BYKdb

Dataset for cluster tadcd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

244 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2A2XVF1      MSKRVDFPRRAFCEFRGIFVRFVFLFLIGMSVAAEPSNEYKLAPNDLLDFRVFQEPELDA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      VVRVSGDGQAIFPLVGGVAIAGASISEAIELIKSRYRDGYLKNPQVTLTVRSYAKKLFTI
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      --------------------------------------------------MSEENPNTGS
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      LGQVQQPGSYDIQSQIRGMSPLSVSRMVVSASSSLTRNAWRAVMKKPRSSSRREMSSPSA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ---------------------------------------------------------MRP
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------MKDNHS
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A290QGD9      -------------------------------------------------------MNPPA
A0A1D8AS58      -------------------------------------------------------MENAP
I6AQC1          -------------------------------------------------------MDSQA
W0ITH7          -------------------------------------------------------MDSQA
A0A258ANJ7      ----------------------------------------------------MSMKMMSS
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------MLWWSR
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      -----------------------MSSISHLPVQSWSPTAFIGFSQPSCTSGPVSLLLDNK
A0A2V2DJ66      -----MENSDSKTPAQDGASQNAPSSQGAKSVRKKRNSGYGYG--YNYSAYGNYGGYGGY
R7L5A9          -----MESSNN--------NNSQPDSAPTKVIKKKIVASYGSGGYGGYGGYGDYGGYGAY
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      --------MPLNGTAGVSPGLALLWPWSPCACNGHSAAFSSGLIIPVNGNIGTVRLYRTD
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ---------------------MENTESKDNSGQKTVKRVIKKRIISDAAGAYGYGPGYGG
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      --------------------------------------------------MDPSQSAQTQ
A0A2A2PYE8      --------------------------------------------------MSSESGEKQS
A0A2T6CN73      -------------------------------------------------MAAEQEKHAPG
A0A2G4G428      TNSSSSSGSASGTNNTSRGSQRRGYGGGGYGGNYGGGYGGGYGGNYGGGYGGGYGGGYGG
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ----------------------------------------MKNDYVRGGADPNSGGYGGY
A0A0R2XQ77      ----------------------------------------MKNDYVRGAPDPNSGGYSGY
A0A2E9IN28      ----------------------------------------MKNDYVRGGADPNTGGYGGY
A0A6N4WTJ5      ----------------------------------------MKNDYVRGAPDLNSGGYGGG
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ----------------------------MRNTTESMVQDPQEEASKRKPNYHNYHSYHNH
A0A6N6ZHN8      ---------------------------------------------------------MSK
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      -----------------------------------------------------------M
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ---------------------------------------------------------MSQ
A0A4Y8P842      -----------------------------------------------------------M
B3DZK9          -----------------------------------------------------------M
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      -----------------------------------------------------MGVFLFL
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      SPYFKMLDPSRPPAEKRFGSVLPTIHSSLDEVGTALDL-------------RRIYHLLL-
A0A2V5UHJ2      -------------MEQVNQPSPYFIRRTLRPENQTIDLHEFSVVEDQVLPLRDYWLIIK-
