A2E1RQR9      VLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP----------------
A0A2E3ISQ4      VLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP----------------
A0A2D6W6F4      VLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP----------------
A0A2D8Z5A8      VLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP----------------
                                                                            

A0A2A2XVF1      ECAALPGRLRQARNIGKPHKKKESSVLGD-----------------IQELIRPAPIARTD
A0A2V5UHJ2      LKSAQAELPVSARKAAKAKHADSSVLLDH-------------------------------
A0A2V5PST3      ---------------------DLASLNRP-------LISYQPVSSGKPKRIAQLQAQQKT
A0A2V5PXM3      --------------ASVAGD-QRKLINAE-------------------------------
A0A139SU05      --------------ASVKDEDKYTLLLKD-------------------------------
A0A1D8AZK8      --------------GDVPDTEKHSLVNSN-------------------------------
A0A1V5QB01      --------------SWDPEDLRTHILSNI-------------------------------
A0A139SPN4      --------------NNVKDEDKYTLLLKD-------------------------------
A0A1V6E7N1      --------------ADTPDDDRYRMVLDH-------------------------------
A0A2D9MYT1      -------------------NIKTTSIIER-------------------------------
A0A258ANJ7      --------------RQIATASEQQKGHDF-------------------------------
A0A139TLN4      --------------PRKLKNQEIVVNLEE-------------------------------
A0A290QGD9      --------------RKMPAPEKAQVVANH-------------------------------
A0A1D8AS58      --------------KRMDQPDKAQIVINN-------------------------------
I6AQC1          --------------KKMDQADKAQVALNN-------------------------------
W0ITH7          --------------KKMDQADKAQVALNN-------------------------------
A0A1G3ZFT0      --------------KEQFK--DFQDLKRN------------------------------V
A0A1Z8ZMT6      --------------PPEEELLEKMESLRD------------------------LPVSMKH
A0A2E8MCT7      --------------PPEEELLKEMESIRD------------------------LPVSMKH
A0A290Q2Z2      --------------SEAVPPAKSGIVEDP-------------------------------
A0A2A2RGK2      --------------SLNA---RASVLVTN-------------------------------
A0A2A2XXF7      --------------SLST---RASVLVTN-------------------------------
A0A2A2R5D6      -------------------D-GVGPLIRE-------------------------------
A0A1J4XH17      --------------ANLNTQEKAKTVVKG-------------------------------
A0A3C1VJ32      -------------------Q-NIGYLLEE-------------------------------
A0A2N9NTX7      -------------------Q-NVGLLVDE-------------------------------
B9XK55          -------------------Q-NVGLLLDE-------------------------------
A0A4P5YMI6      -------------------Q-NVGSLLDE-------------------------------
A0A2E6T482      -------------------Q-NVGSLLEE-------------------------------
A0A3C0DQZ7      -------------------Q-NVGSLLEE-------------------------------
A0A1Z9CBK5      -------------------Q-NVGSLVDE-------------------------------
A0A2D6ZI96      -------------------Q-NVGSLVDE-------------------------------
A0A358KGZ3      -------------------Q-NVGSLMDE-------------------------------
A0A2E9ZQX4      -------------------Q-NVGSLMDE-------------------------------
A0A3D5JZU0      -------------------Q-NVGSLMDE-------------------------------
A0A2E6HCR0      -------------------Q-NVGSLVDE-------------------------------
A0A1Z8WN04      -------------------Q-NVGSLVDE-------------------------------
A0A2D7L1N4      -------------------Q-NVGSLVDE-------------------------------
A0A2E2R937      -------------------Q-NVGSLVDE-------------------------------
A0A520QQY4      -------------------Q-NVGSLVDE-------------------------------
A0A2D5MR66      -------------------Q-NVGSLVDE-------------------------------
A0A2E0PDQ1      -------------------Q-NVGSLVDE-------------------------------
A0A2E2ZZP9      -------------------Q-NVGSLVDE-------------------------------
A0A2A2RGF2      -------------------Q-NVGALLDE-------------------------------
A0A2G4I5Y6      -------------------Q-NVGALLDE-------------------------------
A0A3M1I883      -------------------Q-NIGLLIKE-------------------------------
A0A1V6JZ45      -------------------Q-NVGILVNE-------------------------------
A0A520RRW5      -------------------Q-NVHSLLME-------------------------------
A0A356NPK0      -------------------Q-NVHSLLME-------------------------------
A0A2D7B5P5      -------------------Q-NVHSLLME-------------------------------
A0A3D3XGB5      -------------------Q-NVHSLLME-------------------------------
A0A2V6F8A1      -------------------Q-NVGSLIQE-------------------------------
A0A2V5TNH4      -------------------Q-NVSSLILE-------------------------------
A0A2V5X5Q6      -------------------Q-NVSSLILE-------------------------------
A0A2V2DJ66      --------------KRLSSAEKAQVAASN-------------------------------
R7L5A9          --------------KRLNSAEKAQVAASN-------------------------------
A0A4P5QM05      -------------------T-EIVILLQQ-------------------------------
A0A4Q3C001      -------------------K-GVSALMKE-------------------------------
B4DB23          -------------------N-NVSILMKN-------------------------------
A0A2V5URB2      --------------YRLPNHRNGQKSLIH-----------------YDKYNKVKFDNKLC
A0A5R8KA81      --------------SKFKSPAHSLVMVKD-------------------------------
A0A5B5WU87      --------------PRKLKNQEIVVNLEE-------------------------------
R7DZW0          --------------PRKLKNQEIVVNLEE-------------------------------
A0A2N8HID1      --------------PRKLKNQEIVVNLEE-------------------------------
A0A2N8HS06      --------------PRKLKNQEIVVNLEE-------------------------------
A0A3R5R2M8      --------------SKKERK-NNTPLIRN-------------------------------
A0A411SUQ6      --------------SKKESK-NTKLFIQD-------------------------------
A0A2N8HZF2      --------------NKKESR-NTGLFIQD-------------------------------
A0A354E720      --------------SKKESR-NTKLFIQD-------------------------------
B2UPB6          --------------SKKESK-NTKLFIQD-------------------------------
A0A2A2XXW5      --------------K------SISIVERD-------------------------------
A0A2V6JLK8      -------------------K-NINLLHKA---------EG--------------------
A0A2W5Z1A5      -------------------K-NVTLLHHE---------IG--------------------
A0A2V6EA09      -------------------K-NIKLLHRE---------AG--------------------
A0A2V6GQI7      -------------------K-NIKLLHRE---------AG--------------------
A0A3C1HEJ2      --------------KELQSSDSSQVIMAD-------------------------------
A0A522ULD9      -------------------Q-RVKPLHEE-------------------------------
A0A1V6JU76      -------------------NIKTNSVVES-------------------------------
A0A1Q6UHJ9      --------------RRLNSSQKAQVAVSN-------------------------------
A0A2V2BXR0      --------------RRLNSSQKAQVAVSN-------------------------------
A0A2D8V0G3      -------------------NIKSQSLVER-------------------------------
A0A348S017      -------------------NIKTNSLVER-------------------------------
A0A3C1UUV7      -------------------NIKTNSLVER-------------------------------
A0A350I3V2      -------------------NIKTNSLVER-------------------------------
A0A520RGV5      -------------------NIKTNSLVER-------------------------------
A0A3D3XF90      -------------------NIKTNSLVER-------------------------------
A0A2D7B522      -------------------NIKTNSLVER-------------------------------
A0A356NIC2      -------------------NIKTNSLVER-------------------------------
A0A2N8HDG3      --------------TKKEQR-QVARMFTD-------------------------------
A0A2U8DZK4      --------------LTARKPAEEPLDPAE-------------------------------
A0A2T6DFL8      --------------QDPLARG--GDDPAE-------------------------------
A0A1D8AWD4      --------------AEAGELH--DPSSPE-------------------------------
A0A4Q1C9S2      --------------PEPPALH--DATAPE-------------------------------
A0A178IH18      --------------ATARRPNEDSGDPAD-------------------------------
A0A2T6DT99      --------------PDPLKKDAAGEDPAE-------------------------------
A0A1G3ZT33      --------------RTPARLD--PDNPAE-------------------------------
A0A3E1E2T2      --------------RDPLDEE--GD-PAE-------------------------------
B1ZMW1          --------------TDPLGGD--ED-PAE-------------------------------
A0A3D1TI55      -------------------Q-RVRPLVEE---------GP--------------------
A0A3R8IT45      --------------KKMDQADKAQVVSNN-------------------------------
A0A1H1MGC9      --------------KRLDQPEKAQIVANN-------------------------------
A0A2A2PYE8      --------------KRMDQPDKAQIVINN-------------------------------
A0A2T6CN73      --------------KKLEQVEKAQIVATN-------------------------------
A0A3E1ET42      -------------------K-DVGILHKQ---------SG--------------------
A0A2A2YDW8      -------------------K-DIGVLHKQ---------SG--------------------
A0A352XLN9      -------------------K-DIGVLHKQ---------SG--------------------
A0A3D0YP62      -------------------K-DVGVLHRQ---------SG--------------------
A0A3D3DV47      -------------------K-DVGVLHRQ---------SG--------------------
A0A2E5XJ49      -------------------K-DVGVLHKQ---------SG--------------------
A0A2E6SBY8      -------------------K-DVGVLHKQ---------SG--------------------
A0A2E5QMS4      -------------------K-DVGTLHKQ---------SG--------------------
A0A2E7YXQ3      -------------------K-DVGILHKQ---------SG--------------------
A0A2E3H787      -------------------T-DVNVLHKQ---------SG--------------------
A0A2E7AGN1      -------------------T-DVGVLHKQ---------SG--------------------
A0A2E7AKY7      -------------------T-DVGVLHKQ---------SG--------------------
A0A3D4CU34      -------------------T-DVGVLHKQ---------SG--------------------
A0A2E8M146      -------------------T-DVGVLHKQ---------SG--------------------
A0A355S8S2      -------------------T-DVGVLHKQ---------SG--------------------
A0A2D6DVN8      -------------------T-DVGVLHKQ---------SG--------------------
A0A3C1W2R2      -------------------T-DVGVLHKQ---------SG--------------------
A0A2E3NAY6      -------------------T-DVGVLHKQ---------SG--------------------
A0A2E3II01      -------------------T-DVGVLHKQ---------SG--------------------
A0A368B8C5      -------------------T-DVGVLHKQ---------SG--------------------
A0A3R7RBB5      -------------------T-DVGVLHKQ---------SG--------------------
A0A2A2QX62      -------------------K-DVGVLYKQ---------SG--------------------
A0A4Q3BWH6      -------------------K-DVGVLYKQ---------SG--------------------
A0A3N5WCF1      -------------------K-DVGILHKQ---------SG--------------------
A0A4Q3C1K5      -------------------K-DVGVLHKQ---------SG--------------------
A0A2G4G428      --------------TKSVGP-ERALLAMH-------------------------------
A0A139TV24      --------------SKKEQK-QVSLMLPD-------------------------------
A0A2N8HT11      --------------TKKEQR-QVARMFTD-------------------------------
R7DS70          --------------TKKEQR-QVARMFTD-------------------------------
A0A2N8HNL6      --------------TKKEQR-QVARMFTD-------------------------------
A0A146GCJ0      --------------RSKSVGEQVAEAWNDKTLGSLPKDLAQKQVLEPLRRSLNRKEREAQ
A0A2T6D6H8      --------------RIETVLNQVGEAIREKKLSKIPQEIAGKGVVEPVRKFLNAREATAQ
A0A5C9DC49      --------------KLVKDG-KSRLFMSD---------DP--------------------
A0A139TUL1      --------------SGKERK-KLPLVVIN-------------------------------
A0A2N8HCB0      --------------SGKERA-KLPLVVMN-------------------------------
A0A2N8HP04      --------------SGKERK-KLPMVVTN-------------------------------
A0A2N8HRJ0      --------------SGKERK-KLSLVVTN-------------------------------
A0A366HAG0      -------------------K-GVGTLMHA---------TG--------------------
A0A3M1I8A3      --------------KSAKEV-ERYLQCHL---------HP--------------------
A0A4V0XS84      --------------KRESVV-ERDLEAHS---------NP--------------------
A0A0R2XQ77      --------------KKLDSS-SKAQAVAS---------NI--------------------
A0A2E9IN28      --------------KKLDSN-TKAQAVAS---------NV--------------------
D5ENH7          --------------KKLDSN-SKAQAVAS---------NV--------------------
A0A351WE84      -------------------Q-KIRPLIHE---------GP--------------------
A0A1V5QDZ6      -------------------Q-KVRPLTEE---------GP--------------------
A0A4Y8P964      --------------EFLQGE-GIDEIPKDIPFALTTHAAP--------------------
A0A3D4HF88      --------------QELSAK-EKAIAVAS---------NA--------------------
A0A351MR11      --------------TDTYGP-DRALLARQ---------TK--------------------
A0A5B5WI95      --------------SKKERK-NTSLFIKE-------------------------------
A0A2N8I9W1      --------------NKKESR-NTGLFIQD-------------------------------
A0A4Q5IH27      --------------NKKESR-NTGLFIQD-------------------------------
A0A2N8IBZ6      --------------NKKESR-NTGLFIQD-------------------------------
A0A2N8IJW9      --------------NKKESR-NTGLFIQD-------------------------------
R6J100          --------------NKKESR-NTGLFIQD-------------------------------
A0A1V6J089      -------------------Q-QSRPLTEA---------GQ--------------------
A0A3C1BZR1      -------------------Q-QSRPLTEA---------GQ--------------------
A0A1H6KPB7      -------------------Q-DIGLLHLM---------NG--------------------
A0A2E9ISN4      -------------------RWDLYLPIDKFNPESDIFVAA--------------------
B9XAX1          --------------KKGRNG-TPAHIVAD---------DP--------------------
A0A5R8KKM9      -------------------K-NVGALHRT---------TG--------------------
A0A139TS01      -------------------K-NVPILHSA---------GS--------------------
A0A3E1EJT7      --------------KRMDQP-DKAQIVSN---------GS--------------------
A0A317ZP96      --------------KKLDTN-TKAQAVAS---------NV--------------------
A0A2D5WGA5      -------------------Q-NVGSLLDE---------GD--------------------
A0A2E7SSH2      -------------------Q-NVGSLMDE---------GD--------------------
A0A349GXM8      --------------AHSQLESSIRPIVTE---------EH--------------------
A0A4P5YP61      --------------TAFG-N-NRGLVVVD---------DA--------------------
A0A5R1Q5N3      --------------ELIKGE-GIDEIPKDIPFALTTYSSP--------------------
I0JYY7          --------------ELIKGE-GIDEIPKDIPFALTTYSSP--------------------
A0A4R7S1J2      --------------KYS--D-EAGAILKH---------AE--------------------
A0A2A2XV69      -------------------K-EISLLING---------ND--------------------
A0A651H7X9      --------------RKMEVH-EKAQIVLN---------NE--------------------
A0A4Y8P842      --------------EKLKKS-HPETYEGEIPYALMTYALP--------------------
B3DZK9          --------------EKLKKH-QPETYEGDIPYALMTYALP--------------------
A0A5E6MPC4      --------------EKLKAK-GIDEIPADLPMAFAAHVAP--------------------
A0A4V1SB02      --------------DSSKIP-KGGTVMTD---------DA--------------------
A0A3C1VB86      --------------PKTEGK-GNDLAAAQ---------DS--------------------
A0A146G2Q9      -------------------K-GISLLVNE---------AK--------------------
A0A2T6D3Y2      -------------------K-GISLLVNE---------TK--------------------
A0A2V2SDV4      -------------------Q-NVGAILDE---------GA--------------------
A0A2V5PK75      -------------------Q-NVGLILDE---------GV--------------------
A0A1V6DME1      -------------------Q-NVGSLLQE---------GA--------------------
A0A3D3DIJ3      -------------------Q-NVGLLVDE---------GT--------------------
A0A2D5VY59      -------------------Q-NVQSLLLE---------GP--------------------
A0A2D8UZZ4      -------------------Q-NVQSLLLE---------GP--------------------
A0A353DV86      -------------------Q-NVQSLLLE---------GP--------------------
A0A2E5EPT8      -------------------Q-NVGVLMNE---------DP--------------------
A0A5C9DS93      -------------------Q-NVGALLDE---------GM--------------------
A0A350EWA4      -------------------Q-NVGSLLDE---------GP--------------------
A0A5B5WZ91      -------------------K-NVPILHSA---------GS--------------------
A0A2N8HD92      -------------------K-NVPILHSS---------DV--------------------
A0A2N8HIT2      -------------------K-NVPILHSS---------DV--------------------
A0A354EBD3      -------------------K-NVPILHSS---------GV--------------------
A0A355VEB2      -------------------K-NVPILHSS---------GV--------------------
A0A2N8IMT3      -------------------K-NVPILHSS---------DA--------------------
R6K1U5          -------------------K-NVPILHSS---------DA--------------------
A0A2N8IWC2      -------------------K-NVPILHSS---------DA--------------------
A0A2N8I441      -------------------K-NVPILHSS---------DA--------------------
A0A2N8I3A6      -------------------K-NVPILHSS---------DA--------------------
A0A410SCC4      -------------------K-NVPILHSS---------DA--------------------
A0A3R5VEW0      -------------------K-NVPILHSS---------DV--------------------
A0A411SSG2      -------------------K-NVPILHSS---------DV--------------------
B2UKW3          -------------------K-NVPILHSS---------DV--------------------
A0A1M6RLZ4      -------------------R-DVGVLHKQ---------SG--------------------
A0A354T7G8      -------------------K-GVGVLHRS---------SG--------------------
A0A2S7U4L6      -------------------R-DVGVLYKM---------ST--------------------
A0A512MBZ2      -------------------K-NVGVLHRT---------SG--------------------
A0A2E8MEZ0      -------------------K-DVGVLHKQ---------SG--------------------
A0A4Q2YKS3      -------------------K-DVGVLHKQ---------SG--------------------
A0A2E3EC33      -------------------Q-AVGVLXRQ---------SG--------------------
A0A2E4GN01      -------------------Q-DVGILHRQ---------SG--------------------
A0A1Z8XU55      -------------------K-DVGVIHKQ---------SG--------------------
A0A2E1RQR9      -------------------K-DVGVIHKQ---------SG--------------------
A0A2E3ISQ4      -------------------K-DINVLHKE---------SG--------------------
A0A2D6W6F4      -------------------K-DINVLHKE---------SG--------------------
A0A2D8Z5A8      -------------------K-DINVLHKE---------SG--------------------
                                                                            