A0A2V5PST3      PYNMRTYFPENDTQRPALPDSSESDYAYYGSEEERVQL-------------LDYWKNLV-
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      --------------MENILRPPRPPTAGDAPAQPVSIGSPPPAKGFGIADLKHYFHIVV-
A0A1J4XH17      NKNEPEDQKSYGGYYNGYGSYSYGYGSGAYEENNQRNI-------------KDYLLILR-
A0A7C5LI63      ----------------------MFNQTPAEARPEAVDI-------------KEYLAVLL-
A0A7C5P291      --------------------MAMTGPNPSESRAESVDI-------------KEYLAIIL-
A0A139SU05      ----MAEPAGSSPTPPVPLGAAPSSSAADAPVEQRRSL-------------RDYYVILR-
A0A139SPN4      -----------------------------MPAGQSRSL-------------RDYYVILR-
A0A1V6E7N1      -------------MADVSAKSTHHSPGKDEEVVERRTL-------------RDYLIILR-
A0A2D9MYT1      -----------------MXQXPFNESREEGLFEESINL-------------RHYWHIVL-
A0A290QGD9      SPAPHGGPDQAPESPYGYGAYQQPP-----DGPQQRGF-------------QDYVLILR-
A0A1D8AS58      KADKVQGPGEA-YPAYYGGGQGGYGVLGQGESQMHRSM-------------QDYLLILR-
I6AQC1          KQPK---ASDG-RAEYGYGGYNEYPGYGN-EASGQRTL-------------SDYLLILR-
W0ITH7          KQPN---PSDG-RAEYGYGGYNEYPGYGN-EASGQRTL-------------SDYLLILR-
A0A258ANJ7      PSPKASFNTMQPTSLSLPQSPMEMTQRLEADSESSSSF-------------MNPAQLVDG
A0A139TLN4      ----------------MKSSSPKPDSLETEGGASVSLF-------------PSPRALLAR
A0A1G3ZFT0      --------------------MNTLTHGKANQENIEIDF-------------VALFHQLL-
A0A1Z8ZMT6      -----------------------MAKLRSTPEPVDSYYDEAQAEIKKSPGLFDLAYLLPR
A0A2E8MCT7      -----------------------MAKLRSAPGPVDSYYQETKADIKKSPGVFDLAYLLPR
A0A290Q2Z2      RVWWWRPEKTSLLTGGEGNSLAARSMAHTHVSKEGASL-------------ADFFHLLR-
A0A2A2RGK2      -------------MSTDKVIQPRPPESAPP--IESIDW-------------REYFHAVI-
A0A2A2XXF7      -------------MNKETDLKKPPSASPPPPSQEGIDW-------------REYFHAVV-
A0A2A2R5D6      --------------------------MAAPASEVSLHF-------------LDYWRVIR-
A0A3C1VJ32      ----------------------MDQVTTSAAPEARLHF-------------LDYWRVIR-
A0A2N9NTX7      ----------------------MDPIPVPPPQESKLHF-------------LDYWRIIR-
B9XK55          ----------------------MDPLKTSAPPEAKLHF-------------LDYWRIIR-
A0A4P5YMI6      ----------------------MEAEAISSQPETKLHF-------------LDYWRIIR-
A0A2E6T482      ----------------------MDKIPTTDQSSDKLHI-------------LDYWRILR-
A0A3C0DQZ7      ----------------------MDKIPTTDQSSDKLHI-------------LDYWRILR-
A0A1Z9CBK5      ----------------------MERNTGSDQSSDKLHI-------------LDYWRIIR-
A0A2D6ZI96      ----------------------MERNTGSDQSSDKLHI-------------LDYWRIIR-
A0A358KGZ3      ----------------------MEPTSRKENSSDKLHI-------------LDYWRIIR-
A0A2E9ZQX4      ----------------------MEPTSRKENSSDKLHI-------------LDYWRIIR-
A0A3D5JZU0      ----------------------MEPTSGKENSSDKLHI-------------LDYWRIIR-
A0A2E6HCR0      ----------------------MDNNSGSEQSSDKLHI-------------LDYWRIIR-
A0A1Z8WN04      ----------------------MDNTSGSEQSSEKLHI-------------LDYWRIIR-
A0A2D7L1N4      ----------------------MDNTSGSEQSSEKLHI-------------LDYWRIIR-
A0A2E2R937      ----------------------MDNTSGSEQSSEKLHI-------------LDYWRIIR-
A0A520QQY4      ----------------------MDNTSGSEQSSEKLHI-------------LDYWRIIR-
A0A2D5MR66      ----------------------MDKTSGLEQSSDKLHI-------------LDYWRIIR-
A0A2E0PDQ1      ----------------------MDKTSGSEQSSDKLHI-------------LDYWRIIR-
A0A2E2ZZP9      ----------------------MDKTSGSEQSSDKLHI-------------LDYWRIIR-
A0A7C4LRK7      -----------------MDAAKNNSANTPAAADTSLHF-------------LDYWRIIR-
A0A2A2RGF2      -----------------MDAAPKPTDSAPATPENRLHF-------------LDYWRIIR-
A0A2G4I5Y6      -----------------MDAAPHQAEPAPATPENRLHF-------------LDYWRIIR-
A0A6N6PS97      ------------------MEAAKFVPQDTATQESKLHF-------------LDYWRIIQ-
A0A3M1I883      ----------------------MQSTSSSARPQTEFHF-------------LDYWRIIR-
A0A1V6JZ45      ----------------------MDATKPNPISDSQLHF-------------LDYWRIIR-
A0A7C7Z746      -----------------MELSNSSNNQQINRPASKLHF-------------LDYWRIIR-
A0A520RRW5      -------------------MQTKPSQQPQQQSDSKLHF-------------LDYWRIIR-
A0A356NPK0      -------------------MQTKPSQQPQQQSDSKLHF-------------LDYWRIIR-
A0A2D7B5P5      -------------------MQTKPSQQPQQQSXSKLHF-------------LDYWRIIR-
A0A3D3XGB5      -------------------MQTKPSQQPQQQSDSKLHF-------------LDYWRIIR-
A0A2V6F8A1      ---------------------MEAPKTNSNPVETKLHF-------------LDYWRIIR-
A0A2V5TNH4      ---------------------MEAAKTNSNPVETKLHF-------------LDYWRIIR-
A0A2V5X5Q6      ---------------------METAKTNSNPVETKLHF-------------LDYWRIIR-
A0A4P5QM05      ---------------------------MTESNEAKLHF-------------LDYWRVVK-
A0A4Q3C001      ---------------------------MIDSSEVKLHF-------------LDYWRVIR-
B4DB23          ---------------------------MNDSNEVKLHF-------------LDYWRIIR-
A0A6B3L938      -----------MKKEIDPFSDDAVAEGSDAGSNVPVSN-------------RSAAGLIQV
A0A2V5URB2      EGPMKEISPHRARATMLLEDADLVSEPRLIESDEAPSL-------------RDYWQIVR-
A0A2V2DJ66      YGGYGAYGGYGG-----YGYGTNPAASGEGAEAPNRTL-------------RDYFMILR-
R7L5A9          GGGYGGYGGYGGSYGGYYGGYNSKNPAGEGG-VPNRTF-------------RDYMMILR-
A0A5R8KA81      -----------------MRKSPASSRKIQYDSTTAFTY-------------SDIFHVLR-
A0A5B5WU87      ----------------MNDLSPKKESLDAVGAASVSLF-------------PSPKAILGR
R7DZW0          ----------------MKDLSPKKETLDVGGAAPASLL-------------PSPRAIMGR
A0A2N8HID1      ----------------MKDLSPKKESLDAGGAAPVSLL-------------PSPRAIMGR
A0A2N8HS06      ----------------MKDLSPKKESLDAGGAAPASLL-------------PSPRAIMGR
A0A6N2TNT9      ----------------MKDLSPKKESLDAGGAAPASLL-------------PSPRAIMGR
A0A3R5R2M8      ------------------MNAAPNTTSPMEEEESSFSL-------------DTVLVILR-
A0A411SUQ6      SPGVQYFHTTFHPLSSMTNNTAPTPPVTENTEETALSL-------------DTVLTILR-
A0A2N8HZF2      ----------------MTNNTAPTPPVTENTEETALSL-------------DTVLTILR-
A0A354E720      ----------------MTKNTAPTPPGTENTEETALSL-------------DTVLMILR-
B2UPB6          ----------------MTNNTAPTPPVTENTEETALSL-------------DTVLTILR-
A0A2V6JLK8      ----------------MGGSPPKGPTGMAHNEEVKLHF-------------LDYWRVIR-
A0A2W5Z1A5      ---------------------------MAETDEGKLHF-------------LDYWRVVR-
A0A2V6EA09      ---------------------------MAHNDEVKLHF-------------LDYWRVVR-
A0A2V6GQI7      ---------------------------MAHNDEVKLHF-------------LDYWRVVR-
A0A3C1HEJ2      ----------------MATPSNYLPGDEGPEASSAVDL-------------PSARTLI--
A0A522ULD9      -------------------------MADKEAPEVGLHF-------------LDYWRVVR-
A0A1V6JU76      -------------MSYSYYTSQAAPPEASESSSSNLNL-------------RHYWNIVL-
A0A2A2XXW5      ----------------MEEQFQSQQGNSMSGADPSINL-------------RQYWHVIL-
A0A6N6Q6V0      -----------------MDNSQPNPIRSAGGTD-SRQL-------------RHYWQVML-
A0A1Q6UHJ9      GYGGGYGGGYGGGGYGYGYGYGGGQGEGGSPERPNRTF-------------RDYMMILR-
A0A2V2BXR0      ------------------------------------------------------MMILR-
A0A2D8V0G3      ------------------MEFQQSSQATETSVAENLNL-------------RHYWHILL-