A0A2A2XVF1      SEKYPIATIEEPESGLAEAYRTLRVSIS--ML-GPEEERRVLLFVSAIPEEGKTYTSLNT
A0A2V5UHJ2      ----------HSLSVVAEAYRSFRSALL--LS-QAGGPPHTILVTSAARGEGKTTTLVNS
A0A2V5PST3      SNGKDLIVSYHPLSIFSESYRTIRTALL--LS-EPEATRKVILLTSPSPGEGKTATTLNL
A0A2V5PXM3      ----------DAESGEAEAFRTLRTAIS--ML-GRKEERRVFLFTSAVPSEGKTFCSLNF
A0A139SU05      -----------THPTAVEAFMGIYGAAK--TH-SLVDYPKSMLVTSTIPGEGKTLVSANL
A0A1D8AZK8      -----------KTSPGSEAFLSVYSAVK--IQ-SKLDFPKSVLVTSTIPGEGKTMISCNL
A0A1V5QB01      ----------DQKSGMVEAYRNVRSALL--FS-VAGSQSKFIAMTSAVPKEGKTTTCLNL
A0A139SPN4      -----------TNPTAVEAFTGIYSAAK--TH-SLVDYPKAMLVTSTIPGEGKTLVSANL
A0A1V6E7N1      -----------RQSPGLEAFLSIYSSVK--IH-SKLDFPKSILVTSTIPGEGKTLVSANL
A0A2D9MYT1      ----DLQAHLHPQSNSAEAFRTVRAAIS--LS-VRAGDLQILSVTSTVPSEGKSLVASNH
A0A258ANJ7      --TQGLTPALIAHKAVAESFREFRAIIAR----MARCPHTCHMVVSAVPDEGKTFVSTHL
A0A139TLN4      ------------PSELSESFPLLAERLVSLAD-ENGPGGFSILLTSSCPGEGKTYLAVNL
A0A290QGD9      -----------ADRQVSEAFLTLHSSLR--LK-DDARAAKCILVTSTIPGEGKSFTTTNL
A0A1D8AS58      -----------QDKQVVESFLTLHSSLR--LK-DESKAAQAILVTSTIPGEGKSFTTTNL
I6AQC1          -----------ADRQVAEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTTTNL
W0ITH7          -----------ADRQVAEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTTTNL
A0A1G3ZFT0      KKPIMLLSQKDPRNLSIESLRSLRTSLQ--VN-LSCANNNIISILGASPGVGKTFVSTNL
A0A1Z8ZMT6      ISPTLAVPGWKTDFVHSEMFRVLRASIS--LL-GDANQRKITMITSSIPGEGKTFCAANL
A0A2E8MCT7      ICPTLAVPGWKTDFVHSEMFRVLRASIS--LL-GDTNQRKITMITSSVPGEGKTFCAANL
A0A290Q2Z2      --------------AELEPFRVLHTNLN--LALKGVTPGRSLVMLSAGPGEGKSTTVLRL
A0A2A2RGK2      ---------EERSGIVAESFRSLRASLT--LH-RINEDARTFLFTSSMPSEGKTFCSSNF
A0A2A2XXF7      ---------EERSGIVAESFRSLRASLT--LH-RLNESARTFLFTSSMPSEGKTFCSSNF
A0A2A2R5D6      ----------GADSPHAEGYRILRAKID--LN-PKSGAGNTLTVVSGGPGEGKSTTLFNL
A0A1J4XH17      -----------TEKTVLESFRAIDSLLR--LN-KASKPARVITVTSTLPSEGKSFFTTNL
A0A3C1VJ32      ----------GAESKHAEAYRVLRTNLL--FS-RKDEKLNTIVIVSAGAGEGKSTTTINL
A0A2N9NTX7      ----------GVESPHAEAYRVLRTNLL--FS-RKDEKLNTVAVVSAGAGEGKSTTVFNL
B9XK55          ----------GAESPHAEAYRVLRTNLM--FS-RKDDKLNTMAVVSAGAGEGKSTTVYNM
A0A4P5YMI6      ----------GVDSPHAEAYRVLRTNLM--FA-RKDPKANSLIVVSSGAGEGKTTTVLNL
A0A2E6T482      ----------GDESPHAEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTMFNL
A0A3C0DQZ7      ----------GDESPHAEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTMFNL
A0A1Z9CBK5      ----------GDESPHAEAYRVLRTNIL--FAGRTSEXXTTFSVVSGGAGEGKTTTMFNL
A0A2D6ZI96      ----------GDESPHAEAYRVLRTNIL--FAGRTSEXXTTFSVVSGGAGEGKTTTMFNL
A0A358KGZ3      ----------GDESPHAEAYRVLRTNIL--FAGRKSEDQTTFTVVSGGAGEGKTTTMFNL
A0A2E9ZQX4      ----------GDESPHAEAYRVLRTNIL--FAGRKSEDQTTFTVVSGGAGEGKTTTMFNL
A0A3D5JZU0      ----------GDESPHAEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTMFNL
A0A2E6HCR0      ----------GEESPHAEAYRVLRTNIL--FAARKSEDQTTFTVVSGGAGEGKTTTMFNL
A0A1Z8WN04      ----------GEESPHAEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNL
A0A2D7L1N4      ----------GEESPHAEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNL
A0A2E2R937      ----------GEESPHAEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNL
A0A520QQY4      ----------GEESPHAEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNL
A0A2D5MR66      ----------GEESPHAEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNL
A0A2E0PDQ1      ----------GEESPHAEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNL
A0A2E2ZZP9      ----------GEESPHAEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNL
A0A2A2RGF2      ----------GMDSPHAEAYRVLRTNVL--FT-RKDDQANAITVVSGGAGEGKSTTVLNL
A0A2G4I5Y6      ----------GMDSPHAEAYRVLRTNVL--FT-RKDDAANAITVVSGGAGEGKSTTVLNL
A0A3M1I883      ----------GPDSPHAEAYRVLRTNVL--FS-RKNPNDNTITVVSGGAGEGKSTTIMNL
A0A1V6JZ45      ----------GPDSPHGEAYRVLRTNIL--FS-RKEPGANTLTVVSGGAGEGKSTTILNL
A0A520RRW5      ----------GPDSPHAEAYRVLRTNIL--FS-RKNEKANTLTVVSGGAGEGKSTTIFNL
A0A356NPK0      ----------GPDSPHAEAYRVLRTNIL--FS-RKSEKATTLTVVSGGAGEGKSTTIFNL
A0A2D7B5P5      ----------GPDSPHAEAYRVLRTNIL--FS-RKXEKAXTLTVVSGGAGEGKSTTIFNL
A0A3D3XGB5      ----------GPDSPHAEAYRVLRTNIL--FS-RKNEKANTLTVVSGGAGEGKSTTIFNL
A0A2V6F8A1      ----------GPESPHAEAYRVLRTNVL--FS-RKREDANSITVVSGGAGEGKSTTIFNL
A0A2V5TNH4      ----------GSESPHAEAYRVLRTNVL--FS-RKREDANSLTVVSGGAGEGKSTTIFNL
A0A2V5X5Q6      ----------GPESPHAEAYRVLRTNVL--FS-RKREDANSLTVVSGGAGEGKSTTIFNL
A0A2V2DJ66      -----------ADRASTEAFRTLYSTLK--IN-NVSKDAKVILATSTTPSEGKSFVISNL
R7L5A9          -----------ADRATTEAFRSLHSTLK--VN-NFSKNAKVILFTSTTPSEGKSFIVTNL
A0A4P5QM05      ----------KRDTADAEAYRILKGNIE--LN-LPDHGANTYTLVSGGPGEGKSTTLSNL
A0A4Q3C001      ----------SNDSQHAEAYRILRANVE--FN-KPGRDANTFTLISGGPGEGKSTTLNNL
B4DB23          ----------AGDTSDAEAYRILRAAVE--FN-KPYRDANTFTLISGGPGEGKSTTLNNL
A0A2V5URB2      LPSKKSSLSDRRISVVTESYRKLRAAIF--LS-RPEAPPKTILFTSGTASEGKTITVANT
A0A5R8KA81      -----------PNSPIAESFRILRSSLE--LM-EDHDKDEVVLFTSSIPSEGKSFCSANY
A0A5B5WU87      ---------PSEL---SESFPLLAERLVSLAE-ENGPGCFSILLTSSCPGEGKTYLAVNL
R7DZW0          ---------PSEL---SECFPLLAERMVALSD-GNEGNPLSVLITSTCSGEGKTYLSVNL
A0A2N8HID1      ---------PSEL---SECFPLLAERMVALSD-GNEGNPLSVLITSTCSGEGKTYLSVNL
A0A2N8HS06      ---------PSEL---SECFPLLAERMVALSD-GNGGNPLSVLITSTCSGEGKTYLSVNL
A0A3R5R2M8      -----------DHSVIAECFHILRNNVDSLLP-RPDAGGYVILLTSTCPAEGKTFASANL
A0A411SUQ6      -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
A0A2N8HZF2      -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
A0A354E720      -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
B2UPB6          -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
A0A2A2XXW5      -----LQSHLHPTSSPAEGFRTLRAAIS--LA-KNADKLRVMAFTSTIPSEGKSLVASNF
A0A2V6JLK8      ---------DTPD---AEAYRILRTNIE--FN-RANPEANTISLVSGGPGEGKSTTIANL
A0A2W5Z1A5      ---------DSPD---AEAYRILRTNIE--FN-RRNPEANTISIASGGPGEGKSTTVTNL
A0A2V6EA09      ---------DTPD---AEAYRILRTNIE--FN-RKNPEANTISLVSGGPGEGKSTTIANL
A0A2V6GQI7      ---------DTPD---AEAYRILRTNIE--FN-RKNPEANTISLVSGGPGEGKSTTIANL
A0A3C1HEJ2      ----------PRLVAGAEAFRSLRTTLS--ML-GPVNERRTFLFTSAVPDEGKTFCTINF
A0A522ULD9      ----------GPDSPHAEAYRVLRANIQ--F--ANKGNGGAFSFISGGAGEGKSTTLFNL
A0A1V6JU76      ----GLQAHLHPQSNAAESFRTVRAAIA--LG-AKAEKMRVFTVTSTIPSEGKSLVASNL
A0A1Q6UHJ9      -----------ADRATTEAFRSVHSMLK--VN-NIAKDSKVLLFTSTTPSEGKSFVVTNL
A0A2V2BXR0      -----------ADRATTEAFRSVHSMLK--VN-NIAKDSKVLLFTSTTPSEGKSFVVTNL
A0A2D8V0G3      ----DLQAHLHPQSNAAEGFRTVRAAVS--LV-HKSDKFKVLSMTSTIPSEGKSLVASNL
A0A348S017      ----DMQAHLHPQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNL
A0A3C1UUV7      ----DMQAHLHPQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNL
A0A350I3V2      ----DMQAHLHPQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNL
A0A520RGV5      ----DMQAHLHPQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNL
A0A3D3XF90      ----DMQAHLHPQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNL
A0A2D7B522      ----DMQAHLHPQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNL
A0A356NIC2      ----DMQAHLHPQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNL
A0A2N8HDG3      -----------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFISANL
A0A2U8DZK4      ----------------DEPFRVLQTNITLALRNKPSHGAQTLVMLSAGPGEGKSTTLLRL
A0A2T6DFL8      ----------------LEPYRVLYTNLNLAL--KPGQAH-ALVFSSAGPGEGKSTTLHRL
A0A1D8AWD4      ----------------GEPYRVLQTNLNLAL--TAGKTS-VLVVLSSGPGEGKSTTLRQL
A0A4Q1C9S2      ----------------GEPYRVLQTNLNLAL--PARQSS-VLVVLSSGPGEGKSTTLRQL
A0A178IH18      ----------------AEPFRVLQTNISLAR--KDAAPGRTLVMLSAGPGEGKSTTLLRL
A0A2T6DT99      ----------------LEPFRVLHTNLNLAL--KSDARGRTLILLSAGPGEGKSTTLLRL
A0A1G3ZT33      ----------------SEPFRVLQTNLNLAL--PPGQPG-SLVVVSAGPGEGKSTTVHHL
A0A3E1E2T2      ----------------TEPFRVLHTNLNLAL--KPGEAA-SLVLFSAGPGEGKSTTLHRL
B1ZMW1          ----------------AEPYRVLQTNLNLAL--KPGQPA-SLVIFSAGPGEGKSTTLFRL
A0A3D1TI55      ---------DSPH---AEAYRVLRTNLQ--FA-AKDPGANAITIVSGGVGEGKSTTLFNL
A0A3R8IT45      -----------ADRQVSEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTTTNL
A0A1H1MGC9      -----------QDKQVVESFLTLHSSLR--LK-DESKRAQAILVTSTIPGEGKSFTTTNL
A0A2A2PYE8      -----------ADRQVSEAFLTLHSSLR--LK-DESKNAKCILVTSTIPGEGKSFTTTNL
A0A2T6CN73      -----------TDRLASEAFLTLHSSLR--LK-DESKNAKCILTTSTIPGEGKSLTTTNL
A0A3E1ET42      ---------LSPD---AEAYRILRTNIE--FN-RRSADANAITIVSGGAGEGKSTTLVNL
A0A2A2YDW8      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGAAGEGKSTTLVNL
A0A352XLN9      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGAAGEGKSTTLVNL
A0A3D0YP62      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTLCNL
A0A3D3DV47      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTLCNL
A0A2E5XJ49      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNAITIVSGGAGEGKSTTLVNL
A0A2E6SBY8      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNAITIVSGGAGEGKSTTLVNL
A0A2E5QMS4      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNAITIVSGGAGEGKSTTLVNL
A0A2E7YXQ3      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNAITIVSGGAGEGKSTTLVNL
A0A2E3H787      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITVVSGGAGEGKSTTLVNL
A0A2E7AGN1      ---------MSPD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTLVNL
A0A2E7AKY7      ---------MSPD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTLVNL
A0A3D4CU34      ---------MSPD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTLVNL
A0A2E8M146      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTLVNL
A0A355S8S2      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTLVNL
A0A2D6DVN8      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNL
A0A3C1W2R2      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNL
A0A2E3NAY6      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTLVNL
A0A2E3II01      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNL
A0A368B8C5      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNL
A0A3R7RBB5      ---------MSPD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNL
A0A2A2QX62      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTLVNL
A0A4Q3BWH6      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNL
A0A3N5WCF1      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNL
A0A4Q3C1K5      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNL
A0A2G4G428      ----------EKDVVAVEAVRTIYSSMR--VN-PASMSSHVFLITSTRPSEGKTFVATNL
A0A139TV24      -----------EHSVMAEYFHIMCHNVDSMLP-FSEHQGHVILLASTTPGEGKTFISANL
A0A2N8HT11      -----------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFISANL
R7DS70          -----------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFISANL
A0A2N8HNL6      -----------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFISANL
A0A146GCJ0      LKKHPLIFVEDPSSMQAEAIRTLRTSIS--LL-GKQDDRKTFLFASAIPQEGKSFTSLNF
A0A2T6D6H8      AKRHPLVFIDDPASLQAEAIRTLRTSLS--LL-GKQETRRTFLFASSIPEEGKTFTSLNF
A0A5C9DC49      ---------QSLC---AEAFRSMRASLA--LL-GREEDRKVVFFTSAVPSEGKSFCCVNY
A0A139TUL1      -----------SRSFMEECFHILRNNTELLLLPNPEKASRVVFLTSTRTGEGKTFTALNL
A0A2N8HCB0      -----------GRSLMEECFHILRNNAELMLLPNPEEASRVLFMTSTRAGEGKTFTALNL
A0A2N8HP04      -----------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNL
A0A2N8HRJ0      -----------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNL
A0A366HAG0      ---------ITPD---AEAYRILRTNLE--FN-RRDPNANCISVASGSPGEGKSTTMVNL
A0A3M1I8A3      ---------QSNA---SESIRSIRAAVA--LG-DHGEKLRVLTVTSTIPSEGKSIIAANL
A0A4V0XS84      ---------TSIS---SEGFRTLRAAIS--LT-QQPENLRTIVVTSTIPSEGKSLVASNY
A0A0R2XQ77      ---------DRHV---TESFRSIHSALR--LS-DESRHAKVLVTTSTVPGEGKSFISSNL
A0A2E9IN28      ---------DRHV---TETFRTIHSALK--LN-DESKNAKIILTTSTVPSEGKSFVSSNL
D5ENH7          ---------DRHV---TETFRSIHSAMK--LN-DESKNAKIIVTTSTVPSEGKSFVSSNL
A0A351WE84      ---------ESPH---GEPYRVLRTNMQ--FS-NKGIHGGAFAVISGGVGEGKSTTLFNL
A0A1V5QDZ6      ---------DSPH---AEAYRVLKTNLQ--FA-NKGTLGGAFALVSGGVGEGKSTTLFNL
A0A4Y8P964      ---------ESLI---SNAYRQIRTLLH--YA-IPNRKPQLIALTSTYPSEGKSSTVVNL
A0A3D4HF88      ---------DRRV---TEAFRSVHSALN--LN-EISKNAQIILMTSTVPSEGKSFVSTNL
A0A351MR11      ---------DKMA---IESLRAIHSVMK--IN-PSAANAKVLLTTSTRPGEGKTFVTTNI
A0A5B5WI95      -----------EQSVMAECFHILRNNVDSLLP-RPDEGGHVIMLTSTTPGEGKTFTSANL
A0A2N8I9W1      -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
A0A4Q5IH27      -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
A0A2N8IBZ6      -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
A0A2N8IJW9      -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
R6J100          -----------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANL
A0A1V6J089      ---------SSGQ---GEAYRSLRTSMA--LL-GREDNKKIFAVISGGVGEGKSTTLFNL
A0A3C1BZR1      ---------SSGQ---GEAYRALRTSLA--LL-AREGKQKIFTVISGGVGEGKSTTLFNL
A0A1H6KPB7      ---------SSPD---AEAYRILRTNIE--LK-RKDTNVVTLALVSGNAGEGKTTTLCNL
A0A2E9ISN4      ---------KGTNQIATETYRRIRLNLL--KQ-FGQDENISFTVTSSQSGDGKTFNVANI
B9XAX1          ---------GSIC---SEAFRTLRTTTG--IL-GHEEGKRITLFTSADPNEGKTFFSLNH
A0A5R8KKM9      ---------LNPD---AEAYRILRTNIE--FN-RKRPDANVISVVSGGSSEGKSTTMVNL
A0A139TS01      ---------LGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A3E1EJT7      ---------DPAI---VEAFLSLYSNLR--IN-DESRNARLILVTSTLPSEGKSFITTNL
A0A317ZP96      ---------DRHV---TETFRTIHSALK--LN-DESKNAKVIITTSTVPGEGKSFISSNM
A0A2D5WGA5      ---------ESPH---AEAYRVLRTNIL--FAGRKDESQTTFSVVSGGAGEGKTTTMFNL
A0A2E7SSH2      ---------ESPH---AEAYRVLRTNIL--FAGRQSEDQTTFSVVSGGAGEGKTTTMFNL
A0A349GXM8      ---------STGA---IEAYRALRTSVL--AE-LAKKHEKILMITSADSREGKTLTALNL
A0A4P5YP61      ---------KSIG---AEAIRTLRTSLS--ML-GKAENRRVYLFTSAIPAEGKTFCSLNY
A0A5R1Q5N3      ---------ESFV---SNAFRQIRTLLH--YA-IPNRKPQLIAITSTYPSEGKSSTIVNL
I0JYY7          ---------ESFV---SNAFRQIRTLLH--YA-IPNRKPQLIAITSTYPSEGKSSTIVNL
A0A4R7S1J2      ---------HSPV---AESFRSLRVMAN--LL-GKEEDRRVFVVTSALPSEGKTFCSCNY
A0A2A2XV69      ---------DNPD---AEAYRIMRTNIE--FN-RKNPASNSITIVSGGPGEGKSTTLNNL
A0A651H7X9      ---------DRQA---VEAFRTLHSSLK--LH-DESKNAQALLITSTTPGEGKSFTATNL
A0A4Y8P842      ---------ESEI---SNGFRSIRTLLH--YT-IPGRRPQVITITSTQESEGKSGTTVNL
B3DZK9          ---------ESEV---SNGFRSIRTLLH--YT-IAGRRPQVITVTSTLESEGKSGTTVNL
A0A5E6MPC4      ---------DSAV---SNSFRQIRTLLH--YS-LPDRRPQVMLITSCQMGEGKTSTTVNT
A0A4V1SB02      ---------NSSQ---AEAYRTLRASLS--LL-GEESQRRVLLVTSAVPAEGKTFTATNL
A0A3C1VB86      ---------NSPN---AEVFRTLRATLS--ML-GRENDRKTYLFTSSLPGEGKTFTSVNY
A0A146G2Q9      ---------DNAD---AEAYRILRTNIE--FN-RKNPDANTITMISGGAGEGKSTTMSNL
A0A2T6D3Y2      ---------ENAD---AEAYRILRTNIE--FN-RKNPDANTITMISGGAGEGKSTTMSNL
A0A2V2SDV4      ---------ESPH---AEAYRVLRTNLL--FS-RKDDKLNTVAIVSAGAGEGKSTTVFNL
A0A2V5PK75      ---------DSPH---AEAYRVLRTNLL--FS-RKDDKLNSVAVVSAGAGEGKSTTVFNL
A0A1V6DME1      ---------ESPH---AEAYRVLRTNLL--FS-RKDDKLNSIAVVSAGAGEGKTTTVFNL
A0A3D3DIJ3      ---------ESPH---AEAYRVLRTNLL--FS-RKDDKLNTIAIVSAGAGEGKSTTVFNL
A0A2D5VY59      ---------DSPH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTIFNL
A0A2D8UZZ4      ---------DSPH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTIFNL
A0A353DV86      ---------DSPH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTIFNL
A0A2E5EPT8      ---------DTPH---AEPYRVLRTNIL--FT-NKKPNANTITVVSGGAGEGKSTTVLNL
A0A5C9DS93      ---------DSPH---AEAYRVLRTNVL--FT-RKDEHANAITVVSGGAGEGKSTTVLNL
A0A350EWA4      ---------DSPH---AEAYRVLRTNIL--FS-RKSEDQNTITVVSGGAGEGKSTTLFNL
A0A5B5WZ91      ---------LGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A2N8HD92      ---------LGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A2N8HIT2      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A354EBD3      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A355VEB2      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A2N8IMT3      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
R6K1U5          ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTLCNL
A0A2N8IWC2      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A2N8I441      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTLCNL
A0A2N8I3A6      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A410SCC4      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTLCNL
A0A3R5VEW0      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A411SSG2      ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
B2UKW3          ---------MGPD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNL
A0A1M6RLZ4      ---------ASPD---AEAYRILRTNIE--FN-RKNPDDNSITVVSGGAGEGKSTTLVNL
A0A354T7G8      ---------FNPD---AEAYRILRTNIE--FN-RKSPDANCFSVVSGGAGEGKSTTMVNL
A0A2S7U4L6      ---------ASPD---AEAYRILRTNIE--FN-RPSQDDNAITVVSGGAGEGKSTTLVNL
A0A512MBZ2      ---------FNPD---AEAYRILRTNIE--FN-RRNPEANCITVTSGGAGEGKSTTLCNL
A0A2E8MEZ0      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTLVNL
A0A4Q2YKS3      ---------MSPD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNL
A0A2E3EC33      ---------LSPD---AEAYRILRTNIE--FN-RKTADANSMTIVSGGAGEGKSTTLVNL
A0A2E4GN01      ---------LSPD---AEAYRILRTNIE--FN-RKTSDANSMTIVSGGAGEGKSTTLVNL
A0A1Z8XU55      ---------LSPD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTLVNL
A0A2E1RQR9      ---------LSPD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTLVNL
A0A2E3ISQ4      ---------LSPD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTLVNL
A0A2D6W6F4      ---------LSPD---AEAYRILRTNIE--FN-RKNADANAITLVSGGAGEGKSTTLVNL
A0A2D8Z5A8      ---------LSPD---AEAYRILRTNIE--FN-RKNADANAITLVSGGAGEGKSTTLVNL
                                 :    .                      .     **:    . 