A0A348S017      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A3C1UUV7      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A350I3V2      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A520RGV5      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A3D3XF90      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A2D7B522      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A356NIC2      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A2N8HDG3      ----------------MPDTSAPPAVPPAEESESSLSL-------------DVITGILL-
A0A146GCJ0      ---------------------MPKDDGENLTSKPAVNLSFRDDTHGDLFDSERWFNLLR-
A0A2T6D6H8      ---------------------MVNKGAENKDRKSAAQVTLLRELSGEVIDFERLLNLLR-
A0A3D1TI55      --------------------------MDEKQQDSSLHF-------------LDYWRVIR-
A0A3E1ET42      --------------------------MREQLNESKMHA-------------LDYWQVIR-
A0A2A2YDW8      ------------------------MQPQSSNSEAALHA-------------VDYWQVIK-
A0A352XLN9      ------------------------MQPQSSNSEAALHA-------------VDYWQVIK-
A0A3D0YP62      -----------------------MQPQNSQQNEASLHA-------------IDYWQVLK-
A0A3D3DV47      -----------------------MQPQNSQQNEASLHA-------------IDYWQVLK-
A0A2E5XJ49      --------------------MQNDLDRQSAASEASLHA-------------VDYWQVLK-
A0A2E6SBY8      --------------------MQNDPDRQPAASEASLHA-------------VDYWQVLK-
A0A2E5QMS4      --------------------MQNDPDRQTAASEASLHA-------------VDYWQVLK-
A0A2E7YXQ3      --------------------MQNDPDRQTAASEASLHA-------------VDYWQVLK-
A0A2E3H787      --------------------MRNGPDRQTSASEAALHA-------------VDYWQVLK-
A0A2E7AGN1      --------------------MRNGPESQTNASEAALHA-------------VDYWQVLK-
A0A2E7AKY7      --------------------MRNGPESQTNASEAALHA-------------VDYWQVLK-
A0A3D4CU34      --------------------MRNGPESQTNASEAALHA-------------VDYWQVLK-
A0A2E8M146      --------------------MPNGPERQTNASEAALHA-------------VDYWQVLK-
A0A355S8S2      --------------------MPNGPERQTNASEAALHA-------------VDYWQVLK-
A0A2D6DVN8      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A3C1W2R2      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A2E3NAY6      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A2E3II01      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A368B8C5      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A3R7RBB5      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A2A2QX62      ------------------------MNPTTNTSEASLHA-------------IDYWQVAK-
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      -----------------------MNTSAPQQNEAALHA-------------VDYWQVIK-
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      PNDGRYGYGY-QEYPGY----------GNENAAGHRTL-------------GDYLLILR-
A0A2A2PYE8      QNSSGYGYNYGGNYAGYSAVGYGYGEGGGGGSHSQRTF-------------QDYLLILR-
A0A2T6CN73      ESGGGYSYGTGGNYAGYSAAGYGYGD-AGESSTIQRTF-------------QDYLLIVR-
A0A2G4G428      GNYGGGYGGGYGRQRGGYGGGYGGGYGEGSSKDTEVSI-------------STYVNMVR-
A0A6N6PCD8      ----------------MATRPSTKATQPPASEAKLIDL-------------HAWFFLLR-
A0A139TV24      ---------------MPQPTVPPVSSPAPETPDSSLSL-------------DIVAIILR-
A0A2N8HT11      ---------------MPDTPAPPAAPPA-EEPESSLSL-------------DVITSILL-
R7DS70          ---------------MPDTPAPPAAPPA-EEPESSLSL-------------DVITSILL-
A0A2N8HNL6      ---------------MPDTPAPPAAPPA-EEPESSLSL-------------DVITSILL-
A0A6N6PAZ1      ---MPPLHRSNRQFLDRDDASDDSPEPDSAHADGQDKT-------------KRLMLNLL-