A0A2A2XVF1      AVVFAQQGLKTLLIDADLRRPSLHKALLTVDTLPN-------GLTDYFSG-NSRLASVII
A0A2V5UHJ2      AIVFAQLGIRVLIIDADLRRPRCHALL--RMENLA-------GLSDLLAG-QIELQSAIR
A0A2V5PST3      GIALAQDSFKVLIIDADLRRGSCHSRL--GIGNHR-------GLSNLLAG-NVSIEEVVQ
A0A2V5PXM3      AISLAQQGLRTLIIDCDLRRPMVENTLQNNNQRGF-------GLTDYLTG-QKDFKAVVH
A0A139SU05      AASFARHGKRTLLVDCDLRRPMLHRRF--DLANTS-------GIIAFYEA-DGDLDCDLP
A0A1D8AZK8      AASFARHGKRVLIIDCDMRRPMLHRHF--KLTNEV-------GLIAWFEA-GAKIPADPF
A0A1V5QB01      AVSLAQAGARILMVDSDMRRGELHKFF--GLEGGR-------GLSDLLAG-QAKPEAVIQ
A0A139SPN4      AASFARHGKRTLLVDCDLRRPMLHRRF--DLANTS-------GLIPFYES-GASLDTDLS
A0A1V6E7N1      AASFARHGRRTLLIDCDLRRPMMHRHF--KQSNQA-------GIITWFEK-GADLSVEPQ
A0A2D9MYT1      AIVTAQTGAKTLLVDCDLRRPSVHKAF--QIQSPK-------GLSSYLLGKVDTIDSIVH
A0A258ANJ7      AVSLASQGFRTLLIDMDLRHSQLAQVF--GIPNTRK------GVVDLLLE-EVSFAEVCL
A0A139TLN4      ALSLAVAGKKVLLMDMDLRKGTLSSLL--GGEGKP-------GTGDLDRVGEGGWRSLLE
A0A290QGD9      ALTFAAHGEKVVVIDCDLRRPNIHKSF--RIANQR-------GVIDLCGG-DTRVEDVVV
A0A1D8AS58      ALTFAAHGEKVVVIDCDLRKPNIHKSF--RLENIK-------GVIDVCAG-THTIDQVVI
I6AQC1          ALTFAAHGDRVVVLDCDLRKPNIHKSF--RRENLK-------GVIDVCAG-SATIDDVVM
W0ITH7          ALTFAAHGDRVVVVDCDLRKPNIHKSF--RRENLK-------GVIDVCAG-SATIDDVVM
A0A1G3ZFT0      AYLLATADKRILLVDADLRKGTVHKYF--NLDPSP-------GFAELIQG-SVNIEEALK
A0A1Z8ZMT6      ALAYAKQGTRTLLIDFDLRKPAVHKIFNEERAARP-------GIVNVLNG-TAAANQAIT
A0A2E8MCT7      ALAYAKQGTRTLLVDFDLRKPAVHKIFNEERAARP-------GIVNVLNG-TAAANQAIT
A0A290Q2Z2      ARSMGAAGERVLLVDSDLRRPTQHQLA--ALPKEP-------GLADLLQG-KATLEKVTQ
A0A2A2RGK2      AVTLAQQGFNTLFIDADLRKPGGSIVF-FGENRKP-------GLSEVLMR-TCTMKNAIV
A0A2A2XXF7      AVTLAQQGFNTLFIDADLRKPGGSIVF-YGENRKP-------GLSELLMR-SCAMKNAVM
A0A2A2R5D6      AYVCAQSGQSVLLVDADLRRPTVHTIL--GIENEA-------GISEAMRG-LGEAHQYIR
A0A1J4XH17      GLTFAANDEKVLIIDADLRMPSIGSSL--QLDKKK-------GILQYCEE-GATLDDIVN
A0A3C1VJ32      STVFAQAGNRVLIVDSDLRRPTLHKLF--KVANNL-------GLTNYLLK-QNTVVEVVQ
A0A2N9NTX7      ACVFAQGSQRVLIVDSDLRRPTLHRML--RVSNSI-------GLTNYLLK-QNTLEEVIQ
B9XK55          ATVFAQSGHRVVMVDSDLRRPTLHKLV--NVSNTI-------GLTNYLLK-QNTLEEVIQ
A0A4P5YMI6      AVIFAHNGHKVLLVDTDIRRPSLHKRL--NVSNSI-------GVTNVLLK-QCPVEEAIQ
A0A2E6T482      AVVFAQQGDRCLIVDSDLRRPSMHRYL--QVSNNI-------GLTNYLLG-QVXIDEVIQ
A0A3C0DQZ7      AVVFAQQGDRCLIVDSDLRRPSMHRYL--QVSNNI-------GLTNYLLG-QVTIDEVIQ
A0A1Z9CBK5      AVIFAQMGDRILVVDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTLDEVIQ
A0A2D6ZI96      AVIFAQMGDRILVVDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTLDEVIQ
A0A358KGZ3      AVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLG-QNTLDEVIQ
A0A2E9ZQX4      AVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLG-QNTLDEVIQ
A0A3D5JZU0      AVVFAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLG-QNTLDEVIQ
A0A2E6HCR0      AVIFAQLGDRILVVDSDLRRPSMHRYF--KVTNSI-------GLTNLLLG-QNTLDEVIQ
A0A1Z8WN04      AVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTVEEVVQ
A0A2D7L1N4      AVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTVEEVVQ
A0A2E2R937      AVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTVEEVVQ
A0A520QQY4      AVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLG-QNTVEEVVQ
A0A2D5MR66      AVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLG-QNTVEEVVQ
A0A2E0PDQ1      AVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLG-QNTVEEVVQ
A0A2E2ZZP9      AVIFAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLG-QNTVEEVVQ
A0A2A2RGF2      ATIFAQNGDKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLG-QNKLEEVVQ
A0A2G4I5Y6      ATIFAQNGDKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLG-QNTLEEVIQ
A0A3M1I883      ATVFAQNGERVLLVDSDLRRPSLHKFI--GVSNSI-------GLTNYLMK-QNTLEEVIQ
A0A1V6JZ45      ATVFAQNGQRVLVVDSDLRRPSLHKFL--AVSNSI-------GLTNYLMK-QNTLEEVIQ
A0A520RRW5      ATVFAQNGSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLA-TKSLEEVVQ
A0A356NPK0      ATVFAQNDSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLA-TKSLEEVVQ
A0A2D7B5P5      ATVFAQNXSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLA-TKSLEEVVQ
A0A3D3XGB5      ATVFAQNGSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLA-TKSLEEVVQ
A0A2V6F8A1      GVVFAQNGQRVLLVDSDLRRPSLHKLL--NVSNAV-------GLTNYLLR-QNTLEQVIQ
A0A2V5TNH4      AVVFAQNGQRALLVDSDLRRPSLHKLL--NVSNSV-------GLTSYLLR-QNTLEEVIQ
A0A2V5X5Q6      AVVFAQNGQRALLVDSDLRRPSLHKLL--NVSNSV-------GLTNYLLR-QNTLEEVIQ
A0A2V2DJ66      AFTCALNGEKCIIIDADLRLPALAKVL--GISASK-------GLVSYIEE-GDSLDDVII
R7L5A9          AFTYALHGEKTIIIDADLRLPAMAKVL--GITAKD-------GLIGHIEE-GKPLEDAII
A0A4P5QM05      AYIYAKGGANVLVVDADLRRPSQHRFF--NVDNSI-------GLVDYLHG-RKTLDEITH
A0A4Q3C001      AYTCAKGGYNVLVVDADLRRPTQHRIF--EVDNNY-------GLTDYLTG-KASIDEITR
B4DB23          AYTCAKGGYNVLVVDADLRRASQHHFF--DVDNSF-------GLTDYLLG-RAEIDEIIK
A0A2V5URB2      AIMFARLGNRVLLMDADLRRPTCHKAL--KVQGAT-------GLADYLAG-QEELDKVIK
A0A5R8KA81      AISSANLGKRTLLIDADLRRPMVNELF-FKGRVSV-------GLADVLQG-KVTLEEALH
A0A5B5WU87      ALSLAVAGKKVLLMDMDLRKGTLSSLL--GGQGKP-------GIGNLDRSGEGGWRSLVE
R7DZW0          ALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRSLVE
A0A2N8HID1      ALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRSLVE
A0A2N8HS06      ALSLAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRSLVE
A0A3R5R2M8      AAAFAKAGRKVLLIDGDLRKRSLSRQL--GGYGRR-------GLTSILLNRLQTAALPIR
A0A411SUQ6      AAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQTTDTTGIIR
A0A2N8HZF2      AAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQQNPDTTGIIR
A0A354E720      AAAFAYAGKKVLLIDGDLRKSSLTRRL--GGSGRK-------GLTSILLRQNPDTAGVIR
B2UPB6          AAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQTTDTTGIIR
A0A2A2XXW5      AIVTSQTGLKTLLVDADLRRPSVHKAF--QLQSPV-------GLSAYLSGRTDNFSEFVH
A0A2V6JLK8      AFICAQGGYSTLIVDADLRRPVQHLLF--DLSNEI-------GLTNYLTT-DMDLDQAIL
A0A2W5Z1A5      GYICAQGGYSTLIVDADLRRPVQHMHF--DLDNKI-------GLSNYLTS-NMRIEEVIR
A0A2V6EA09      AFVCAQGGYSTLIVDADLRRPIQHEFF--GVSNTA-------GLTSYLTT-EMPLEKVIL
A0A2V6GQI7      AFVCAQGGYSTLIVDADLRRPIQHEFF--GVSNTA-------GLTSYLTT-EMPLEKVIL
A0A3C1HEJ2      AYSLAQQGMRTLLIDCDLRCPTVEEYLLGRNTESP-------GVSDYLSG-KKDFSDIIQ
A0A522ULD9      AYICAQQGDKVLIVDSDLRRPTQHTIL--GLSNRL-------GLTNVLMR-DVPIEETIK
A0A1V6JU76      AVVVAQTGLRTVLVDADLRRPSLHKAF--QLHSPM-------GLTAYLTEQTNRVDDVIQ
A0A1Q6UHJ9      ALMCAMHGEKTIIIDADLRLPAMAKVL--GIESRD-------GIVGYVED-GRPLEDCVI
A0A2V2BXR0      ALMCAMHGEKTIIIDADLRLPAMAKVL--GIESRD-------GIVGYVED-GRPLEDCVI
A0A2D8V0G3      AIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GLSAYLTGQITDPSEITQ
A0A348S017      AIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ
A0A3C1UUV7      AIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ
A0A350I3V2      AIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ
A0A520RGV5      AIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ
A0A3D3XF90      AIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ
A0A2D7B522      AIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ
A0A356NIC2      AIVTAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ
A0A2N8HDG3      ALAFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFSVIR
A0A2U8DZK4      ARAMGAAGERVLLIDADLRRPTQHRLF--NVAKTP-------GLADLLQS-KVTLDQCRS
A0A2T6DFL8      TRLMGEMGDRVLLIDADLRRPTQHRIA--ERPRSP-------GLSDLLTA-QKTLDEVIQ
A0A1D8AWD4      ALCMAAAGEKVLLIDSDVRRPTQHKLA--GLSRDP-------GLTDIVLN-KVPWTAAVV
A0A4Q1C9S2      ALCMAAAGEKVLLIDSDVRRPTQHKLA--TLPREP-------GLTDIVLN-KVGWEAAVQ
A0A178IH18      ARAMGEAGARVLLIDSDLRRPTQHQLT--GAAKEP-------GLADLLQG-KATLDDVTR
A0A2T6DT99      ARAMAKAGERVLLIDSDLRRPTQHQLA--GLRKEP-------GLAEVLQG-KATLQSVTQ
A0A1G3ZT33      VRVMAAAGERVLLVDSDVRRPAQHRLM--DQTREP-------GLIDLLLN-KATLESVVR
A0A3E1E2T2      VRVMAAGGERVILIDSDVRRPTQHHLA--DRPREP-------GLSEFLLN-RKTLDEVIQ
B1ZMW1          ARLAAAAGERVVLIDSDFRRPAQHRLA--ERPREP-------GLSDWLMN-RQPLETIVQ
A0A3D1TI55      AYVCAQLGDKVLLVDSDLRRPALHKIL--GMSNDF-------GLTNVLMR-DVPIEETIK
A0A3R8IT45      ALTFAAHGDKVVIVDCDLRKPNIHKSF--RRENLK-------GVIDVCAG-SATIDDVVM
A0A1H1MGC9      ALTFAAHGEKVVIVDCDLRKPNIHKSF--RLENLK-------GVIDVCAG-TQTVDQVLC
A0A2A2PYE8      ALTFAAHGERVVVIDCDLRKPNIHKSF--RLENLK-------GVIDICAG-KATIADVAI
A0A2T6CN73      ALTFAAHGEKVIVVDCDLRKPNIHKSF--RIENIR-------GVIDVCSG-KATLDEVIV
A0A3E1ET42      AYICAQGGYNTLMIDGDLRRPKLHTFF--DINNSV-------GLTNYLTT-ALMLEDVIL
A0A2A2YDW8      AYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLSNYLTT-ELMLEDVIL
A0A352XLN9      AYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLSNYLTT-ELMLEDVIL
A0A3D0YP62      AYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-DLLLEDVIL
A0A3D3DV47      AYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-DLLLEDVIL
A0A2E5XJ49      AYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-DLMLEDVIL
A0A2E6SBY8      AYVCAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-DLMLEDVIL
A0A2E5QMS4      AYVCAQGGYTTLMIDSDLRRPTLHTFF--DINNSV-------GLTNYLTT-DLMLEDVIL
A0A2E7YXQ3      AYVCAQGGYTTLMIDSDLRRPTLHTFF--DINNSV-------GLTNYLTT-DLMLEDVIL
A0A2E3H787      AYVCAQGGYTTLMIDADLRRPQLHTFF--DINNSV-------GLTNYLTT-DLMLEDVIL
A0A2E7AGN1      AYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A2E7AKY7      AYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A3D4CU34      AYVCAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A2E8M146      AYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A355S8S2      AYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A2D6DVN8      AYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A3C1W2R2      AYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A2E3NAY6      AYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A2E3II01      AYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A368B8C5      AYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A3R7RBB5      AYVCAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTT-DLMLEDVIL
A0A2A2QX62      AYICAQGGYTTLMIDADLRRPRLHTFF--EINNSV-------GLTNYLTT-ELMLEDVIL
A0A4Q3BWH6      AYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-ELMLEDVIL
A0A3N5WCF1      AYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-ELMLEDVIL
A0A4Q3C1K5      AYICAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-ELMLEDVIL
A0A2G4G428      ALGFSQHGERVLVIDADLRLPNVGPSL--GLTGTE-------GISRWFND-ESTIDESIV
A0A139TV24      AQAFSKIGKRVLLIDGDLRKTSLSSQL--GGKGRK-------GLSTILLNKVSDLSSVIH
A0A2N8HT11      AMSFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFSVIR
R7DS70          AMSFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFSVIR
A0A2N8HNL6      AISFANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFSVIR
A0A146GCJ0      AHALAQKGLRTVVIDADLRRPRLKDDLLPDAGDID-------GLTDYLSG-GAPLDQVVR
A0A2T6D6H8      AHSLAQQGLRTVIIDADLRKPRLKADLLPEEGDIS-------GLTNYLSG-TATLTEVVK
A0A5C9DC49      AVAYAQQGRRTLVIDFDLRKPTLAESF--GLKEDLA------GVSDVLLG-KATLDQSVQ
A0A139TUL1      AAAYAQTGKKVLLIDGDLRKASLSAFC--VGKNSR-------GLAHLLMNPLASPDSVLQ
A0A2N8HCB0      AAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDSVLQ
A0A2N8HP04      AAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDSVLQ
A0A2N8HRJ0      AAAYAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDSVLQ
A0A366HAG0      ATICAQGGYNTLIIDADMRRPRQHTFF--NVPHTF-------GLSNYLSS-NVPLEEVVV
A0A3M1I8A3      AIAMAQTGYRTLLVDADMRRPRLHKAF--QLHNPV-------GLPAYLHG-KTDQFEELV
A0A4V0XS84      AIVSAQSGLRTLLVDADLRRPSVHKAF--GIENNI-------GLSAYLMD-QVTDPTEII
A0A0R2XQ77      ALTFANHGEKTLLLDGDLRLPNVARSL--QLQNDF-------GLLDHIEK-GVALDEVIL
A0A2E9IN28      SLTFANHGEKTLLIDCDLRLPNVARSL--QLENDF-------GVLDHIDK-GVDLDEVII
D5ENH7          ALTFANHGEKTLLLDADLRLPNVAASM--QLENER-------GVLDHVEK-GMPIEDVTI
A0A351WE84      AYTCAQLGYKTIVVDSDLRRPVQHSIL--SMSNRI-------GLTNVLMK-DSTLEECVK
A0A1V5QDZ6      AYVCAQLGDKVLIVDSDLRRPVQHRIL--GVSNRF-------GLTNVLMR-DVPIEETIK
A0A4Y8P964      ATVLGQQG-TVLIIDGDLRRPMLHKVL--GLRPRP-------GLSEILTG-QVNVEEAIQ
A0A3D4HF88      AYTYASHGERVVLIDCDLRMPNVAKSM--NLSNEK-------GLQQCLKD-GSRPEDVVH
A0A351MR11      ALTFAQHGERVLVVDADLRLPNVAPSM--GIETDN-------GISKYFNN-EITLDEAIL
A0A5B5WI95      AATFAKAGRKVLLIDGDLRKFSLTRQM--GGHGRR-------GLTSILLN-QVDDPFHII
A0A2N8I9W1      AAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ-QSSDTTGII
A0A4Q5IH27      AAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ-QSSDTTGII
A0A2N8IBZ6      AAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ-QSSDTTGII
A0A2N8IJW9      AAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQ-QSSDTTGII
R6J100          AAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQ-QSSDTTGII
A0A1V6J089      AYVCAEQGSKVLVIDSDLRRPVQHKMV--GLANRA-------GLVNVLTG-ELKPEDVIQ
A0A3C1BZR1      AYVCAEQGSKVLIIDSDLRRPVQHKMV--GLANRT-------GMVNVLTG-DLKAEDVIQ
A0A1H6KPB7      AYVFAQGGFSTLMIDADLRRSKLAEYN--DVECEY-------GLSNFLTS-DLALQDVIL
A0A2E9ISN4      ALPFAWVGKRVLLIDADLRLGNLTRRL---LGRELRH-----GLADWLAD-DSCDANIHI
B9XAX1          AICQAQGGKLTLLIDLDLRRPSVGESF-SHPPGTP-------GVTNYLLG-KESLSTLVL
A0A5R8KKM9      ATVCAQGGYNTLIIDGDLRRPRMHTFF--DVTNDV-------GLTTYLSS-PMELEEVVL
A0A139TS01      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEA-------GLTSYLLE-DYPLEEVIF
A0A3E1EJT7      GLTFASQGQRTVIVDCDLRKPNVERSF--RLQTTA-------GVISYCLQ-GSALDDIIV
A0A317ZP96      ALTFANHGEKTLLLDGDLRLPNVARSL--QLENEK-------GLLDHVEQ-GKDLDDVIV
A0A2D5WGA5      AVVFAQQGDRVLIVDSDLRRPSMHRYL--KVTNNT-------GLTNYLLG-QNTIEEVIQ
A0A2E7SSH2      AVVFAQMGDRILVVDSDLRRPSMHRYF--KVTNNI-------GLTNLLLG-QNTLDEVIQ
A0A349GXM8      SIMVVQMGKRVLLVDMDLRRGRIHRSL--GLDREP-------GVTDVLRH-GKSLREVIQ
A0A4P5YP61      AVSLAQQGSKTLLIDGDLRRPAVEKAISGKDKKAV-------GVTDYILG-QKTLKEIVQ
A0A5R1Q5N3      ATVLGQQG-TVLIIDGDLRKPSLHKSL--GLRPRP-------GLSEILTG-QVNIEEALQ
I0JYY7          ATVLGQQG-TVLIIDGDLRKPSLHKSL--GLRPRP-------GLSEILTG-QVNIEEALQ
A0A4R7S1J2      ALSLAQQGLKTLLIDADLRRPKVSASV-YGEDRKP-------GLTEYLLG-QATFTDVIH
A0A2A2XV69      AYTFAKGGYTTLVVDADLRRPSQHRIF--GIDNKN-------GLSDLLTK-QLSLEQVVH
A0A651H7X9      ALTYAQHGEKTLLIDCDLRKPNIHQGL--QLENDT-------GLIDFVRG-NANFDALAK
A0A4Y8P842      ATVLGQQG-TVLIIDADLRRPAIHKNL--GLRPRP-------GLSEILTG-QAQVEEAVQ
B3DZK9          ATVLGQQG-TVLVIDADLRRPSIHKIL--GLRPRP-------GLSEILTG-QAQVEEAVQ
A0A5E6MPC4      ATVLGQQG-TVLLIDADLRRPNLHKIL--GLRPHP-------GLSELLTN-QASLGNAVQ
A0A4V1SB02      AAALATQGLSTLLIDADLRRPALSATM---LERDVRQNEEFRGLTDVLSG-LCTPDEAIR
A0A3C1VB86      AVSLAQQGLRTLLVDIDLRRPMIEKFFLGKTSRLP-------GVTDYFLG-RKKFDELCQ
A0A146G2Q9      ASIFASGGYSTLIVDADLRRPSQHRIF--GVENEV-------GLTDFLTT-DVHLEEVVN
A0A2T6D3Y2      ASIFASGGYSTLIVDADLRRPSQHRIF--GVENEV-------GLTDFLTT-DVHLEEVVN
A0A2V2SDV4      AAVFAQGGQRVLIVDSDLRRPTLHKML--RVSNHI-------GLTNYLLK-QNTVEEVIQ
A0A2V5PK75      ACVFAQSRQRVLIVDSDLRRPTLHKML--RVPNDL-------GLTNYLLK-QNSLEDVIR
A0A1V6DME1      ATVFAQGNQRVIIVDSDLRRPTLHKRF--GVSNSI-------GLTNYLLK-QNKLEEVIQ
A0A3D3DIJ3      AAVFAQSGQRTIIVDSDLRRPTLHKML--RVTNAI-------GLTNYLLR-QNTLEEVIQ
A0A2D5VY59      ATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLG-QKSVEEVIQ
A0A2D8UZZ4      ATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLG-QKSVEEVIQ
A0A353DV86      ATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLG-QKSVEEVIQ
A0A2E5EPT8      ATIFAQNGNRVLLVDSDLRRPSLHKRL--DIENSP-------GLTDYLLG-QGKLEDVIQ
A0A5C9DS93      ATIFAQNGNKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLG-QNKLEEVIQ
A0A350EWA4      ACIFAQNGARVLIVDSDLRRPSIHKIL--RVSNSV-------GLTNYLLG-QQPIEEVVQ
A0A5B5WZ91      AYICAQGGYATLMIDGDLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEDVIF
A0A2N8HD92      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A2N8HIT2      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A354EBD3      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEL-------GLTSYLLE-DYPLEEVIF
A0A355VEB2      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEL-------GLTSYLLE-DYPLEEVIF
A0A2N8IMT3      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