A0A6I1K459      -----------------MEPFEQPRAGDVSPEAGTLFN-------------RNLWHAFM-
A0A139TUL1      ----------------------MSIPVIQPEDNDIFSF-------------RFIFSTAR-
A0A2N8HCB0      ----------------------MPVSVIQPEDNDIFSF-------------RFIFSTAR-
A0A2N8HP04      ----------------------MPVSVIQPEDNDIFSF-------------RFIFSTAR-
A0A2N8HRJ0      ----------------------MPVSVIQPEDNDIFSF-------------RFIFSTAR-
A0A6N2U9Y7      ----------------------MPVSVIQPEDNDIFSF-------------RFIFSTAR-
A0A366HAG0      -------------------------MATPNNLELQRHA-------------LDYWQIIR-
A0A2U8DZK4      -------------------------MAYSDPVKESAPL-------------PAFLQTLN-
A0A2T6DFL8      -------------------------MANVHAAPVGASV-------------AGFLQILR-
A0A1D8AWD4      -------------------------MPTLPSTKDSATL-------------GDFVGLLR-
A0A4Q1C9S2      -------------------------MAFSPVSKDSATL-------------GDFVGLLR-
A0A178IH18      -------------------------MARPDSSSETAAL-------------PEFFQVLR-
A0A2T6DT99      -------------------------MASTHASREGASL-------------ADFFQLLR-
A0A1G3ZT33      -------------------------MASIITSRDGGSL-------------TDFFNILR-
A0A3E1E2T2      -------------------------MAQPSASKDSATL-------------ADFLRLLR-
B1ZMW1          -------------------------MVPTSASKDSASL-------------ADFMQLLR-
A0A3M1I8A3      ---------MAYQAYPQTAPADPVSLPPAGGAMGSMTL-------------RHYWHVLL-
A0A4V0XS84      -------------------MNSKGNLTQSKSLADKIDF-------------NEYWNVLR-
A0A351WE84      ------METSEATRASLVILGCGVKFMADSQQDTALHF-------------LDYWRVIK-
D5ENH7          G-------YGYGGGSYGYGGYGSGGGGAGYEQGPQRSA-------------KDYLLMFR-
A0A0R2XQ77      G--------GYGSNSYSDGGYGAGGY--GAGGAPQRSF-------------KDYFLMFR-
A0A2E9IN28      G-----YGYGYGGGYGYGGYGAGGGYGEGGGGAPQRSF-------------KDYFLMFR-
A0A6N4WTJ5      GYGGGSYGYGYGSGYGDGGSYGGGGY---GSGAPQRSF-------------KDYFLMFR-
A0A1V5QDZ6      -------------------------MEQQPSDSSGLHF-------------LDYWRVIR-
A0A4Y8P964      --MSEEIQRIPDQNFPSGQIQDPNSNLTAIPSDPYYSF-------STGQWLKDRLKEIY-
A0A3D4HF88      GYHGYHGYGGHGGAGYGGYGYGYGDDYSTQHRQPPRTF-------------RDYIFILR-
A0A6N6ZHN8      EGKGYGYGYGGGGYYGGYYYGDGYGGYAEAAVSPSRTL-------------KDYFLMLR-
A0A6G6K641      --------------MRSKNSDIEDDEDDVKGSGEGLSW-------------RVYYQALK-
A0A5B5WI95      -----------------MVNRPSPSPPVMEEEESNLSL-------------DLALAILR-
A0A2N8I9W1      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A4Q5IH27      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A2N8IBZ6      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A2N8IJW9      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A7G6DX28      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
R6J100          -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A1V6J089      --------------------------MAEESQTTALHF-------------LDYWRVIR-
A0A3C1BZR1      --------------------------MAEESQTTALHF-------------LDYWRVIR-
A0A7C4KLL2      -------MVAPSQPHQSTQPIHYMPAPDITAPESPSEL-------------RTIAGILA-
A0A1H6KPB7      ----------------------MSSPAINQKSEASLHA-------------GDYLQILR-
A0A2E9ISN4      -----------MQIPNSTISESKPPTPADNDRETTTAF-------------SNPWALVQL
B9XAX1          ---------------MKLRLSNEREIAEMTEVDRPLDV-------------QEFLQTLI-
A0A5R8KKM9      -------------------------MNPSPPQEHRQHA-------------LDYWQIIR-
A0A139TS01      -----------------------MNAPDQQNGDPIVRN-------------IDYIQVLK-
A0A3E1EJT7      -------MNPPSPYARSSYAPVNPDFTDGEEPEDNDYL-------------RRWWVMVL-
A0A7C3I5X9      ----------MDYDLDRMGTAQGLPGEAEGAGGSKVNL-------------RHFWYVLL-
A0A2D5WGA5      ----------------------MDKLPKTDQSSDKLHI-------------LDYWRIIR-
A0A2E7SSH2      ----------------------MERKPGTEHSSDKLHI-------------LDYWRIIR-
A0A349GXM8      -------------------MATPRPGGGVSTEENKIDF-------------RIYLSVML-
A0A4P5YP61      ------------------MIQNRSESEFDQEAGSSVDL-------------RQIYHVFL-
A0A6B2LYM4      SNNQYQSGGSQGGYYGGYYYGEGYSGYADSGNAPSRSL-------------TDYLLILR-
A0A6D1VXB3      ---MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSF-------STGEWLKERFNEIY-
I0JYY7          ---MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSF-------STGEWLKERFNEIY-
A0A4R7S1J2      ----------------------MSLSSLPPQGPTRLNLPKTFSQDLESEADFDWRGLLI-
A0A2A2XV69      ------------------------MMNSSDSNEIQLHF-------------LDYWRVIR-
A0A651H7X9      QPPHQEPESTRPTPHRYAYSDSGIDSSPYGEGGPQRSI-------------KDYILILR-
A0A4Y8P842      SEELQKKPEDVLAVGSKEALPTEVLLSPYESSDLDWIK-------------QKLWDIYR-
B3DZK9          SEELQKKPKDNLTVGNKDVFQTEVLLSPYESSDLEWLK-------------EKLWDIYR-
A0A5E6MPC4      ----MEEIQPRPRESLGPLASGALPLEVSEEGSGWESV-------------RSLLSDVN-
A0A6N6PKP9      ----MERRIGPDPTLVLICIPMPRSTEKQPNSSLATDL-------------RGLYFALR-
A0A6N6Z250      -----------------------MSAAGADPHSEPLSL-------------GEVLRILR-
A0A4V1SB02      -----------------------------------MNP-------------LHYLYLFL-
A0A6N6QEJ2      -----------------MEAIKTQASAASGISDSKLHF-------------LDYWRILR-
A0A3C1VB86      --------------MPNPDPLDLPPSLETSAPGSISDL-------------HGVIRLLL-
A0A146G2Q9      -----------------------MSLESPDSGEIKLHF-------------LDYWRVIR-
A0A2T6D3Y2      -----------------------MSFESPDSGEIKLHF-------------LDYWRVIR-
A0A6N6P5E3      -------------------MQSNIQTTESGTGEIKLHL-------------LDYWRVVR-
A0A2D5VY59      ----------------------MQSKPVPQQSDSKLHF-------------LDYWRIIR-
A0A2D8UZZ4      ----------------------MQSKPVPQQSDSKLHF-------------LDYWRIIR-
A0A353DV86      ----------------------MQSKPVPQQSDSKLHF-------------LDYWRIIR-
A0A2E5EPT8      ---------------------MEYQSNGPTSSDNRLHF-------------LDYWRILR-
A0A6J4HTK1      ---------------------------MAQTDEVKLHF-------------LDYWRVVR-
A0A6N6PHJ5      ---------------------MEPLKQQ-AQQESRLHF-------------LDYWRIIR-
A0A6M1RXR2      ---------------------MEPNKVATPPPETKLHF-------------LDYWRIIR-
A0A7C3DXS4      ---------------------MDATKVATPPPETKLHF-------------LDYWRIIR-
A0A2V2SDV4      ---------------------MDPIKAA-APQDSKLHF-------------LDYWRIIR-
A0A2V5PK75      ---------------------MDPLKVP-ASQETKLHF-------------LDYWRIIR-
A0A1V6DME1      ---------------------MDPLKTT-PPPETKLHF-------------LDYWRIIR-
A0A3D3DIJ3      ---------------------MDPLKVA-PPQEAKLHF-------------LDYWRIIR-
A0A6I1K583      -----------------MDAASNYATPAAGTPENRLHF-------------LDYWRIIR-
A0A350EWA4      -----------------------MDSFKQDQPTASLHF-------------LDYWRIIR-
A0A5B5WZ91      -----------------------MNAPDLQNGDPIVRN-------------IDYIQVLK-
A0A2N8HD92      -----------------------MNSQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8HIT2      -----------------------MNAQDQQNSDRIVRN-------------IDYLQVLK-
A0A354EBD3      -----------------------------------VRN-------------IDYLQVLK-
A0A355VEB2      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8IMT3      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