R6K1U5          AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A2N8IWC2      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A2N8I441      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A2N8I3A6      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A410SCC4      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A3R5VEW0      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A411SSG2      AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEA-------GLTSYLLE-DYPLEEVIF
B2UKW3          AYICAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLE-DYPLEEVIF
A0A1M6RLZ4      AYICAQGGYSTLMIDADLRRPKLHTFF--DINNTV-------GLTNYLTT-DLMLEDVIL
A0A354T7G8      AYVCAQGGYNVLLIDADLRRPSLHHHF--DVSHAT-------GLTNYLTT-DISLEDVVI
A0A2S7U4L6      AYICAQGGYSTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTT-TLPLEDVVL
A0A512MBZ2      ATVCAQGGYSVLLIDADLRRPSLHRLF--DVSNAN-------GLTNYLTM-NIRLEDVVV
A0A2E8MEZ0      AYVCSQGGYTTLMVDADLRRPRLHSFF--DINNSV-------GLTNYLTT-DLALEDVIL
A0A4Q2YKS3      AYICAQGGYTTLMIDGDLRRPRLHTFF--DINNAV-------GLTNYLTT-ELALEDVIL
A0A2E3EC33      AYVCAQGGYNTLMIDADLRRPQLHTFF--NXNNSV-------GLTNYLTT-DLALEDVIL
A0A2E4GN01      AYVCAQGGYNTLMIDGDXRRPQLHTFF--NINNSV-------GLTNYLTT-DXALEDVIL
A0A1Z8XU55      AYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLQLEDVIL
A0A2E1RQR9      AYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLQLEDVIL
A0A2E3ISQ4      AYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLKLEDVIL
A0A2D6W6F4      AYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLXLEDVIL
A0A2D8Z5A8      AYVCAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTT-DLKLEDVIL
                           :.:* * *                       *                 

A0A2A2XVF1      -PTEI------E----NLALLPAGRRA-PNPAELLSSADIPKLFA-QLLKRYDRIVIDSA
A0A2V5UHJ2      -PTSA------E----NLSFISAGALP-PNPAELLGSKKMHDLLE-QLREQFEFIFVDSS
A0A2V5PST3      -RTSI------A----GLSVLTRGACP-PNPTELLRMRKMKEILT-GLGGSFDFILIDSS
A0A2V5PXM3      -ASGS------E----NFFYIPAGSHA-PNPAELLARTGIDGLID-EALLHFERVIIDSA
A0A139SU05      NDSTLGIVKLSE----NLSLLRSGGRS-RRPTELLESPFFGDLLQ-KLGHYYDLIIIDSP
A0A1D8AZK8      TDAALGLAKVDE----NLYLLRSGGRS-KSPTELLENPVFGQFIE-AMKQHFDLIVVDSP
A0A1V5QB01      -RTGL------P----NLDLVATGPFP-PNPAELVLRPEFKAFMD-HARRQYDRILFDCP
A0A139SPN4      TDPTLGIVKLNE----NLSLLRSGGRS-RRPTELLESDLFGDLLK-KLGRYYDLIVIDSP
A0A1V6E7N1      KNPDLGIISLGE----NLSLLCSGGRS-KTPSSLLETPAFTQLLE-RLKQQYELVVVDSP
A0A2D9MYT1      -QTEV------A----NLDIICCGAVP-NNPSELAGSQRMIDFVE-EVRXKYEKIVFDCP
A0A258ANJ7      -SGGI------A----HLAIMPAGKRV-ANPAELLSTCGVERLKEMAFSAGFDRIVIDTA
A0A139TLN4      KSSVS------D----HLDYLFAGTLP-DHPSRLLLHDRVRELMK-ELKEHYDFIFMDCV
A0A290QGD9      -KGPH------P----NLDIIPAGGRA-KNPTHVLNSAGFEHMIA-DLRTRYDRVFIDTP
A0A1D8AS58      -KGVH------P----NLDVIPAGGRA-KNPTQILNSRNFEHLLA-DLRKRYDRVFIDTP
I6AQC1          -RDVH------P----NLDVIATGGRA-KNPTQILNSKNFEIMIA-ELRKRYDRIFIDTP
W0ITH7          -RDVH------P----NLDVIATGGRA-KNPTQILNSKNFEIMIA-ELRKRYDRIFIDTP
A0A1G3ZFT0      -LTSH------H----NLTILPRGNYP-VDPAELLSSERCKELIS-LFSKQFDIILIDTA
A0A1Z8ZMT6      VYPGL------D----TLSVIYSGPKS-PNPGELLEPGRLRALIG-MFAANFDHIVIDSA
A0A2E8MCT7      VYPGL------D----TLSVIYSGPKS-PNPGELLEPGRLRDLVE-MFSSNFDHIVIDSA
A0A290Q2Z2      -RGVS------P----GLDFIPCGAVG-GFTLSLLYIDRLKALLA-ELRGRYDRVIFDAP
A0A2A2RGK2      -PTHI------D----NLQIMTAGGRA-PNPSELLTYENIDRVLK-EALSKYDRVVVDSA
A0A2A2XXF7      -PSHI------D----GLSILTAGGRA-PNPSELLTYENLERVMS-EALSKYDRIVVDSA
A0A2A2R5D6      -ATSV------P----NMHVITAGDMP-ASEMGAFSGLKLREILN-DLKLRYDIVLLDAP
A0A1J4XH17      -KNVY------S----NFDVITAGGKA-TNPTQIFLSPRFQQLLE-EAKSRYSKIIIDTP
A0A3C1VJ32      -TTSV------P----NLDFMASGKLP-SSSMGILGSAQMKELIA-ELKQRYDFIFFDSP
A0A2N9NTX7      -TTNL------P----SMDFLASGKLP-SSSLGILSSSQMRDLIN-ELKQRYDFVFFDSP
B9XK55          -TTRL------P----NLDFMASGKLP-SSSLGILSSAQMKDLIT-ELKQRYDYVFFDSP
A0A4P5YMI6      -TTPI------P----NLHFLPSGRLQ-SSSLGILNSPQMREFID-EMKRRYDFVFFDSP
A0A2E6T482      -TTQI------P----SLHFIPSGKLP-SSSMGILSSSKMREFVS-EMKSRYDYVFLDAP
A0A3C0DQZ7      -TTQI------P----SLHFIPSGKLP-SSSMGILSSSKMREFVS-EMKSRYDYVFLDAP
A0A1Z9CBK5      -TSDS------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAP
A0A2D6ZI96      -TSDS------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAP
A0A358KGZ3      -TSES------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAP
A0A2E9ZQX4      -TSES------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAP
A0A3D5JZU0      -TSES------T----NLHFIPSGKLP-SSSMGVLNSAKMKQFVA-EMKSRYDYVFFDAP
A0A2E6HCR0      -TTDI------P----NMHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKSRYDYVFFDAP
A0A1Z8WN04      -ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAP
A0A2D7L1N4      -ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAP
A0A2E2R937      -ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAP
A0A520QQY4      -ITDI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAP
A0A2D5MR66      -ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKGFVA-DMKSRYDYVFFDAP
A0A2E0PDQ1      -ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKGRYDYVFFDAP
A0A2E2ZZP9      -ITDI------P----NLHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKGRYDYVFFDAP
A0A2A2RGF2      -HSTL------A----NLHFLPSGRLP-SSALGILNSPQMKDFIK-EAKQRYDFVFFDAP
A0A2G4I5Y6      -HSPL------A----NLHFLPSGRLP-SSALGILNSPQMKDFIK-EAKRRYDFVFFDAP
A0A3M1I883      -TTSL------P----TLDFLPSGKLP-SSALGIINSPRMKELVD-EVRNRYDFVFFDSP
A0A1V6JZ45      -TTKL------P----MMDFLASGKLP-SSSLGILNSTRMKEFIK-DVQRRYDFVFFDSP
A0A520RRW5      -TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSP
A0A356NPK0      -TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSP
A0A2D7B5P5      -TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSP
A0A3D3XGB5      -TTKH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSP
A0A2V6F8A1      -TTSI------P----TLDFLPSGKLP-SSSLGILNSVQMKDFIK-EAKKRYDFVFFDSP
A0A2V5TNH4      -TTSI------P----TLDFLPSGKLP-SSSLGILNSAQMKDFIK-EAKRRYDFVFFDSP
A0A2V5X5Q6      -TTSI------P----TLDFLPSGKLP-SSSLGILNSTQMKDFIK-EAKRRYDFVFFDSP
A0A2V2DJ66      -KDYF------Q----NLDVLVCERRA-KNPSQMLNSEEFVSMIE-SFREKYDKVFIDSP
R7L5A9          -HDYF------P----NLDVLVCEKRA-KNPTQTLNSEEFAAMIE-KFRDTYDRIFIDSP
A0A4P5QM05      -PSRL------E----NLAIIPSGSLA-MEDVGILNGPRMTELIL-QLKKRYDVVFFDSP
A0A4Q3C001      -TTKI------D----NLSFIPSGQLP-SDAIGILNSQRMTDMMQ-KVKHQYDLVFFDSP
B4DB23          -TTKI------D----NLSFIPSGLLP-GDSVGILNSQRMTDLIA-KVKSQYDLVFFDSP
A0A2V5URB2      -LTSI------P----NLWILNGGSVP-PSPTELIGSKKMQDTLA-LLKESYDFIFIDSP
A0A5R8KA81      -VSNT------E----NLFILSAGTEI-RNPAELLASPALAEFFD-SLKGKFDRVVLDTA
A0A5B5WU87      KSSVS------D----HLDYLFAGTLP-DHPSRLLLHDRVRVLME-ELKEHYDFIFMDCV
R7DZW0          QSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCV
A0A2N8HID1      QSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCV
A0A2N8HS06      QSPVS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCV
A0A3R5R2M8      ---RI------EETGISFDFLGAGPAV-PNPVSLLSQPILGQMLE-HLKKQYDTVIIDAP
A0A411SUQ6      ---PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKKQYDAVIIDAP
A0A2N8HZF2      ---PL------GGNSRGMDILYTGPMV-PNPVILLSHPLLGHILG-ILKKQYDAVIIDAP
A0A354E720      ---PV------GEDTRGMDVLYTGPTV-PNPVTLLSHPLLGQILS-ILKKQYDAVIIDAP
B2UPB6          ---PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKKQYDAVIIDAP
A0A2A2XXW5      -TTEV------P----NLDVICCGAVP-PNPSELIGSNRMVRFLE-EASRRYDRVILDCP
A0A2V6JLK8      -PTNV------E----NLSILPSGILP-SDAVGILNSQRMSDTIA-QLKMRYDIVFFDSP
A0A2W5Z1A5      -PTSV------E----NLSLLPSGVIP-SDAVGILNSQKMSDLIA-ELKTRYDIIFFDSP
A0A2V6EA09      -PTAV------E----NLSILPSGVLP-ADAVGILNSQRMSDTIA-ELKSRYDLIFFDSP
A0A2V6GQI7      -PTAV------E----NLSILPSGVLP-ADAVGILNSQRMSDTIA-ELKSRYDLIFFDSP
A0A3C1HEJ2      -KSQT------E----NFCFIGAGTKS-PNPSELLAQPGFKQLLT-EALSHFDQVVIDSA
A0A522ULD9      -PTAI------P----NLHFLPSGKLP-KTSIGLLDSQRMRELVK-DLKARYDYVFFDSP
A0A1V6JU76      -TTEV------T----NLDVACCGQIR-SQPSELLGSQRMVQFMQ-ELSKRYDRVILDCP
A0A1Q6UHJ9      -KDYY------P----NLDVLPCEKRS-QNPTQALSSEEFISMIA-KFREQYDKVFIDSP
A0A2V2BXR0      -KDYY------P----NLDVLPCEKRS-QNPTQALSSEEFISMIA-KFREQYDKVFIDSP
A0A2D8V0G3      -TTEV------P----NLDLICCGAVP-NNPSELVGSKRMGELLD-SLRDRYDRIFVDCP
A0A348S017      -KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCP
A0A3C1UUV7      -KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCP
A0A350I3V2      -KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCP
A0A520RGV5      -KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCP
A0A3D3XF90      -KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCP
A0A2D7B522      -KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCP
A0A356NIC2      -KTEV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCP
A0A2N8HDG3      TLPEH------A----GVDILYAGPHV-PNPVTLLSLPELGTLIQ-MFKERYDAVIIDSP
A0A2U8DZK4      -RNIA------P----GLDFIPSGTIS-GFTLSLFYADRLKEILA-DLRTQYDRIVFDAP
A0A2T6DFL8      -KSIS------P----GLDFIASGAAG-NFTLSLIYANRLRELMT-TLRGRYDRIVFDSP
A0A1D8AWD4      -RDKS------G----LIDFIPAGAAANNVTLGLLYATKLKALVE-EFRGRYDKVLFDSP
A0A4Q1C9S2      -RDKS------G----LIDFIPAGALANNITLGLLYANKLRELVA-HCRSRYDKVLFDSP
A0A178IH18      -RSIA------P----NLDFIPCGSVG-GFTLSLLYADRLKALLA-GLGKSYDRIMFDAP
A0A2T6DT99      -REIQ------P----NFDFIPCGSVG-SFSLTLLYVDRLKALIQ-ELRGQYDRIVFDAP
A0A1G3ZT33      -RDVV------P----GLDFIASGTPG-GFTLSLLYANRLRELIA-QCKGRYGRIVFDSP
A0A3E1E2T2      -KGLA------P----NLDFIPSGHAP-GFTLGLLHLNRLKDLIA-TLSGRYDKIVFDSP
B1ZMW1          -RELA------P----NLDFIPSGGVP-GFTLGLLQVNRLKELIA-TLRGRYDKILFDSP
A0A3D1TI55      -STSV------P----NLHFLPSGKLP-RTSVGILNSQRMRELIK-TLKSRYDYIFFDSP
A0A3R8IT45      -RDVA------P----NLDVIATGGRA-KSPTQILNSKNFEIMIA-ELRKRYDRIFIDTP
A0A1H1MGC9      -RNVH------P----NLDVIPAGGRA-KNPTQILNSKNFELMLS-ELRKRYDRIFIDTP
A0A2A2PYE8      -RNVH------P----NLDVIPAGGRA-KNPTQILNSKGFELMIS-DLRKQYDRVFIDTP
A0A2T6CN73      -RNQQ------P----NLDVLPTGGRA-KNPTHILNSKAFETMIA-DLRKRYDRVFIDTP
A0A3E1ET42      -QTPI------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKNRFDLVLIDSP
A0A2A2YDW8      -QTPV------E----NLFFMPSGILP-ADAAGILNSRRMSELIA-DVKQRFDLVLVDSP
A0A352XLN9      -QTPV------E----NLFFMPSGILP-ADAAGILNSRRMSELIA-DVKQRFDLVLVDSP
A0A3D0YP62      -QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSP
A0A3D3DV47      -QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2E5XJ49      -QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELIE-DVKQRFDLVLVDSP
A0A2E6SBY8      -QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELIE-DVKQRFDLILVDSP
A0A2E5QMS4      -QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELVQ-DVKQRFDLILVDSP
A0A2E7YXQ3      -QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELVQ-DVKQRFDLILVDSP
A0A2E3H787      -QTPV------D----NLYXLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2E7AGN1      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2E7AKY7      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A3D4CU34      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2E8M146      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A355S8S2      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2D6DVN8      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A3C1W2R2      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2E3NAY6      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2E3II01      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A368B8C5      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A3R7RBB5      -QTPV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2A2QX62      -QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSP
A0A4Q3BWH6      -QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSP
A0A3N5WCF1      -QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSP
A0A4Q3C1K5      -QTPV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2G4G428      -KNVA------P----NLDVLPVGMSC-RNPTQVISSAKFIEMLT-DMRSRYDRIFIDSP
A0A139TV24      PLPDH------P----GVDILYGGPHV-PNPVSLLSRPEIEQLIQ-SFKRSYDAVIIDAP
A0A2N8HT11      TLPEH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSP
R7DS70          TLPEH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSP
A0A2N8HNL6      TLPEH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSP
A0A146GCJ0      -KTDQ------D----NLFLLPAGHRA-PNPSELLGGSEFREMLA-KLLLTYDRVVVDSA
A0A2T6D6H8      -KTPY------E----NLFLLPGGHRA-PNPAELLNEDDFQKMLD-ELLKSYDRIVVDTA
A0A5C9DC49      -KTRF------E----NLFLLTAGRTV-PNPAELLSGQWARQLIR-EAAGKFDHVVLDNA
A0A139TUL1      SGENF------P----GFDMVPAGPVP-PNPAALLTQGRFEDLIR-YWRTRYDRIIVDGC
A0A2N8HCB0      SGRKF------P----GFDLVTAGPVP-PNPVALLTQDRFEELLR-YWRARYDRIILDGC
A0A2N8HP04      SGKRF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRARYDRIILDGC
A0A2N8HRJ0      SGKRF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRARYDRIILDGC
A0A366HAG0      -QTQV------D----HLYFMPSGVMP-ADSAGLLNSQKFVDLLT-DVKSRFDLVLIDSP
A0A3M1I8A3      TATEV------P----NLDMISCAGGS-SQSTELVASRRMVQFLD-EARKRYDRVILDTP
A0A4V0XS84      NTSKV------P----NLDVVCCGSIP-MIPSELIGSKRMEKFLL-DMRERYDRVVFDCP
A0A0R2XQ77      -KEVY------P----NLDVLPSGGKS-KNPTQVLNSARFEAMIA-DLRDRYDRIVIDSP
A0A2E9IN28      -KEVY------P----NLDVLPTGGKS-KNPTQVLNSARFEAMFA-DLRDRYDRIVVDSP
D5ENH7          -REVY------P----NLDVIPTGGKS-KNPTQVLVSAPFEAMLA-DLRDRYDRIVIDSP
A0A351WE84      -PTIV------P----NLSFLPSGRLP-RSMMGIIDSQRMRELVK-DLKSRYDYVFFDSP
A0A1V5QDZ6      -TTSV------P----NLHFLPSGKLP-RTSLGLLDSQRMRELVK-NLKARYDYVFFDSP
A0A4Y8P964      -STAI------P----NVWAIGGGRAA-IHPADLLGSESMQYLTQ-LVRQYFGYVLIDTP
A0A3D4HF88      -KDVY------P----NLDVMGSGGHS-QKSTQILNDKRFIALLE-DLRGSYDRVFIDSP
A0A351MR11      -KDFE------P----NLDILPVGGIC-KNPTQVINSPRFDELIR-ELRTRYDRIFIDSP
A0A5B5WI95      --RQA------GENNTPFDFLGTGPAA-PNPVTLLSQPLLAQILE-CFRKKYDAVIIDTP
A0A2N8I9W1      --RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAP
A0A4Q5IH27      --RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAP
A0A2N8IBZ6      --RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAP
A0A2N8IJW9      --RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAP
R6J100          --RPL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAP
A0A1V6J089      -ETGV------P----NLWMLTSGRLR-RGTIGIMNNTRLRNLLD-HLKEQYDYILLDSP
A0A3C1BZR1      -ETGV------P----NLWMMTSGRLR-RGSLGIMNNARLRALMD-SLKEKYDFVLLDSP
A0A1H6KPB7      -QTHV------D----NLYILPAGPTP-SDASGVLNSYRMRELLD-EVRRRFDIVLIDSP
A0A2E9ISN4      VKLKH------E----PISILPAGVFD-DSLPEKVNAARLRGLVH-SLQQDYDVIIIDTA
B9XAX1          -KTPY------P----NLYILTAGPKV-ANPAEELGGDAIKQLLL-EASNQFDRIVIDTP
A0A5R8KKM9      -ETPI------E----NLFLMPSGLMP-ADSSGMLNSPRFRQLLD-DVKSRFDIVLIDSP
A0A139TS01      -QTPV------E----NLYVMPAGPVP-FDPSGALNSRKFSELLQ-EVKQRFDIVLVDSP
A0A3E1EJT7      -KNVH------P----YLDIISTGGRA-KNPIQLFNSKEFETLVV-ELSKRYDRVLFDTP
A0A317ZP96      -KEVY------P----NLDVLPSGGKS-KNPTQILNSASFESMLA-ELRDRYDRIIIDTP
A0A2D5WGA5      -TTEL------P----SLHFIPSGKLP-SSSMGILSSAKMKEFVT-EMKSRYDYVFLDAP
A0A2E7SSH2      -TSDS------P----NLHFIPSGKLP-SSSMGVLNSSKMKEFVA-EMKSRYDYVFFDAP
A0A349GXM8      -PARI------E----NLFVAPSGGDI-DDSAELLQTVDVRGFFV-DVQDDYDYIFVDTS
A0A4P5YP61      -QTGI------E----NFSFIPAGTTA-PNPAELLGQHGIDGLVA-EALLNYDRVVIDSA
A0A5R1Q5N3      -LSTI------P----NVWAISGGRAA-IHPTDLLGSESMHSLIQ-LVRQYFCYILIDTP
I0JYY7          -LSTI------P----NVWAISGGRAA-IHPTDLLGSESMHSLIQ-LVRQYFCYILIDTP
A0A4R7S1J2      -SSPI------PAHSGTFRVIPAGFRS-PNPAELLASNAFPQLLE-LALKHFDRVVIDTA
A0A2A2XV69      -KTKV------E----NLFFMPSGLLP-RDAVGILNSQRMMEVIQ-ETKSRFDIVFFDSP
A0A651H7X9      -RSPH------E----NLDVILTGGRA-KQPSQILNSADFERFIA-EARQRYQRIIIDTP
A0A4Y8P842      -ATSL------P----NVWAIVGGRAA-IHPADLLGAESFGQLCR-YLREYFAYILIDTP
B3DZK9          -PTSL------P----NVWAIVGGRAA-LHPADLLGAESFSQLCR-SLREYFTYILIDTP
A0A5E6MPC4      -ATAL------P----NVWAIGAGRTP-CHPADLLGAAAMAYLCQ-WARGHFTYVILDCP
A0A4V1SB02      -ATAV------Q----HLSLMPSGRRA-PNPAELLAQGGVEKLIQ-QLLAKYDRIVFDSA
A0A3C1VB86      PHQDV------P----KLSWMAAGSSV-PNPSELLMSADFQKLLS-EGLAHYDRIVIDTA
A0A146G2Q9      -QTKI------D----NLFLMTSGRLP-ADAVGILNSQRMVDLIE-EVKHRFDIVFFDSP
A0A2T6D3Y2      -QTKI------D----NLFLMTSGRLP-ADAVGILNSQRMVDLIE-EVKHRFDIVFFDSP
A0A2V2SDV4      -TTSL------P----TLDFMASGKLP-SSSLGILNSPQMKELIG-QLKQHYDFVFFDSP