R6K1U5          -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8IWC2      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8I441      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8I3A6      -----------------------MNAQDQQNSDRIVRN-------------IDYLQVLK-
A0A410SCC4      -----------------------MNAQDQQNSDRIVRN-------------IDYLQVLK-
A0A3R5VEW0      -----------------------MSVQDQQNSDRIVRN-------------IDYLQVLK-
A0A411SSG2      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
B2UKW3          -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A7C3HWX0      ---------------------MDTSKTSSAPQDSPLHF-------------LDYWRIIR-
A0A1M6RLZ4      ----------------------MQQNNSLNPSEASLHA-------------VDYWQIVK-
A0A7C4KPD7      --------------------MDSTKSFGTPQAETKLHF-------------LDYWRIIR-
A0A354T7G8      --------------------------MNETGSEFQKHA-------------MDTWQVVK-
A0A512MBZ2      --------------------------MSEAGKDIQAQA-------------IDSWQIIR-
A0A2E8MEZ0      ------------------------MQGTNFRNADDAPS-------------VDYWQVVK-
A0A6B3LBV6      ---------------MANPPYFNPNRFQQNSQESGPQV-------------GDYWQVIR-
A0A2E3EC33      ---------------------------MAKQSETKLHA-------------LDYWQVIR-
A0A2E4GN01      ---------------------------MAKQSETKLHA-------------LDYWQVVR-
A0A1Z8XU55      ---------------------------MAKQSETKLHA-------------LDYWQVAR-
A0A2E1RQR9      ---------------------------MAKQSETKLHA-------------LDYWQVAR-
A0A2E3ISQ4      ---------------------------MAKQSETKLHA-------------LDYWQVAR-
A0A2D6W6F4      ---------------------------MAKQSETKLHA-------------LDYWQVAR-
A0A2D8Z5A8      VEKTSECSYFADSKFILNSPQIKYIXTMAKQSETKLHA-------------LDYWQVAR-
A0A4Q2YKS3      -----------------------MQSPSTQQSEAALHA-------------VDYWQVIK-
A0A6N6P3T8      -----------------------MPTPPPQQSETALHA-------------FDYWQVIK-
                                                                            

A0A2A2XVF1      --QRWWVITLLVGVSMMAATGYV-MRQP--KIYESRAVLQV---QQSEQQV-------VN
A0A2V5UHJ2      --RHRWLILSCALALFIGATLYT-FTRT--PLYTADATLLI---ERKAPQILKLQDARAD
A0A2V5PST3      --KRRRIIIQIFIIFLLVGAYFT-FTAT--PVYKATATLKI---EPINPMVTGVTGVGES
A0A2V5PXM3      ------------MVAAIGTTTYL-LRAP--KIYASKLVLQV---EQEEQKILNI----QR
A0A1V5QB01      --KRIWLVALCFVLSLTVMVAIL-VRQV--PVYRCRVTLLM-----------------SK
A0A1J4XH17      --ERVWLLVFVFAIIFLGSIIYL-IKAT--PIYEAEAMLQI---LRDDTTV-------LG
A0A7C5LI63      --KRKWLILVCFLLSMAGATVFL-FTRQ--PIYRANARLLV---TTAG-SL-------PT
A0A7C5P291      --KRKWLVLICFLLSMAASTAFL-FTRQ--SIWRANCKLLV---TSAGAAL-------PS
A0A139SU05      --ERFWIALPLALLVSLVIGYYQ-ARQT--PMYASTAIIQF-----------------ER
A0A139SPN4      --ERFWIALPLALLVALGIGYYQ-ARQT--PMYASTAIIQF-----------------ER
A0A1V6E7N1      --ERLWIALPIALLVAVGIGYYQ-SRAT--PLYQSRATLRF-----------------EK
A0A2D9MYT1      --ERRWLVAATFLVVIILTAFYL-FSAT--PIFSATTRLQI---DRETENA-------LR
A0A290QGD9      --ERIWYILAVFLVIFSCVLVYT-LTQT--KIYQSRSLIQI---LRRDPAV-------LK
A0A1D8AS58      --ERVWYIVLVFALVFSAAVIFT-FTRV--PRYTSVASVQV---FRNDPVV-------MQ
I6AQC1          --ERIWYIVVVFLVIFSSALVYT-FSQT--KIFSSSATVQI---MRRPAMT-------LP
W0ITH7          --ERIWYIVVVFLVIFSSALVYT-FSQT--KIFSASATVQI---MRRTAVT-------LP
A0A258ANJ7      MRRHSWIPITLSLFGLILGYAYF-KRQK--PVYEAVSVAQFGSEQSSLLGLNSM------
A0A139TLN4      IIRNWYWCLLSLCICLPLAYLYA-ARLP--FVYGKATTVLI---KNDYPKESVATTVLAT
A0A1G3ZFT0      --EHKWLIAVIIAISLMGGKYYA-SKQI--PVYNPDVLIQV---ESNRGVSGLTIGLPGM
A0A1Z8ZMT6      LIARWHWILIGSLLGVVLGVITI-RMSV--PEYRSTATVRVKSQNSGSMGNSSDSDDIDL