A0A2V5PK75      -TTPL------P----TLDFLASGKLP-SSSLGILSSAQMKELIN-ELKQRYDFVFFDSP
A0A1V6DME1      -TSPL------A----TLDFLPSGKLP-SSSLGILNSAQMKDLIA-QLKQRYDFVFFDSP
A0A3D3DIJ3      -TTSL------P----TLDFLSSGKLP-SSSLGILSSTQMKDLIG-ELKQRYDFVFFDSP
A0A2D5VY59      -TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSP
A0A2D8UZZ4      -TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSP
A0A353DV86      -TTKL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSP
A0A2E5EPT8      -KTDQ------A----DLDLLPSGKLP-SSAMGILNSQQMRDFVK-EVQSRYDFILLDSP
A0A5C9DS93      -TTSL------P----NLNFLPSGRLP-SSALGILNSPQMKEFIK-EAKRRYDFVFFDAP
A0A350EWA4      -TSSL------P----SLDVMPSGKLP-SSSMGILSSVRMKQLVK-ELKSRYDFVFFDSP
A0A5B5WZ91      -QTPV------E----NLYVMPAGPIP-FDPSGALNSRKFSELLQ-EVKQRFDIVLVDSP
A0A2N8HD92      -QTPI------E----NLYVMPAGPTP-FDPSGTLNSRKFSELLQ-EVKQRFDMVLVDSP
A0A2N8HIT2      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A354EBD3      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A355VEB2      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A2N8IMT3      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
R6K1U5          -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A2N8IWC2      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A2N8I441      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A2N8I3A6      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A410SCC4      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A3R5VEW0      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A411SSG2      -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
B2UKW3          -QTPI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSP
A0A1M6RLZ4      -QTPI------D----NLFFMPSGILP-ADAAGILNSRRMSDLVQ-DVKQRFDLVLIDSP
A0A354T7G8      -RTQV------E----NLFFLPSGLLP-ADSAGLLNSQRMVDLIA-DVKSRFDLVLIDSP
A0A2S7U4L6      -QTSI------E----NLYFMPSGILP-ADASGILNSRRMSELIQ-EVKSRFDLVLVDSP
A0A512MBZ2      -RTPI------D----NLYFLPSGLLP-ADSAGILNSQRMSELIA-DVKSRFDLVLIDSP
A0A2E8MEZ0      -QTPV------D----NLYFLPSGILP-ADAAGILNSRRMSELLQ-DVKQRFDLVLVDSP
A0A4Q2YKS3      -QTPV------D----NLYFMPSGILP-SDAAGILNSRRMSELIQ-DVKQRFDLVLVDSP
A0A2E3EC33      -QTAY------E----NLYFMPSGILP-SDAAGILNSRRMSELIA-DVKSRFDLVLVDSP
A0A2E4GN01      -QTAY------E----NLYFMPSGILP-SDAAGILNSRRMSELXA-DVKSRFDLVLVDSP
A0A1Z8XU55      -QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSP
A0A2E1RQR9      -QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSP
A0A2E3ISQ4      -QTAY------E----NLYFMPSGILP-ADAAGILNSKRMSELIA-DVKSRFDLVFIDSP
A0A2D6W6F4      -QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-XVKSRFDLVFIDSP
A0A2D8Z5A8      -QTAY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSP
                                 .                                 :  :..*  

A0A2A2XVF1      PVNAVSDTLILAPH-ADKTILVIHAGKTPRKAIQRSVHLLR-KAQAKVAGFVLNRLPTGR
A0A2V5UHJ2      PLMAVSDAVFLSTM-VDGTLLVIN-RRTPKPLLRKARARLT-TPHSKILGMLLNRINIHN
A0A2V5PST3      PAIAVSDPVILSNV-ADGVILVFHAQKTTAASARKTKERFD-AIRAPILGVILNGINLED
A0A2V5PXM3      PVHAVSDTLLILDR-VQTLCLVVRSRKTPRNSVLRAVQMLN-EAGAPLAGVILNLIP-RS
A0A139SU05      PLGAVTDGLLIAER-VDEVAYVCRFNRAHRKHIQLYMRALR-NAKTEVLGVVLNGLTPRR
A0A1D8AZK8      PMGAVTDSLLISER-TDEIIYVCRFNRAYRKHIRLYIKQLR-ESKNELLGIVLNGLSPRR
A0A1V5QB01      PVMAVSEAAILTSL-AEGVVMVVWAGHTSRKLVQLAAKLIQ-ERGARILGCVLNNLDFSR
A0A139SPN4      PLGAVTDGLLIAER-VDEVAYVCRFNRAHRKHIQLYMRALR-NAKTEILGVILNGLAPRR
A0A1V6E7N1      PLGAVTDSLLLAER-TDEIVYVCRFNKALRKHIQLYTKLLL-SGKNEVLGIVLNGLSPRR
A0A2D9MYT1      PVSAVSDPLIIAAN-TDGTVFVNKFNKIRREHARKTVQRVQ-DAGINIVGVCINDLDFEG
A0A258ANJ7      PLIPVNDTLELGTL-ADSTFLVVRCNRTPADIILEAIRKLH-QTGIPITGLVLNRLTQRT
A0A139TLN4      PYASLADARIAARL-ADATLYVMRAGCVKKRDLSSLQKTWK-SGELKRMGIVLCDVENRS
A0A290QGD9      PIAAVSDALIILPL-VDGSIFTVFFNKVRRRAAQYAARRLI-DSHVPNFGAVLNGLNMNV
A0A1D8AS58      PLAAVSDALIILPL-VDGSIFTIFFNRVRRKAAQFSARKLL-EANVPCFGAVLNGLNLAV
I6AQC1          PLAAVSDALIILPL-VSGSIFTIFFNKVRRKAAQHAARKLL-ESNVPVYGAVLNGLNLAV
W0ITH7          PLAAVSDALIILPL-VSGSIFTIFFNKVRRKAAQHAARKLL-ESNVPVYGAVLNGLNLAV
A0A1G3ZFT0      PVLLVTDAVLISAT-SATNYLVLGSNVHQASHLEMAIKRLS-SAGVTVHGSIFNFHNATS
A0A1Z8ZMT6      PLLPVPDTRILAPL-VDNLALVIRADHTPVKSIQGALEMLK-DDGVSSSGVILNDFTENR
A0A2E8MCT7      PLLPVPDTRILAPL-VDNLALVIRAEHTPVKSIQRAFDMLE-DDGVFSSGVILNDFTENR
A0A290Q2Z2      PIIGVSDASVLASV-ADDVLLLVQHRRNPHSMVVRAQQIIE-GLHKQIVGVVLNRVPVNS
A0A2A2RGK2      PLLAVSDTLLIAPH-IDLCTLVVRAFTTPKKMVMRAIKSLE-ETKTTPAGLILNFLPSGR
A0A2A2XXF7      PLLAVSDTLLVAPH-VDLCTLVVRAFGTPRKMVARAIKSLE-ETKTHPAGLILNFLPSGR
A0A2A2R5D6      PVLGISDGAVLAHE-VDFTLLVIQHRRYPRDISMRAKRAVE-EVKGNLLGVVLNAVAVKS
A0A1J4XH17      PLGVVSDIMNILPY-TDGLIFVVKFNSVKRKTAKAHLSRLL-ESNVPVFGAVINQISLDI
A0A3C1VJ32      PILGVSDASILASE-VDLVMQVIQYRRYPQPMTIRAKQMIE-KVGGNFVGMVLNNINMSQ
A0A2N9NTX7      PIMGVSDASILASE-VDMTLQVIQYRRYPQPMNIRAKQLIE-KVGGNLIGIVLNNINMSQ
B9XK55          PIMGVSDASILASE-VDMTLQVIQYRRYPQPMNIRAKQLIE-KVGGNLIGIVLNNINMSQ
A0A4P5YMI6      PIMGVSDASILVSQ-MDLAMLVVQFRKYPQAMSVRAKQTIE-KVGGNLMGAVLNNINIAQ
A0A2E6T482      PIMGVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGGDLVGVVLNNINISQ
A0A3C0DQZ7      PIMGVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGGDLVGVVLNNINISQ
A0A1Z9CBK5      PIMGVSDASVLASA-VDLCVLVVQYRKYPQXMTQRAKDMVV-KVGGNLVGVVLNNINISQ
A0A2D6ZI96      PIMGVSDASVLASA-VDLCVLVVQYRKYPQXMTQRAKDMVV-KVGGNLVGVVLNNINISQ
A0A358KGZ3      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGGDLVGVVLNNINISQ
A0A2E9ZQX4      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGGXXVGVVLNNINISQ
A0A3D5JZU0      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGGDLVGVVLNNINISQ
A0A2E6HCR0      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGGDLAGVVLNNINISQ
A0A1Z8WN04      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGGNLIGVVLNNINISQ
A0A2D7L1N4      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGGNLIGVVLNNINISQ
A0A2E2R937      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGGNLIGVVLNNINISQ
A0A520QQY4      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGGNLIGVVLNNINISQ
A0A2D5MR66      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGGNLVGVVLNNINISQ
A0A2E0PDQ1      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVT-KVGGNLVGVVLNNINISQ
A0A2E2ZZP9      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVT-KVGGNLVGVVLNNINISQ
A0A2A2RGF2      PIMGVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGGRLIGVVLNNINLAS
A0A2G4I5Y6      PIMGVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGGRLIGVVLNNINLAS
A0A3M1I883      PIMGVSDASILCSM-VDIALLVVQYRKYPQAMTLRAKQMVQ-KVGNNLLGIVLNNINISQ
A0A1V6JZ45      PIMGVSDASILASE-VDLSVLVVQYRKYPQAMTLRAKQMVE-KVGGTMLGVVLNNINISQ
A0A520RRW5      PIMGVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGGNLLGVVLNNINISQ
A0A356NPK0      PIMGVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGGNLLGVVLNNINISQ
A0A2D7B5P5      PIMGVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGGNLLGVVLNNINISQ
A0A3D3XGB5      PIMGVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGGNLLGVVLNNINISQ
A0A2V6F8A1      PIMGVSDASILASE-VDLALLVIQYRKYPQAMTLRAKQMVE-KVGGTMLGVVLNNINISQ
A0A2V5TNH4      PIMGVSDASILASE-VDLSLLVIQYRKYPQAMTIRAKQMVE-KVGGALLGVVLNNINISQ
A0A2V5X5Q6      PIMGVSDASILASE-VDLSVLVIQYRKYPQAMTIRAKQMVE-KVGGAMLGVVLNNINISQ
A0A2V2DJ66      PIGAVSDAISLLPE-VDGVLYVIKFNTAKRKVVRRCVRRMM-ESNVPILGAVMNMVNTGA
R7L5A9          PIGAVSDAITLLPT-VDGVIYVVKFNTVKRKTIRAYIRRMM-ESNVPILGAVMNMVNPSS
A0A4P5QM05      PILGVSDASILVSE-VDNTIMVVQYRRFPRNMLQRVKSTVA-HVGGNLIGVVLNNVDIHQ
A0A4Q3C001      PILGVSDGSVLASE-VDMTIMVVQHRRFPRAMLQRVKQAVI-QVGGTLIGVVLNNVDTRH
B4DB23          PILGVSDGSVLASE-VDVTIMVVQHRRFPRVMLQRVKQAVL-NVGGRLIGVVLNNVDAKH
A0A2V5URB2      PIMPVSDAVVLSTL-TDGMIFVVRGQNTPKHIVREAISQLG-NNRSKILGVVLNRVDVRS
A0A5R8KA81      PIHAVSDTLHMVSF-CKFVCLVARCSKTPRKAVIRAAQMLE-EAGKAPSGIILNMLPARR
A0A5B5WU87      PYASLADARIVARL-ADATLYVMRAGCVRKRDLPCLQKTWK-NGKLKRMGIVLCDVENHS
R7DZW0          PYSSLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGELKRMGIVLCDVEPHG
A0A2N8HID1      PYSSLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGELKRMGIVLCDVEPHG
A0A2N8HS06      PYSSLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGELKRMGIVLCDVEPHG
A0A3R5R2M8      PYGILADTAILASW-SDISLYLTRSGMIDKRYFPQVQKLAD-TGKLPNLAFIINGVNFKS
A0A411SUQ6      PYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKLPNMAYIINGVNFKS
A0A2N8HZF2      PYGILADTAILASL-SDITLYTVRSGKIDKRYLLQIQQLAD-QGKLPNMAYIINGVNFKS
A0A354E720      PYGILADTAILASL-SDITLYTVRSGKIDKRYLTQIQQLAD-QGKLPNMAYIINGVNFKS
B2UPB6          PYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKLPNMAYIINGVNFKS
A0A2A2XXW5      PVSAVSDPLIVGAM-ADGMVFVTKFNKIRREHALRSVQRIQ-DSGIHLVGLVLNDIDFEG
A0A2V6JLK8      PILGVSDASVIASE-VDQTVIVVQHRRFPRAMLTRVKQAIL-GVGGTVLGVVLNNVDLKH
A0A2W5Z1A5      PMLGVSDASVLASE-VDQTIIVVQHRRFPRAMLTRVKQAIT-GSGGTVLGVVLNNVDLRH
A0A2V6EA09      PMLGVSDASVLASE-VDETIIVVQHRRFPRAMLTRVKQAIL-SVGGTLLGVVLNDVDLKH
A0A2V6GQI7      PMLGVSDASVLASE-VDETIIVVQHRRFPRAMLTRVKQAIL-SVGGTLLGVVLNDVDLKH
A0A3C1HEJ2      PVHPVSDTLLLAHR-AKTVCVVVRANKTPRKAALTAVQKLQ-KSRANIAGFILNGITLLH
A0A522ULD9      PIIGVTDASILASE-VDGVMLVVQYRKFPKVISMRAKRMIE-NTGSHILGVVLNNINIMR
A0A1V6JU76      PVSAVSDPLILSAM-ADAVVFVTKFNKVRRDHARRTIQRIQ-DAGIHICGVVLNDIDFEG
A0A1Q6UHJ9      PVGAVSDAIALLPY-VDGVIYIVKFNSVSRKAIQKNVRRLM-VSNVPVVGAIMNMVSQGS
A0A2V2BXR0      PVGAVSDAIALLPY-VDGVIYIVKFNSVSRKAIQKNVRRLM-VSNVPVVGAIMNMVSQGS
A0A2D8V0G3      PVSAVSDPLMVGAR-TDGMVFVSKFNKIRREHARKTVQRIQ-DAGIYILGTVINDIDFEG
A0A348S017      PVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGIYILGTVINDIDFEG
A0A3C1UUV7      PVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGIYILGTVINDIDFEG
A0A350I3V2      PVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGIYILGTVINDIDFEG
A0A520RGV5      PVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGIYILGTVINDIDFEG
A0A3D3XF90      PVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGIYILGTVINDIDFEG
A0A2D7B522      PVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGIYILGTVINDIDFEG
A0A356NIC2      PVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGIYILGTVINDIDFEG
A0A2N8HDG3      PYGILADTAILAGH-ADISLYVVRSNRIDKRHISTVQQLAD-SGQLPNLGFIINAVDFKA
A0A2U8DZK4      PIIGVSDSAVITSL-IDHVLLLIQYRRNPLSMVLRAQQTIL-GLDKEILGVVLNRVPKNA
A0A2T6DFL8      PIIGVSDTSVLMTV-VDGVVLLIQHRRNPQSMVLRAQQIVG-GVKASILGIVLNQIPGNA
A0A1D8AWD4      PIIGVSDASVLASL-ADGIVLLIQHRRNPESMVQRAKQIID-GLKVPVIGVVLNQVPTGT
A0A4Q1C9S2      PIIGVSDASVLGSL-ADGIVLLIQHRRNPESMVQRAKQIIDQQVKVPVIGVVLNQVPTGS
A0A178IH18      PIIGVSDASVITSL-VDDVLLLVQYRRNPQSMVVRAQQIIA-GLHKEILGIVLNRVPKNA
A0A2T6DT99      PIIGVSDASVLASV-MDDVLLLVQHRRNPQSMVMRAQQIIE-GLGKTIVGIVLNRVPRNS
A0A1G3ZT33      PVIGVSDASVLSSV-VDGVVLLIQHRRNPQSMVLRAKQIIE-GLKTPLVGVVLNQVPHGS
A0A3E1E2T2      PIIGVSDASVLASA-VDGTVLLIQHRRNPQSMVVRAQQIVE-SLKAPLLGVVLNQVPLNS
B1ZMW1          PIIGVSDASVLASV-MDGAVLLIQHRRNPQSMVLRAQQIVE-AIKTPLLGVVLTQVPENA
A0A3D1TI55      PIVGVSDASVLASE-VDLALLVVQYRKYPKVMSNRAKKMVE-NVGGRLVGVVLNNINVMR
A0A3R8IT45      PLAAVSDALIILPL-ANGAIFTIFFNKVRRKAAQHAARKLL-ESNVPVFGAVLNGLNLAV
A0A1H1MGC9      PLAAVSDALIILPL-LDGSLFTIFFNRVRRKAAQFSARKLL-EVNVPCFGAVLNGLNLAV
A0A2A2PYE8      PLAAVSDALIILPL-VDGSIFTIFFNKVRRKAAQFSAKKLL-EANVPNFGAVLNGLNLAV
A0A2T6CN73      PLAAVSDALIILPL-VDGSIFTIFFNKVRRKAAQFAAKRLL-DSNVPNFGAVLNGLNLVV
A0A3E1ET42      PILGVSDASVLASE-VDLTIIVIQHRKLPRSMLLRVKQAIE-NVGGNLLGVVLNNVDVRS
A0A2A2YDW8      PILGVSDASVLASE-VDLTIIVVQHRKLPRNMLLRVKQAVE-NVGGHVLGVVLNNVDVRS
A0A352XLN9      PILGVSDASVLASE-VDLTIIVVQHRKLPRNMLLRVKQAVE-NVGGHVLGVVLNNVDVRS
A0A3D0YP62      PILGVSDASVLASE-VDLTIVVVQHRKLPRNMLVRVKQAVE-NVGGHVIGVVLNNVDVRS
A0A3D3DV47      PILGVSDASVLASE-VDLTIVVVQHRKLPRNMLVRVKQAVE-NVGGHVIGVVLNNVDVRS
A0A2E5XJ49      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGGQVIGVVLNNVDVRS
A0A2E6SBY8      PILGVSDASVLASE-VDLTMIVVQHRKLPRXMLLRVKQAVE-NVGGQVIGVVLNNVDVRS
A0A2E5QMS4      PILGVSDASVLASE-VDLTIVVVQHRKLPRNMLMRVKAAVE-NVGGQVIGVVLNNVDVRS
A0A2E7YXQ3      PILGVSDASVLASE-VDLTIVVVQHRKLPRNMLMRVKAAVE-NVGGQVIGVVLNNVDVRS
A0A2E3H787      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVXQAVE-NVGGQVIGVVLNNVDVRS
A0A2E7AGN1      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGGYVVGVVLNNVDVRS
A0A2E7AKY7      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGGYVVGVVLNNVDVRS
A0A3D4CU34      PILGVSDASVLASE-ADLTMIVVQHRKLPRNMLLRVKQAVE-NVGGYVVGVVLNNVDVRS
A0A2E8M146      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKQAVE-NVGGHVIGVVLNNVDVRS
A0A355S8S2      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKQAVE-NVGGHVIGVVLNNVDVRS
A0A2D6DVN8      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGGHVIGVVLNNVDVRS
A0A3C1W2R2      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGGHVIGVVLNNVDVRS
A0A2E3NAY6      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMXVRVKEAVE-NVGGHVIGVVLNNVDVRS
A0A2E3II01      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGGHVIGVVLNNVDVRS
A0A368B8C5      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGGHVIGVVLNNVDVRS
A0A3R7RBB5      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGGHVIGVVLNNVDVRS
A0A2A2QX62      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGGHVIGVVLNNVDVRS
A0A4Q3BWH6      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGGHVIGVVLNNVDVRS
A0A3N5WCF1      PILGVSDASVLASE-VDLTMLVVQHRKLPRNMLLRVKQAVE-NVGGHVIGVVLNNVDVRS
A0A4Q3C1K5      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGGNVIGVVLNNVDVRS
A0A2G4G428      PIGAVSDALNLIPN-VDGVIYVVRYNFVSTRNVAECITRLR-EVGVPILGAVLNRMSMRM
A0A139TV24      PYGILADTAIFAKL-ADISLYVIRSNKIDKRYIATIQQLAN-EGKLPNMGFVINAVDFKA
A0A2N8HT11      PYGILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQLPNMGFVINAVDFKS
R7DS70          PYGILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQLPNMGFVINAVDFKS
A0A2N8HNL6      PYGILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQLPNMGFVINAVDFKS
A0A146GCJ0      PVNAVSDALLIASC-VDTACLVVRAGKTPKKASLRAVKQLQ-KSGAKLAGFIFNRLPVGG
A0A2T6D6H8      PVNAVSDVLLIANC-IQTTCLVVHAGRTPKKAVLRAVRQLQ-KTGARLGGFVFNRLPVGG
A0A5C9DC49      PVNAVSDALLIVKE-AQTVCLVANARKTSYRVVQRALEMLR-RAGAKPSGVVLNFLPQSA
A0A139TUL1      PYEAVADASLMARH-ADLVLYLIRCGMIEKQYVPSIQEVAA-RGEFRSVALILNAENFKN
A0A2N8HCB0      PYEAVVDASLMARH-ADLVLYVIRCGMIEKQYVPAIQGLAD-KGEFRAVALILNAENFKN
A0A2N8HP04      PYEAVADASLMARH-ADLVLYVIRCGMIEKQYVPVIQGLAD-KGEFRSGAVILNAENFKN
A0A2N8HRJ0      PYEAVADASLMARH-ADLVLYVIRCGMIEKQYVPVIQGLAD-KGEFRSGAVILNAENFKN
A0A366HAG0      PIIGVSDASVLAAE-ADMTIIVVQHRKLPRQMLQRVKQTIE-QVGGKVAGAVLNNVNINS
A0A3M1I8A3      PVSAVSDPLVVASL-SDGCVFVAKFNKVRREHARKTLRRLL-DAGVHICGVLLNDIDFEG
A0A4V0XS84      PVAAVSDALVLGTL-ADGVIFVVKFNKIHRDHARKSIQRIQ-SAGINIFGTVVNDIDYSN
A0A0R2XQ77      PLAAVSDVLNLLPL-ADGVLYVIKFNTVKRKTAVVNVRRLW-ESNTPIFGAILNNISSTL
A0A2E9IN28      PLAAVSDALNLLPL-VDGILYVIKFNTVKRKTAVVNVRRLW-ESNTPVFGAILNNITSSL
D5ENH7          PLAAVSDALNLLPL-VDGVVYVIKFNTVKRKTAVANVRRLW-ESNTPVFGAILNNITTSL
A0A351WE84      PIIGITDASILASE-VDGVLLVVQYRKYPRVISSRAKRMVE-NVGGKLLGVVLNNINIMR
A0A1V5QDZ6      PIMGVTDASILASE-VDGVLLVVQYRKYPKIITSRAKRMIE-NVGGNVLGVVLNNINIMR
A0A4Y8P964      PMHGMPDAAIIGTL-TDGLIYVIQNGRTEKKDFLQNLQILA-SVNTKILGVVLNKTD---
A0A3D4HF88      PVAAVSDALNVLPH-VDGVLYVINYNTVKRKTVKASVRRLF-ESNVPVFGVIMNQITAAM
A0A351MR11      PLGAVSDALHLVPK-VDGVIYVVRFNLVKKRNAMSCIARLR-EAGVPIVGAVLNSMATRL
A0A5B5WI95      PYGILADTAILAAL-SDISLYLIRSGMIDKRYFNQIQKLAD-SGKLPNLAYIINAVDFKS
A0A2N8I9W1      PYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKLPNMAYIINGVNFKS
A0A4Q5IH27      PYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKLPNMAYIINGVNFKS
A0A2N8IBZ6      PYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKLPNMAYIINGVNFKS
A0A2N8IJW9      PYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKLPNMAYIINGVNFKS
R6J100          PYGILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKLPNMAYIINGVNFKS
A0A1V6J089      PILGVTDAAILASE-VDGVLLVVQYRKYPKIISLRAKRMIE-NAGGQVLGAVLNNINIMR
A0A3C1BZR1      PILGVTDAAILASE-ADGVLLVVQYRKYPKIISLRAKRMIE-NAGGRLMGAVLNNINIMR
A0A1H6KPB7      PVLGVSDASLIVSK-ADATIMVVQPRKLPMKALVREKMVIE-NAGGHLMGVVMNNVDISG
A0A2E9ISN4      PVSIFSESLAFCQA-TGGVLVMMDSLTSQASVQNCLNEL----RGIRTLGFCVNGVNES-
B9XAX1          PINAVSDTFILLPL-AQIICLVVRAGKTPKHAIMRAVELMA-RANVPPTGIVLNFLPQHS
A0A5R8KKM9      PILGVSDASVLAAE-ADLTLLVVQHRKLPRHMLQRVKHSVD-AVGGDVVGVVLNNVDIHS
A0A139TS01      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A3E1EJT7      PLGAVSDALNILPL-MDGAIYTIHFNRVRRKAAQQCTRRLL-AVNVPVFGAVMNGMNTGI
A0A317ZP96      PLAAVSDALNLLPL-VDGILYVIKFNTVKRKTAVVNVRRLW-ESNTPVFGAVLNNITSTL
A0A2D5WGA5      PIMGVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGGDLVGVVLNNINISQ
A0A2E7SSH2      PIMGVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGGNLVGVVLNNINISQ
A0A349GXM8      PVLRVTDTVILASQGIGQVLYVARVNFTPKPMIRYSLDMLK-D--ANILGLVMNSIEMHK
A0A4P5YP61      PVHAVSDTLLMLKR-VQTVCLVARANKTPRKATLRAVQMLR-QAEAPLAGLILNRLPRRV
A0A5R1Q5N3      PMHGMPDAAIIGSV-TDGLIYVIQAGRIERKDFLQNLQILA-TVNARILGVVLNKTT---
I0JYY7          PMHGMPDAAIIGSV-TDGLIYVIQAGRIERKDFLQNLQILA-TVNARILGVVLNKTT---
A0A4R7S1J2      PIVAVSDTLVIVPH-VQTVLLVIHWKKTPSTVIQRALNLLG-ESGKSPSGLILNNVPEGS
A0A2A2XV69      PILGVSDASVLSSE-LDLTIIVVQHRRFPKEMIQRVKQAIE-NVGGNILGVVLNNVDIRH
A0A651H7X9      PLAAVSDSLILLPL-VDGALFTIQFNRVKRKAAQTVVRRLS-ETSVPVFGAILNGLNLSL
A0A4Y8P842      PMRGIPDASIVSMQ-TEGVLYVIEDGKDDRKEVQNNVEAFS-RINTRILGIILNKADPVS
B3DZK9          PMRGMPDAPIVSMQ-SEGVLYVIEDGRDDRKEVQNNIEAFS-RINSRVLGIILNRADPLS
A0A5E6MPC4      PLVGMPDAAVVATL-TDGVLLVIRDGAVDRSDARRVVETLS-VVNTRILGIVLNRVQQAN
A0A4V1SB02      PVNAVSDTLSIAPL-ANAVCIVLRYGKTPRRAILRAVGLLR-KSNARMAGVIMNRMPARR
A0A3C1VB86      PILPVSDTLLLAGK-VQTVVLVVQACKTSRKAVERSVQLLK-NASAPTGGVVLNLLPKRR
A0A146G2Q9      PILGVSDASVLSSA-VDLTIIVVQHRRFPRAMLQRVKQAVL-NVGGNILGVVLNNVDVRH
A0A2T6D3Y2      PILGVSDASVLSSA-VDLTIIVVQHRRFPRAMLQRVKQAVH-NVGGNILGVVLNNVDVRH
A0A2V2SDV4      PVMGVSDASIIASE-VDMTLQVIQYRRYPQPLNIRAKQLIE-KVGGNLVGIVLNNINMSQ
A0A2V5PK75      PIMGVSDASILASE-VDMTLQVIQYRRYPQPMNVRAKQLIE-KVGGNLVGIVLNNINMSQ
A0A1V6DME1      PIMGVSDASILASE-MDMTVQVIQYRRYPQPMNIRAKQLIE-KVGGNLIGIVLNNINMSQ
A0A3D3DIJ3      PIMGVSDASILASE-VDMTIQVIQYRRYPQPMNIRAKQLIE-KVGGNLVGIVLNNINMSQ
A0A2D5VY59      PIMGVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGGNLLGVVLNNINISQ
A0A2D8UZZ4      PIMGVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGGNLLGVVLNNINISQ
A0A353DV86      PIMGVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGGNLLGVVLNNINISQ
A0A2E5EPT8      PLMGVSDATVLTSM-VDLTLLVIQYRKYPQSLAVRSRQMIE-KVGGTLLGIVLNNINVSS
A0A5C9DS93      PIMGVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGGRLIGVVLNNINLAS
A0A350EWA4      PIMGVSDASVLASE-VDLTLQVIQYRRYPQPMTIRAKQMIE-KVGGNLLGVVLNNINMAQ
A0A5B5WZ91      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A2N8HD92      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A2N8HIT2      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A354EBD3      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A355VEB2      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A2N8IMT3      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
R6K1U5          PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A2N8IWC2      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A2N8I441      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A2N8I3A6      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A410SCC4      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLVGVVMNNVDITS
A0A3R5VEW0      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A411SSG2      PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
B2UKW3          PILGVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGGNLAGVVMNNVDITS
A0A1M6RLZ4      PILGVSDASVLASE-VDLTMIVVQHRKLPRKMLVRVKQAVE-NVGGTVLGVVLNNVDVKS
A0A354T7G8      PILGVSDASVLANE-ADMTMIVVQHRKLPRHMLMRVKQSVE-NAGGKVVGVVLNNVDLRS
A0A2S7U4L6      PILGVSDASVISSE-VDLTMIVVQHRKLPRNMLVRVKQAVE-NVGGTVLGVVLNNVDLRS
A0A512MBZ2      PILGVSDASVLSNE-ADMTMLVVQHRKLPRHMLMRVKQTVE-NVGGRVLGVVLNNVDVRS
A0A2E8MEZ0      PILGVSDAAVLASE-VDLTMVVVQHRKLPRNMLLRVKQAVE-NVGGQVIGVVLNNVDVRS
A0A4Q2YKS3      PILGVSDASVLASE-VDLTMIVVQHRKLPRNMLIRVKQAVE-NVGGHVIGVVLNNVDVRS
A0A2E3EC33      PILGVSDASVLASE-VDLTIIVIQHRKLPRGMLIRVKQAIE-NVGGKALGVVLNNVDVRS
A0A2E4GN01      PILGVSDASVLASE-VDLTIIVIQHRKLPRGMLIRVKQAIE-NVGGKALGVVLNNVDVRS
A0A1Z8XU55      PILGVSDASVLSSE-VDLTIIVIQHRKLPRGMLVRVKQAIQ-NVGGTALGVVLNNVDVRS
A0A2E1RQR9      PILGVSDASVLSSE-VDLTIIVIQHRKLPRGMLVRVKQAIQ-NVGGTALGVVLNNVDVRS
A0A2E3ISQ4      PILGVSDASVISSE-VDLTIIVIQHRKLPRGMLLRVKQAIQ-NVGGTALGVVLNNVDVRS
A0A2D6W6F4      PILGVSXASVISSE-VXLTIIVIQHRKLPRGMLLRVKQAIQ-NVGGTALGVVLNNVDVRS
A0A2D8Z5A8      PILGVSDASVISSE-VDLTIIVIQHRKLPRGMLLRVKQAIQ-NVGGTALGVVLNNVDVRS
                *   .                                            .  .       

A0A2A2XVF1      AAGYYYYYYGDKYEKDSVYG----------------------------------------
A0A2V5UHJ2      NEYG--GYYQQYYEYYSQDPPAITDNAPALSENGHGRLSRRSRLNGSFPVTLKPVASEKS
A0A2V5PST3      PDYA--YYRHYYGSDYGTVA----------------------------------------
A0A2V5PXM3      GGGYGYYYYDSYYAYGYYGK----------------------------------------
A0A139SU05      VEYYSNYRYYRSYGKYTERV----------------------------------------
A0A1D8AZK8      IEYYSNYRYYRSYKKYYGSQ----------------------------------------
A0A1V5QB01      VGYY---YYSTYYGYYDYDH----------------------------------------
A0A139SPN4      VEYYSNYRYYRSYGKYTNVE----------------------------------------
A0A1V6E7N1      IKYYSNYRYYRSYKKYYGTH----------------------------------------
A0A2D9MYT1      KDSYYYSYYYYQNRYYASHY----------------------------------------
A0A258ANJ7      RSFD--QYYHRSYYKGSETD----------------------------------------
A0A139TLN4      RPSRKYAMYRSFDTSSPCPG----------------------------------------
A0A290QGD9      SGYYYGQYTDKSYKDYYVVM----------------------------------------
A0A1D8AS58      SGYYYAQYYDKSYKDYYVTM----------------------------------------
I6AQC1          AGYYYAQYYDKSYKDYYVMT----------------------------------------
W0ITH7          AGYYYAQYYDKSYKDYYVMT----------------------------------------
A0A1G3ZFT0      KKSSYQYYSSHYYYEDESDH----------------------------------------
A0A1Z8ZMT6      LQGGKYGYGYGYGQYGDDA-----------------------------------------
A0A2E8MCT7      LQGGKYGYGYGYGHYGDDT-----------------------------------------
A0A290Q2Z2      SDDY--GYYTRNYAYYSARE----------------------------------------
A0A2A2RGK2      GGYYAYYYSGKYYGSYGAKG----------------------------------------
A0A2A2XXF7      GGYYAYYYSGKYYGSYGAKG----------------------------------------
A0A2A2R5D6      DEAY--YYYSSYGNYYYNRN----------------------------------------
A0A1J4XH17      VNYYYSNYYDKTYYDYYNNG----------------------------------------
A0A3C1VJ32      DEGY--YYYSGYYHDYYYSR----------------------------------------
A0A2N9NTX7      DESY--YYYSGYYHDYYSRN----------------------------------------
B9XK55          DESY--YYYSGYYHDYYSKN----------------------------------------
A0A4P5YMI6      DSYY--YYYSGYQYTSENQP----------------------------------------
A0A2E6T482      DSYY--YYYSGYYYDYYYKS----------------------------------------
A0A3C0DQZ7      DSYY--YYYSGYYYDYYYKS----------------------------------------
A0A1Z9CBK5      DSYY--YYYSGYYYDYYYKS----------------------------------------
A0A2D6ZI96      DSYY--YYYSGYYYDYYYKS----------------------------------------
A0A358KGZ3      DSYY--YYYSGYYYDYYYKS----------------------------------------
A0A2E9ZQX4      DSYY--YYYSGYYXDYYXKS----------------------------------------
A0A3D5JZU0      DSYY--YYYSGYYYDYYYKS----------------------------------------
A0A2E6HCR0      DSYY--YYYSGYYYDYYYKS----------------------------------------
A0A1Z8WN04      DSYY--YYYSGYYYDNYYKS----------------------------------------
A0A2D7L1N4      DSYY--YYYSGYYYDNYYKS----------------------------------------
A0A2E2R937      DSYY--YYYSGYYYDNYYKS----------------------------------------
A0A520QQY4      DSYY--YYYSGYYYDNYYKS----------------------------------------
A0A2D5MR66      DSYY--YYYSGYYYDNYYKS----------------------------------------
A0A2E0PDQ1      DSYY--YYYSGYYYDNYYKT----------------------------------------
A0A2E2ZZP9      DSYY--YYYSGYYYDNYYKS----------------------------------------
A0A2A2RGF2      DASY--YYYSG--YNYHSNN----------------------------------------
A0A2G4I5Y6      DASY--YYYSG--YNYRSNN----------------------------------------
A0A3M1I883      DSYY--YYYSGYYYDYYYGS----------------------------------------
A0A1V6JZ45      DSYY--YYYSGYYYDYYSKG----------------------------------------
A0A520RRW5      DSYY--YYYSGYYYDYYSKQ----------------------------------------
A0A356NPK0      DSYY--YYYSGYYYDYYSKQ----------------------------------------
A0A2D7B5P5      DSYY--YYYSGYYYDYYSKQ----------------------------------------
A0A3D3XGB5      DSYY--YYYSGYYYDYYSKQ----------------------------------------
A0A2V6F8A1      DSYY--YYYSGYYYDYYSKR----------------------------------------
A0A2V5TNH4      DSYY--YYYSGYYYDYYAKR----------------------------------------
A0A2V5X5Q6      DSYY--YYYSGYYYDYYAKR----------------------------------------
A0A2V2DJ66      VSGYSINYYDKNYQNYYMTP----------------------------------------
R7L5A9          ASVYSMNYYDKSYQNYYTAP----------------------------------------
A0A4P5QM05      DDSY--RYYSNYKDYY--GP----------------------------------------
A0A4Q3C001      DEGY--SYYNNYNDYY--AP----------------------------------------
B4DB23          DDGY--SYYYNYNEYY--GP----------------------------------------
A0A2V5URB2      AEYR--DYYRYYNPEFYYPS----------------------------------------
A0A5R8KA81      NSGLYYHYYSGSYGKPVYGK----------------------------------------
A0A5B5WU87      RSSRKYAMYRSFDTSS--PC----------------------------------------
R7DZW0          RSSRGYAVYRSLDTSS--PC----------------------------------------
A0A2N8HID1      RSSRGYAVYRSLDTSS--PC----------------------------------------
A0A2N8HS06      RSSRGYAVYRSLDTSS--PC----------------------------------------
A0A3R5R2M8      ASYNYYGYGYGYGYGTGSRS----------------------------------------
A0A411SUQ6      ASYSYYGYGYGYQYGYGTK-----------------------------------------
A0A2N8HZF2      ASYSY--YGYGYQYGYGTK-----------------------------------------
A0A354E720      ASYSYYGYGYGYQYGYGAK-----------------------------------------
B2UPB6          ASYSYYGYGYGYQYGYGTK-----------------------------------------
A0A2A2XXW5      KDSYYYSYHYYQNQYYSSHY----------------------------------------
A0A2V6JLK8      DQNY--YYYTNYYGYY--QP----------------------------------------
A0A2W5Z1A5      DQNY--YYYTNYYGYY--QP----------------------------------------
A0A2V6EA09      DQNY--YYYTHYYAYY--QP----------------------------------------
A0A2V6GQI7      DQNY--YYYTHYYAYY--QP----------------------------------------
A0A3C1HEJ2      RSDY--YDYSDYYARY--RE----------------------------------------
A0A522ULD9      DDYY--YYYHSYYADYYYRS----------------------------------------
A0A1V6JU76      RDSYYYSYTYYQNRYYSSYH----------------------------------------
A0A1Q6UHJ9      AAGYSLNYYDKSYQNYYTMP----------------------------------------
A0A2V2BXR0      AAGYSLNYYDKSYQNYYTMP----------------------------------------
A0A2D8V0G3      KDSYYYSYYYYQNRYYASYY----------------------------------------
A0A348S017      KDSYYYSYYYYQNRYYASYY----------------------------------------
A0A3C1UUV7      KDSYYYSYYYYQNRYYASYY----------------------------------------
A0A350I3V2      KDSYYYSYYYYQNRYYASYY----------------------------------------
A0A520RGV5      KDSYYYSYYYYQNRYYASYY----------------------------------------
A0A3D3XF90      KDSYYYSYYYYQNRYYASYY----------------------------------------
A0A2D7B522      KDSYYYSYYYYQNRYYASYY----------------------------------------
A0A356NIC2      KDSYYYSYYYYQNRYYASYY----------------------------------------
A0A2N8HDG3      GSYS----YYGYGYHYGNTS----------------------------------------
A0A2U8DZK4      GADY--AYYSKNYAYY--GS----------------------------------------
A0A2T6DFL8      GGDY--GYYTSNYAYY--HE----------------------------------------
A0A1D8AWD4      GEDY--SYYTNNYSYY--S-----------------------------------------
A0A4Q1C9S2      GEDY--GYYTNNYSYY--S-----------------------------------------
A0A178IH18      GDDY--GYYTNNYAYY--SS----------------------------------------
A0A2T6DT99      GEDY--GYYTHNYAYY--SS----------------------------------------
A0A1G3ZT33      GDDY--GYYTGNYDYY--SE----------------------------------------
A0A3E1E2T2      GDDY--GYYTNNYSYY--SE----------------------------------------
B1ZMW1          GGDY--GYYTHNYSYY--SD----------------------------------------
A0A3D1TI55      DDYY--YYYHTYYSHYYGPQ----------------------------------------
A0A3R8IT45      AGYYYAQYYDKSYKDYYVMA----------------------------------------
A0A1H1MGC9      SGYYYAQYYDKSYKDYYVTM----------------------------------------
A0A2A2PYE8      SGYYYAQYYDKSYKDYYVVM----------------------------------------
A0A2T6CN73      SGYYYAQYYDKSYKDYYVV-----------------------------------------
A0A3E1ET42      DSQY--QYYTSYYTYY--SP----------------------------------------
A0A2A2YDW8      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A352XLN9      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A3D0YP62      DNQY--QYYTSYYTYY--AP----------------------------------------
A0A3D3DV47      DNQY--QYYTSYYTYY--AP----------------------------------------
A0A2E5XJ49      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E6SBY8      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E5QMS4      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E7YXQ3      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E3H787      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E7AGN1      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E7AKY7      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A3D4CU34      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E8M146      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A355S8S2      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2D6DVN8      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A3C1W2R2      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E3NAY6      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E3II01      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A368B8C5      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A3R7RBB5      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2A2QX62      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A4Q3BWH6      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A3N5WCF1      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A4Q3C1K5      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2G4G428      ASVYTDSFDASYEKYY--NA----------------------------------------
A0A139TV24      AGHH--YYGYGYHYNYGYNT----------------------------------------
A0A2N8HT11      SSYS--YYGYGYHYGNTSKN----------------------------------------
R7DS70          SSYS--YYGYGYHYGNTSKN----------------------------------------
A0A2N8HNL6      SSYS--YYGYGYHYGNTSKN----------------------------------------
A0A146GCJ0      RSAG--YYYYYYGGEY--SK----------------------------------------
A0A2T6D6H8      QSAG--YYYYYYGGDY--AK----------------------------------------
A0A5C9DC49      GSGY--YYYYSGNKYY--GK----------------------------------------
A0A139TUL1      SRFH-------YYSEYSGSE----------------------------------------
A0A2N8HCB0      SRFH-------YYSEY--SE----------------------------------------
A0A2N8HP04      SRFH-------YYDEY--SE----------------------------------------
A0A2N8HRJ0      SRFH-------YYDEY--SE----------------------------------------
A0A366HAG0      DATY--GYYTSYYGYY--SG----------------------------------------
A0A3M1I8A3      RDSYYYSYYFYQNRYY--SS----------------------------------------
A0A4V0XS84      SQYYYSEYYSNQIASP--EF----------------------------------------
A0A0R2XQ77      ASYYYSSYSDKAYQDY--YI----------------------------------------
A0A2E9IN28      SSYYYSNYSDKAYQDY--YI----------------------------------------
D5ENH7          SSYYYSQYSDKAYQDY--YI----------------------------------------
A0A351WE84      DDYY--YYYHASYTQY--NP----------------------------------------
A0A1V5QDZ6      DDYY--YYYHSYYSQY--YQ----------------------------------------
A0A4Y8P964      ------GSYQSYYSYY--AY----------------------------------------
A0A3D4HF88      SSYYYTNYYEKSYDKY--YT----------------------------------------
A0A351MR11      AAFYTNSYDASYSKYY--TD----------------------------------------
A0A5B5WI95      SSYS--YYGYNYGYRY--SY----------------------------------------
A0A2N8I9W1      SSYS--YYGYGYGYQY--GY----------------------------------------
A0A4Q5IH27      SSYS--YYGYGYGYQY--GY----------------------------------------
A0A2N8IBZ6      SSYS--YYGYGYGYQY--GY----------------------------------------
A0A2N8IJW9      SSYS--YYGYGYGYQY--GY----------------------------------------
R6J100          SSYS--YYGYGYGYQY--GY----------------------------------------
A0A1V6J089      DDYY-------YYYHY--TT----------------------------------------
A0A3C1BZR1      DDYY-------YYYHY--AT----------------------------------------
A0A1H6KPB7      DTQY--QYYTTYYSYY--SP----------------------------------------
A0A2E9ISN4      ------YLRSNGYDAY--GS----------------------------------------
B9XAX1          GYRY--------YYHY--TP----------------------------------------
A0A5R8KKM9      DNTY--GYYTSYYTYY--NS----------------------------------------
A0A139TS01      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A3E1EJT7      TGDYYMENNSKLFKEY--YN----------------------------------------
A0A317ZP96      SSYYYSQYSDKSYQDY--YI----------------------------------------
A0A2D5WGA5      DSYY--YYYSGYYYDY--YY----------------------------------------
A0A2E7SSH2      DSYY--YYYSGYYYDY--YY----------------------------------------
A0A349GXM8      ISSLYYAYQYPNYAYY--SN----------------------------------------
A0A4P5YP61      GLGG--YYYDSYYNYS--YY----------------------------------------
A0A5R1Q5N3      ------TSYQSYYSYY--AY----------------------------------------
I0JYY7          ------TSYQSYYSYY--AY----------------------------------------
A0A4R7S1J2      RGYYY-HYSPGYYGSK--GV----------------------------------------
A0A2A2XV69      DQSY--GYYTSYYNYY--SP----------------------------------------
A0A651H7X9      AGYYYAQYYDKSYKDY--YV----------------------------------------
A0A4Y8P842      SSYY--YSYSYKYRSA--VP----------------------------------------
B3DZK9          HSSY--Y-YAYKYRSQ--AS----------------------------------------
A0A5E6MPC4      RSYY--AYHYAY------------------------------------------------
A0A4V1SB02      GASY--YYY--YYGDP--YV----------------------------------------
A0A3C1VB86      LSGY--YY--SYHHGY--GY----------------------------------------
A0A146G2Q9      DQHY--QYYTSYYNYY--YQ----------------------------------------
A0A2T6D3Y2      DQHY--QYYTSYYNYY--YQ----------------------------------------
A0A2V2SDV4      DENY--YYYSGYYHE---------------------------------------------
A0A2V5PK75      DESY--YYYSGYYHDY--YS----------------------------------------
A0A1V6DME1      DESY--YYYSGYYHDY--YY----------------------------------------
A0A3D3DIJ3      DESY--YYYSGYYHDY--YY----------------------------------------
A0A2D5VY59      DSYY--YYYSGYYYDY--YS----------------------------------------
A0A2D8UZZ4      DSYY--YYYSGYYYDY--YS----------------------------------------
A0A353DV86      DSYY--YYYSGYYYDY--YS----------------------------------------
A0A2E5EPT8      DASY--YYYSGYHYHD--NP----------------------------------------
A0A5C9DS93      DASY--YYYSGYH-YH--SN----------------------------------------
A0A350EWA4      DENY--YYYSGYYYDY--YS----------------------------------------
A0A5B5WZ91      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A2N8HD92      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A2N8HIT2      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A354EBD3      DHQY--QYYTTYYSYY--ST----------------------------------------
A0A355VEB2      DHQY--QYYTTYYSYY--ST----------------------------------------
A0A2N8IMT3      DHQY--QYYTTYYSYY--SA----------------------------------------
R6K1U5          DHQY--QYYTTYYSYY--SA----------------------------------------
A0A2N8IWC2      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A2N8I441      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A2N8I3A6      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A410SCC4      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A3R5VEW0      DHQY--QYYTTYYSYY--SA----------------------------------------
A0A411SSG2      DHQY--QYYTTYYSYY--SA----------------------------------------
B2UKW3          DHQY--QYYTTYYSYY--SA----------------------------------------
A0A1M6RLZ4      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A354T7G8      DAQY--QYYTSYYTYY--AP----------------------------------------
A0A2S7U4L6      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A512MBZ2      DSQY--QYYTSYYTYY--SP----------------------------------------
A0A2E8MEZ0      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A4Q2YKS3      DSQY--QYYTSYYTYY--AP----------------------------------------
A0A2E3EC33      DNQY--QYYTSYYTYY--SP----------------------------------------
A0A2E4GN01      DNQY--QYYTSYYTYY--SP----------------------------------------
A0A1Z8XU55      DNQY--QYYTSYYTYY--AP----------------------------------------
A0A2E1RQR9      DNQY--QYYTSYYTYY--AP----------------------------------------
A0A2E3ISQ4      DNQY--QYYTSYYTYY--AP----------------------------------------
A0A2D6W6F4      DNXY--QYYTSYYTYY--AP----------------------------------------
A0A2D8Z5A8      DNQY--QYYTSYYTYY--AP----------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      SNGVSTGALDVVRAKLGEAMGPMASLVLRDSIRALGESSESFPEAKLEVLVQHVSQEILD
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A5C9DC49      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A5R1Q5N3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5C9DS93      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      DYQRQRFEEETLKEIKKTTEQHGAAQPDGPVKADSAISKKKPNGTAVDNPSLTSEPAAIQ
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A5C9DC49      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A5R1Q5N3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5C9DS93      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      -----------------TKT----------------------------------------
A0A2V5UHJ2      EPRDGADGATASGAASISEKTSEALPHRPSKNPAAIPKPATKKTMNKESREELSPEFLKL
A0A2V5PST3      -----------------AAENGNGGEHTDVEVLMNDGPFEKDPWPKIAASEIVPQNFFDH
A0A2V5PXM3      -----------------YGHGQKEKARAAAA-----------------------------
A0A139SU05      -----------------DRPERETKRPKKVVEEAEVSEIA--------------------
A0A1D8AZK8      -----------------S------------------------------------------
A0A1V5QB01      -----------------IRESKEDAKT---------------------------------
A0A139SPN4      -----------------PARGELDREPARAPEAAPAAEPAVAA-----------------
A0A1V6E7N1      -----------------G------------------------------------------
A0A2D9MYT1      -----------------KSDKPXEEEAXQLPLQPGVKXAGKEEXSA--------------
A0A258ANJ7      -----------------ETAPLRPASRGLHTPSNFG------------------------
A0A139TLN4      -----------------K------------------------------------------
A0A290QGD9      -----------------SKKDDTQSPLK--------------------------------
A0A1D8AS58      -----------------AKQDGEPDAR---------------------------------
I6AQC1          -----------------ESEEGEDTAEADDKVPEMPTSRS--------------------
W0ITH7          -----------------ESEEGEDTAEADDKVPEMPTSRS--------------------
A0A1G3ZFT0      -----------------PKKKRRTLV----------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      -----------------NRSSERRDKRSRTEQAERAKSDERITFTERERDERRKS-----
A0A2A2RGK2      -----------------VYGE---------------------------------------
A0A2A2XXF7      -----------------VYGE---------------------------------------
A0A2A2R5D6      -----------------GEKKPRSGAATPQRATLAKNDEQSHGSEDF-------------
A0A1J4XH17      -----------------ELPEKKSNLDKATKLATRVKSALSKKKNKEKTLV---------
A0A3C1VJ32      -----------------DPSEQEAEAKKADLAAKGPG-DTEV-----------------N
A0A2N9NTX7      -----------------EDQEKGSGPD------EGPGDKTKL-----------------D
B9XK55          -----------------EDESE-TATD------AGEG-KART-----------------D
A0A4P5YMI6      -----------------EAPAVAKRATKGALAEKPAA----------------------E
A0A2E6T482      -----------------REKEEENADKSEDG--AKEG-KLLAKADLGAG----------E
A0A3C0DQZ7      -----------------REKEEENADKSEDG--AKEG-KLLAKADLGAG----------E
A0A1Z9CBK5      -----------------REGEEDAGEEKKAD---KDQ-KLVAQANPGGS----------D
A0A2D6ZI96      -----------------REGEEDAGEEKKAD---KDQ-KLVAQANPGGS----------D
A0A358KGZ3      -----------------RETEDEPVEDKKDG---KEE-KLIAQADAAGE----------D
A0A2E9ZQX4      -----------------RETEEEPVEDKKDG---KEE-KLIAQADAXGX----------D
A0A3D5JZU0      -----------------RETEEEPVEDKKDG---KEE-KLIAQADAVGE----------D
A0A2E6HCR0      -----------------RENEEESEDVKESE---NGK-SLVSEAASDRE----------D
A0A1Z8WN04      -----------------REDEEGSDGTGSDNKEIKDK-SITTE-VDSSS----------D
A0A2D7L1N4      -----------------REDEEGSDGTGSDNKEIKDK-SITTE-VDSSS----------D
A0A2E2R937      -----------------REDEEGSDGTGSDNKEIKDK-SITTE-VGGSS----------D
A0A520QQY4      -----------------REDEEGSDGTGSDNKEIKDK-SITTE-VDSSS----------D
A0A2D5MR66      -----------------RENEEESLPEKGSD---QEK-SITNESADRDG----------S
A0A2E0PDQ1      -----------------RENEEESIAVKESD---KDK-LINTEATENNE----------S
A0A2E2ZZP9      -----------------RENEEEPIAEKESD---KDK-LINTEDAENNE----------S
A0A2A2RGF2      -----------------NADEPGTNGKPPGKADRHKP-AAPTADAP-------------T
A0A2G4I5Y6      -----------------NDDESSTNGKPPGKVDRHKP-VAPVADAT-------------S
A0A3M1I883      -----------------SSEYGRRRRKSSRKRRKSRE-KDSSAEAPATAATETEEAETPE
A0A1V6JZ45      -----------------EYGESKSSEDDESRKAAPKK-PAEA-----------------E
A0A520RRW5      -----------------DGDNTSSKKKSDGKSGKTSA-RGDL-----------------E
A0A356NPK0      -----------------DGDNTSSKKKSDGKSGKTSA-RGDL-----------------E
A0A2D7B5P5      -----------------DGDNTSSKKKSDGKSGKTSA-RGDL-----------------E
A0A3D3XGB5      -----------------DGDNTSSKKKSDGKSGKTSA-RGDL-----------------E
A0A2V6F8A1      -----------------EEEP-S--KNNGEKKKPAGE-RAQL-----------------D
A0A2V5TNH4      -----------------EEEPPA--KNNGEKKTPAGE-RAQL-----------------D
A0A2V5X5Q6      -----------------EEEPAA--KNNGEKKKPAGE-RAQL-----------------D
A0A2V2DJ66      -----------------PEIENQQEGRRQPPEVSHSDGEEKNS-----------------
R7L5A9          -----------------MESDEDEQPPEDVPPEMPSESKQ--------------------
A0A4P5QM05      -----------------KRDTPE-DRKKPEVAAA--------NADNEDAY----------
A0A4Q3C001      -----------------RTESPK-QASGQQPRRPAAAPTPASTGSKHGDY----------
B4DB23          -----------------RRGTPKIEAPAPQLARP--------RDTHREDY----------
A0A2V5URB2      -----------------ARLT---------------------------------------
A0A5R8KA81      -----------------PVAS---------------------------------------
A0A5B5WU87      -----------------PGK----------------------------------------
R7DZW0          -----------------AGK----------------------------------------
A0A2N8HID1      -----------------AGK----------------------------------------
A0A2N8HS06      -----------------AGK----------------------------------------
A0A3R5R2M8      -----------------RRNEPETAPEDSDKQ----------------------------
A0A411SUQ6      --------------------EPQQTSRKQDK-----------------------------
A0A2N8HZF2      --------------------KPQQTSRKQNK-----------------------------
A0A354E720      --------------------DPQQTARKRD------------------------------
B2UPB6          --------------------EPQQTSRKQDK-----------------------------
A0A2A2XXW5      -----------------RNKSADEPADKKSASEKSKSA----------------------
A0A2V6JLK8      -----------------RDKETHRRGRQKSRVAANGSADNGHIDTDEY------------
A0A2W5Z1A5      -----------------QDRQS-RRSRSR-AGVGAESNGASDNGRDEY------------
A0A2V6EA09      -----------------RGKET-RRGRSRKAAATVAHNGASGSDEDEY------------
A0A2V6GQI7      -----------------RGKET-RRGRSRKAAATVAHNGA--SDSDEY------------
A0A3C1HEJ2      -----------------KDHSPAAPAPKAANSGK--------------------------
A0A522ULD9      -----------------QESMPKPETVGGVTAAEVRKEST--------------------
A0A1V6JU76      -----------------RERAESRRQAVVESSGSTPAPHA--------------------
A0A1Q6UHJ9      -----------------DVEEEDSEGEEAQEGGESEDPENSENSK---------------
A0A2V2BXR0      -----------------DVEEEDSEGEEAQKGGESEDPENSENSK---------------
A0A2D8V0G3      -----------------SNEKKLGSKKGEGAKDGELVQGGKAGKDDEPSKA---------
A0A348S017      -----------------SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------
A0A3C1UUV7      -----------------SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------
A0A350I3V2      -----------------SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------
A0A520RGV5      -----------------SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------
A0A3D3XF90      -----------------SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------
A0A2D7B522      -----------------SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------
A0A356NIC2      -----------------SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------
A0A2N8HDG3      -----------------KNAHS--------------------------------------
A0A2U8DZK4      -----------------KSARTR-----------DKTAGDTINFSEKK------------
A0A2T6DFL8      -----------------GSRRTRRSARSDK--KPEAGGEDRLDLHE--------------
A0A1D8AWD4      -------------------HEKPVPGAAGAAGPNEARGSDRIEMRETREPERKR------
A0A4Q1C9S2      -------------------HEKP-----AVAGKAAERGAERLDLDEK---PRRR------
A0A178IH18      -----------------RDVRRRSRRHRSGRDRDDEADA-RETFTEPER-----------
A0A2T6DT99      -----------------HGRRRSRRSRRDDADGESDSRGDRIEYVERERRRSKE------
A0A1G3ZT33      -----------------GHKRRKSARTEAA--AVPAGGAERIVLDEPDSRRHG-------
A0A3E1E2T2      -----------------GSGRRRR---SAAKPKSPGRGGDELKLS---------------
B1ZMW1          -----------------GSHRRHRPGPSAAHQAAPAVEGDRLVLREPERKDPA-------
A0A3D1TI55      -----------------EERTPDRPKELDVGEAY--------------------------
A0A3R8IT45      -----------------GAEDAIDNSASNEEEDVVAPGSKS-------------------
A0A1H1MGC9      -----------------AKQDPGTVER---------------------------------
A0A2A2PYE8      -----------------SKNDTEQ-EK---------------------------------
A0A2T6CN73      -----------------SKGDTEQ-ER---------------------------------
A0A3E1ET42      -----------------TNAEARKPRQAAPAGGAP----QRPAPAKAGAGRGENEDY---
A0A2A2YDW8      -----------------AESELPQPQPSTSSRPATPS-------STASTSNQNDTLY---
A0A352XLN9      -----------------AESELPQPQPSTSSRPATPS-------STASTSNQNDTLY---
A0A3D0YP62      -----------------TTGDEIARDTATAAPAPS---------QQAQPARNDEDLY---
A0A3D3DV47      -----------------TTGDEIARDTATAAPAPS---------QQAQPARNDEDLY---
A0A2E5XJ49      -----------------SADPDPVA--GGSPGGPPGGGSRTVS-TS-APQDEDEALY---
A0A2E6SBY8      -----------------TADADPVP--XASPGGASAGRVRSAA-ASPSSQDDDGGLY---
A0A2E5QMS4      -----------------SSDVDPISSPPRKMTVST-GASPTAT-PSTPEEDDDGLSY---
A0A2E7YXQ3      -----------------SSDVDPISSPPRKMTVST-GASPTAT-PSTPEEDDDGLSY---
A0A2E3H787      -----------------SADADPVPGAGFEAAAES-ATAEATG-SSKDENDDDGLTY---
A0A2E7AGN1      -----------------SADADPVPGGGVTKSAER-ASVKTPG-GKNETDDEEGLTY---
A0A2E7AKY7      -----------------SADADPVPGGGVTKSAER-ATVKTPG-GKNELDDEKGLTY---
A0A3D4CU34      -----------------SADADPVPGGGVTKSAER-ASVKTPG-GKNETDDEEGLTY---
A0A2E8M146      -----------------SADSDPVPTVGATASATSGSALESKV-VANDSEEDEGLNY---
A0A355S8S2      -----------------SADSDPVPTVGATASATSGSALESKV-VANDSEEDEGLNY---
A0A2D6DVN8      -----------------SADSDPVPSVGATASGTS-AATESTV-ATSDEDKDEGLTY---
A0A3C1W2R2      -----------------SADSDPVPSVGATASGTS-AATESTV-AANDEDKDEGLTY---
A0A2E3NAY6      -----------------SADSDPVPTGGTTSSGTT-EAIESTV-ATNDADDDEGLTY---
A0A2E3II01      -----------------SADSDPVPTVGTTASGTS-AAIESAV-AATDADKDEGLTY---
A0A368B8C5      -----------------SADSDPVPTVGTTASGTS-AAIESAV-AANDADKDEGLTY---
A0A3R7RBB5      -----------------SADSDPVPTVGTTASGTS-AAIESAV-AANDADKDEGLTY---
A0A2A2QX62      ------------------AESQSLPSQGSSSAPAKPAPPRSTS-RGDAADDAKQDLY---
A0A4Q3BWH6      ------------------AESQPMPTQSGSQAPSQSPAPRSSS-RASSTDDSKQDLY---
A0A3N5WCF1      ------------------AEAQVVAP--PPGSSSAPSKPQAAATRGADS-----ELY---
A0A4Q3C1K5      ------------------AESQIGPPVSSPTSSTPAAKPQAPA-RGNDS-----ELY---
A0A2G4G428      -----------------AAGAAAKDDAGDAVASTENPEDNPKV-----------------
A0A139TV24      -----------------TNS----------------------------------------
A0A2N8HT11      -----------------NPS----------------------------------------
R7DS70          -----------------NPS----------------------------------------
A0A2N8HNL6      -----------------NPS----------------------------------------
A0A146GCJ0      -----------------NSVYGEKSV----------------------------------
A0A2T6D6H8      -----------------NGVYGAKAG----------------------------------
A0A5C9DC49      -----------------KGVYGATSSRG--------------------------------
A0A139TUL1      -----------------TAG----------------------------------------
A0A2N8HCB0      -----------------TDG----------------------------------------
A0A2N8HP04      -----------------TDG----------------------------------------
A0A2N8HRJ0      -----------------TDG----------------------------------------
A0A366HAG0      -----------------DGK-----GDGTMKAKRKTRQSTPAKGAKVKSPRAKADEVF--
A0A3M1I8A3      -----------------YRSRPDQIGAVRST-----------------------------
A0A4V0XS84      -----------------GEAKSSSVATDSDRANGASRSASFNGGGKSATVPLASTLATSP
A0A0R2XQ77      -----------------SQDVELEDELAGSVEPEME--PRS-------------------
A0A2E9IN28      -----------------HHEEELEEEMAGSVEPQSELGPKA-------------------
D5ENH7          -----------------HQEDEFEEELAGSVEPDKQ------------------------
A0A351WE84      -----------------DGQ-------------------EKVPAKTIAASADGKDSLF--
A0A1V5QDZ6      -----------------SDE--------------------SKPADELADTSNRKKDAL--
A0A4Y8P964      -----------------KAKDELQNKNETQNLSPFQSLRFLNGWVKKKSSDKTTDS----
A0A3D4HF88      -----------------GGSNPKA------------------------------------
A0A351MR11      -----------------AAD------------------------QGAEKPAPKKDPVV--
A0A5B5WI95      -----------------GSG--REAAGKN-------------------------------
A0A2N8I9W1      -----------------GSGEPRQTTRKQD------------------------------
A0A4Q5IH27      -----------------GSGEPRQTTRKQD------------------------------
A0A2N8IBZ6      -----------------GSGEPRQTTRKQD------------------------------
A0A2N8IJW9      -----------------GSGEPRQTTRKQD------------------------------
R6J100          -----------------GSGEPRQTTRKQD------------------------------
A0A1V6J089      -----------------RKYYGVVRHENDDNLTES-------------------------
A0A3C1BZR1      -----------------KKYYGSSKHDKEDDATEA-------------------------
A0A1H6KPB7      -----------------TEG-VEPSAALNPLPVTSRSSKRSEVAKKTESTDQPGDDLY--
A0A2E9ISN4      -----------------YGTRHIESAFLYGMESETPKNKRWKFR----------------
B9XAX1          -----------------RNGYKSIGVYGNDYPAKIPLNT---------------------
A0A5R8KKM9      -----------------DQR---GKKDRQPVANAPQKTLASLQSPKSEKNRTSYQDAF--
A0A139TS01      -----------------ESG---ASGGNADASSLKKAERSGKAKELAATQSNDNEDLY--
A0A3E1EJT7      -----------------PGG-----------------------------EPPVTSQSS--
A0A317ZP96      -----------------QQEEEFEHELEGEVEPEELQTKS--------------------
A0A2D5WGA5      -----------------KSR----EKEEESGDAAKDGKKEPKLLAKADVGGEDEKPKY--
A0A2E7SSH2      -----------------KSR----ETEEESTEDNKNGGND-KLIAQADIGGDDVKPKY--
A0A349GXM8      -----------------AYAYGYDYYYDEKGGNRRSRRQIRWRKQLEHAGAWIRKTLMPM
A0A4P5YP61      -----------------GKY--------------------------------GAKGVYGA
A0A5R1Q5N3      -----------------KEK--------------NEIQNKNQTQSLSPFHSLQFLNDWVQ
I0JYY7          -----------------KEK--------------NEIQNKNQTQSLSPFHSLQFLNDWVQ
A0A4R7S1J2      -----------------YGASA--------------------------------------
A0A2A2XV69      -----------------SKN------------VPEKSGQNAQAASPATTKPTPQSGEY--
A0A651H7X9      -----------------VTS-------------------------------EDEKEMR--
A0A4Y8P842      -----------------SDS-----------QEIMRKEKEG-------------------
B3DZK9          -----------------SNS-----------QELMRKEEEA-------------------
A0A5E6MPC4      ----------------------------------RLSEEQRRAEALRAPSQPPS------
A0A4V1SB02      -----------------KDGVYGSSVNPKKKRGKKANDEDAAWPESTPAVSPSQASRAKE
A0A3C1VB86      -----------------GNY------------GEKAADKTSDDTRGNLASEARPENLL--
A0A146G2Q9      -----------------KPQ--------QQKADKKPAKKAPVSAVQQLNGEKDQEDTY--
A0A2T6D3Y2      -----------------KPQ--------QQKADKKPAKKAPVSAVQQLNGEKDQEDTY--
A0A2V2SDV4      -------------------E-----------GTNDEEQEAAPGGPASQKS----------
A0A2V5PK75      -----------------VNE-----------D---QESAARPDEPAGDKARRA-------
A0A1V6DME1      -----------------RSS-----------ESSDKDEAAGEKKADDSQAKVEIKKKY--
A0A3D3DIJ3      -----------------RSE-----------E---QEPVVKEGAESGGKDKLDIKQKY--
A0A2D5VY59      -----------------KQD---------DSEGGSSAQPKTKSSKTASRGDVELKNKF--
A0A2D8UZZ4      -----------------KQD---------DSEGGSSAQPKTKSSKTASRGDVELKNKF--
A0A353DV86      -----------------KQD---------DSEGGSSAQPKTKSSKTASRGDVELKNKF--
A0A2E5EPT8      -----------------SSS----GSLNIDSKPRELKGKVDRQRGQDSSEEPDLKSKY--
A0A5C9DS93      -----------------NNA------DEPGANGKPPGKVDRRKPVAPATDAPTIKPKY--
A0A350EWA4      -----------------KQN---------DDDGDQSGRKNGHPATKDEPASRLDLKKY--
A0A5B5WZ91      -----------------ESG---ASDGNADASSLKKAERSGKAKELAATQSSDNEDLY--
A0A2N8HD92      -----------------DGG---SSGGNVDASSMKKAERSGKAKELAANQSHDSEDLY--
A0A2N8HIT2      -----------------DGG---SSGENADASSMKKAERSGKAKELAATQSHDSEDLY--
A0A354EBD3      -----------------DGS---SSGENAEASSMKKAERSGKAKELAATQSHDSEDLY--
A0A355VEB2      -----------------DGS---SSGENAEASSMKKAERSGKAKELAATQSHDSEDLY--
A0A2N8IMT3      -----------------DGS---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
R6K1U5          -----------------DGS---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
A0A2N8IWC2      -----------------DGS---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
A0A2N8I441      -----------------DGS---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
A0A2N8I3A6      -----------------DGS---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
A0A410SCC4      -----------------DGS---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
A0A3R5VEW0      -----------------DGA---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
A0A411SSG2      -----------------DGA---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
B2UKW3          -----------------DGA---SSGENADASSMKKVERSGKAKELAATQSHDSEDLY--
A0A1M6RLZ4      -----------------SEA-----------------PQEVRAAAQPQGAQSNSADLY--
A0A354T7G8      -----------------TNSPTGGAGGKTRRRKVKAETTANALTSPRTVSRPEGEDVF--
A0A2S7U4L6      -----------------GQN---------------KSAAAEATAKSSS-DSPKTNDLY--
A0A512MBZ2      -----------------NNQAAAPGEQPQKRRRRSDAPAAPNAAPSPA-SRAPQGDLF--
A0A2E8MEZ0      -----------------SSL-----EETGTPQQMTAAPASSKTEEKKS-ERSSSEDLY--
A0A4Q2YKS3      -----------------AEG-----QVGPPVNAETAPRQQKSGGREND-SELY-------
A0A2E3EC33      -----------------SNI-----DPNQKISSDKPKAPSSKEPKGSS-EEISIEDKF--
A0A2E4GN01      -----------------SNM-----DPNQKISSDKTKSSSSKESKSSS-EEISAEDKY--
A0A1Z8XU55      -----------------RNL-----DPNMNSNSDDLFKSGDKLASNDK-DNLTAEDKF--
A0A2E1RQR9      -----------------RNL-----DPNMNSNSDDLFKSGDKLASNDK-DNLTAEDKF--
A0A2E3ISQ4      -----------------RNL-----DPNMESDSIGSTKSESKVASNDQ-NNLSAEDKF--
A0A2D6W6F4      -----------------RNL-----DPDMESGSIGSPKAGSKLASNDQ-NNLSAEDKF--
A0A2D8Z5A8      -----------------RNL-----DPDMESGSIGSPKPGSKLASNDQ-NNLSAEDKF--
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      VIVRLTQAMGPIAPLVLREHISALGETLESFPQARLEELVQRLCKEIVTDSFRQQFEEEM
A0A2V5PST3      IVSKLRDAVGPMAGLIVEDHISLLGEARNRFPKNRLQELFDRICEEILDDKLKNDFQQSM
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      IKQKY-------------------------------------------------------
A0A2N9NTX7      IKPKY-------------------------------------------------------
B9XK55          IKPKY-------------------------------------------------------
A0A4P5YMI6      LNQKY-------------------------------------------------------
A0A2E6T482      DKPKY-------------------------------------------------------
A0A3C0DQZ7      DKPKY-------------------------------------------------------
A0A1Z9CBK5      VKPKY-------------------------------------------------------
A0A2D6ZI96      VKPKY-------------------------------------------------------
A0A358KGZ3      VNPKY-------------------------------------------------------
A0A2E9ZQX4      VXPKX-------------------------------------------------------
A0A3D5JZU0      VKPKY-------------------------------------------------------
A0A2E6HCR0      VKPKY-------------------------------------------------------
A0A1Z8WN04      VKPKY-------------------------------------------------------
A0A2D7L1N4      VKPKY-------------------------------------------------------
A0A2E2R937      VKPKY-------------------------------------------------------
A0A520QQY4      VKPKY-------------------------------------------------------
A0A2D5MR66      VKPKY-------------------------------------------------------
A0A2E0PDQ1      VEPKY-------------------------------------------------------
A0A2E2ZZP9      VEPKY-------------------------------------------------------
A0A2A2RGF2      IKPKY-------------------------------------------------------
A0A2G4I5Y6      IKPKY-------------------------------------------------------
A0A3M1I883      LKEKF-------------------------------------------------------
A0A1V6JZ45      LKTKY-------------------------------------------------------
A0A520RRW5      LKNKF-------------------------------------------------------
A0A356NPK0      LKNKF-------------------------------------------------------
A0A2D7B5P5      LKNKF-------------------------------------------------------
A0A3D3XGB5      LKNKF-------------------------------------------------------
A0A2V6F8A1      LKQKY-------------------------------------------------------
A0A2V5TNH4      LKQKY-------------------------------------------------------
A0A2V5X5Q6      LKQKY-------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A5C9DC49      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      RRPVGSEKSSFKMNRNS-------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      KA----------------------------------------------------------
A0A5R1Q5N3      EKIKRPDK----------------------------------------------------
I0JYY7          EKIKRPDK----------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A5C9DS93      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      -------
A0A2V5UHJ2      AKLTSDV
A0A2V5PST3      QEELRVL
A0A2V5PXM3      -------
A0A139SU05      -------
A0A1D8AZK8      -------
A0A1V5QB01      -------
A0A139SPN4      -------
A0A1V6E7N1      -------
A0A2D9MYT1      -------
A0A258ANJ7      -------
A0A139TLN4      -------
A0A290QGD9      -------
A0A1D8AS58      -------
I6AQC1          -------
W0ITH7          -------
A0A1G3ZFT0      -------
A0A1Z8ZMT6      -------
A0A2E8MCT7      -------
A0A290Q2Z2      -------
A0A2A2RGK2      -------
A0A2A2XXF7      -------
A0A2A2R5D6      -------
A0A1J4XH17      -------
A0A3C1VJ32      -------
A0A2N9NTX7      -------
B9XK55          -------
A0A4P5YMI6      -------
A0A2E6T482      -------
A0A3C0DQZ7      -------
A0A1Z9CBK5      -------
A0A2D6ZI96      -------
A0A358KGZ3      -------
A0A2E9ZQX4      -------
A0A3D5JZU0      -------
A0A2E6HCR0      -------
A0A1Z8WN04      -------
A0A2D7L1N4      -------
A0A2E2R937      -------
A0A520QQY4      -------
A0A2D5MR66      -------
A0A2E0PDQ1      -------
A0A2E2ZZP9      -------
A0A2A2RGF2      -------
A0A2G4I5Y6      -------
A0A3M1I883      -------
A0A1V6JZ45      -------
A0A520RRW5      -------
A0A356NPK0      -------
A0A2D7B5P5      -------
A0A3D3XGB5      -------
A0A2V6F8A1      -------
A0A2V5TNH4      -------
A0A2V5X5Q6      -------
A0A2V2DJ66      -------
R7L5A9          -------
A0A4P5QM05      -------
A0A4Q3C001      -------
B4DB23          -------
A0A2V5URB2      -------
A0A5R8KA81      -------
A0A5B5WU87      -------
R7DZW0          -------
A0A2N8HID1      -------
A0A2N8HS06      -------
A0A3R5R2M8      -------
A0A411SUQ6      -------
A0A2N8HZF2      -------
A0A354E720      -------
B2UPB6          -------
A0A2A2XXW5      -------
A0A2V6JLK8      -------
A0A2W5Z1A5      -------
A0A2V6EA09      -------
A0A2V6GQI7      -------
A0A3C1HEJ2      -------
A0A522ULD9      -------
A0A1V6JU76      -------
A0A1Q6UHJ9      -------
A0A2V2BXR0      -------
A0A2D8V0G3      -------
A0A348S017      -------
A0A3C1UUV7      -------
A0A350I3V2      -------
A0A520RGV5      -------
A0A3D3XF90      -------
A0A2D7B522      -------
A0A356NIC2      -------
A0A2N8HDG3      -------
A0A2U8DZK4      -------
A0A2T6DFL8      -------
A0A1D8AWD4      -------
A0A4Q1C9S2      -------
A0A178IH18      -------
A0A2T6DT99      -------
A0A1G3ZT33      -------
A0A3E1E2T2      -------
B1ZMW1          -------
A0A3D1TI55      -------
A0A3R8IT45      -------
A0A1H1MGC9      -------
A0A2A2PYE8      -------
A0A2T6CN73      -------
A0A3E1ET42      -------
A0A2A2YDW8      -------
A0A352XLN9      -------
A0A3D0YP62      -------
A0A3D3DV47      -------
A0A2E5XJ49      -------
A0A2E6SBY8      -------
A0A2E5QMS4      -------
A0A2E7YXQ3      -------
A0A2E3H787      -------
A0A2E7AGN1      -------
A0A2E7AKY7      -------
A0A3D4CU34      -------
A0A2E8M146      -------
A0A355S8S2      -------
A0A2D6DVN8      -------
A0A3C1W2R2      -------
A0A2E3NAY6      -------
A0A2E3II01      -------
A0A368B8C5      -------
A0A3R7RBB5      -------
A0A2A2QX62      -------
A0A4Q3BWH6      -------
A0A3N5WCF1      -------
A0A4Q3C1K5      -------
A0A2G4G428      -------
A0A139TV24      -------
A0A2N8HT11      -------
R7DS70          -------
A0A2N8HNL6      -------
A0A146GCJ0      -------
A0A2T6D6H8      -------
A0A5C9DC49      -------
A0A139TUL1      -------
A0A2N8HCB0      -------
A0A2N8HP04      -------
A0A2N8HRJ0      -------
A0A366HAG0      -------
A0A3M1I8A3      -------
A0A4V0XS84      -------
A0A0R2XQ77      -------
A0A2E9IN28      -------
D5ENH7          -------
A0A351WE84      -------
A0A1V5QDZ6      -------
A0A4Y8P964      -------
A0A3D4HF88      -------
A0A351MR11      -------
A0A5B5WI95      -------
A0A2N8I9W1      -------
A0A4Q5IH27      -------
A0A2N8IBZ6      -------
A0A2N8IJW9      -------
R6J100          -------
A0A1V6J089      -------
A0A3C1BZR1      -------
A0A1H6KPB7      -------
A0A2E9ISN4      -------
B9XAX1          -------
A0A5R8KKM9      -------
A0A139TS01      -------
A0A3E1EJT7      -------
A0A317ZP96      -------
A0A2D5WGA5      -------
A0A2E7SSH2      -------
A0A349GXM8      -------
A0A4P5YP61      -------
A0A5R1Q5N3      -------
I0JYY7          -------
A0A4R7S1J2      -------
A0A2A2XV69      -------
A0A651H7X9      -------
A0A4Y8P842      -------
B3DZK9          -------
A0A5E6MPC4      -------
A0A4V1SB02      -------
A0A3C1VB86      -------
A0A146G2Q9      -------
A0A2T6D3Y2      -------
A0A2V2SDV4      -------
A0A2V5PK75      -------
A0A1V6DME1      -------
A0A3D3DIJ3      -------
A0A2D5VY59      -------
A0A2D8UZZ4      -------
A0A353DV86      -------
A0A2E5EPT8      -------
A0A5C9DS93      -------
A0A350EWA4      -------
A0A5B5WZ91      -------
A0A2N8HD92      -------
A0A2N8HIT2      -------
A0A354EBD3      -------
A0A355VEB2      -------
A0A2N8IMT3      -------
R6K1U5          -------
A0A2N8IWC2      -------
A0A2N8I441      -------
A0A2N8I3A6      -------
A0A410SCC4      -------
A0A3R5VEW0      -------
A0A411SSG2      -------
B2UKW3          -------
A0A1M6RLZ4      -------
A0A354T7G8      -------
A0A2S7U4L6      -------
A0A512MBZ2      -------
A0A2E8MEZ0      -------
A0A4Q2YKS3      -------
A0A2E3EC33      -------
A0A2E4GN01      -------
A0A1Z8XU55      -------
A0A2E1RQR9      -------
A0A2E3ISQ4      -------
A0A2D6W6F4      -------
A0A2D8Z5A8      -------
                       

© 1998-2020Legal notice