A0A2E8MCT7      LIARWHWILIGILLGVVLGVINI-RMSV--PEYRSTATVRVKSQNSGSMGNSSESEDIDL
A0A290Q2Z2      --LRKALIFLILSLVVITTVVVT-AFLP--KWYLSTLNVRV---EKPEGEVKLF------
A0A2A2RGK2      --DRLWIVILCVILGGIYAGFTL-SKIE--TTYRARAVLFI---EQDQARILD-----PR
A0A2A2XXF7      --DRLWIVILCVVVGGIYAGVTL-SKVE--TTYRARAVLFI---EQDKSRILD-----AK
A0A2A2R5D6      --NRAAIIVTVLLLTLMTGYVVTVYVMQ--KMYDAKAQLRV---YKEKSDV-------EF
A0A3C1VJ32      --IRKAIIITVFLITAIIATAVT-LILP--ESYASTARIKV---ENEGGIVS------GM
A0A2N9NTX7      --IRKTVILAVFLLVVITATVVT-FILP--PKYKSMARIKI---ERDQTDIP------SL
B9XK55          --IRKTVILAVFLLVVITATIVT-FILP--EQFSSTARIKV---EGDTTDVP------GI
A0A4P5YMI6      --IRKMVILTVFLLVVITTTAVT-YVLP--KTYMSSVRIDV---QKDVSDVQ--------
A0A2E6T482      --VRFVTILLVFLLTAVTTTVVT-FLLP--RTYMSLSRISV---EKDSSDIA------PL
A0A3C0DQZ7      --VRFVTILLVFLLTAVTTTVVT-FLLP--RTYMSLSRISV---EKDSSDIA------PL
A0A1Z9CBK5      --VRIATILLVFLLTAITTTVVT-VMLP--STYMSLSRIAV---EKDTSDIA------PL
A0A2D6ZI96      --VRIATILLVFLLTAITTTVVT-VMLP--STYMSLSRIAV---EKDTSDIA------PL
A0A358KGZ3      --VRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAV---EKDTSDIA------PL
A0A2E9ZQX4      --VRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAV---EKDTSDIA------PL
A0A3D5JZU0      --VRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAV---EKDTSDIA------PL
A0A2E6HCR0      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSISRIAV---EKDTSDIA------PL
A0A1Z8WN04      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2D7L1N4      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2E2R937      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A520QQY4      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2D5MR66      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2E0PDQ1      --VRIAIILVVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2E2ZZP9      --VRIAIILVVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A7C4LRK7      --VRKTVILTVFMLVVLTTTLVT-QYLP--QYYSSTARIEV---EKDMPDVE------GW
A0A2A2RGF2      --MRALLIFVVFALVVGTTALLT-HNME--PTFMSTVRMDV---QKDVGDIS------S-
A0A2G4I5Y6      --MRGLLIFVVFALVVGTTAVLT-HSME--PTYMSTVRMDV---QKDVGDIT------S-
A0A6N6PS97      --VRKTVIIAVFLLVVITTTVVT-YILP--KTYMSTAQIEV---QKDLSDIP------L-
A0A3M1I883      --IRKMVILAVWLLVVLTTLAVT-FVLK--PTYASTVRIEI---EKDATDIP------T-
A0A1V6JZ45      --IRKTVILAVFLLVVLTTTAVT-FVLK--PTFMSTARIEV---EKQPTDFD------P-
A0A7C7Z746      --IRKMVIIAVFLLVLLSTTAIT-LILP--KTYSSTVRISV---AKDATDIP------G-
A0A520RRW5      --IRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAI---EKDNSDIT------P-
A0A356NPK0      --IRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAI---EKDNSDIT------P-
A0A2D7B5P5      --IRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAI---EKDNSDIT------P-
A0A3D3XGB5      --IRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAI---EKDNSDIT------P-
A0A2V6F8A1      --IRKTVILAVFLLVVLTTTAVT-FILP--ESWSSMVRIAV---EKDISDIS------P-
A0A2V5TNH4      --IRKTVILAVFLLVVLTTTAVT-FILP--ESWSSTVRIAV---EKDVSDIN------P-
A0A2V5X5Q6      --IRKTVILAVFLLVVLTTTAVT-FILP--ESWSSTVRIAV---EKDVSDIN------P-
A0A4P5QM05      --LRLGLILLTFFLVMVSAEVYV-YFLP--RQFYSHVTVEI---KPDVFDRL------NE
A0A4Q3C001      --VRAGLITLVFLLVMITAGVTT-YFMP--RQYLAKVSMVV---KPDSTKGV------SI
B4DB23          --LRMGLILLTFFLVMVTAGVTT-YFLP--KKYYSKVTMEV---KQDKSDLV------QT
A0A6B3L938      ALEKWWMIVIFAALGYVAALYYL-SIKE--PTTKARAVVEV---TTKELQLV------GQ
A0A2V5URB2      --KHKWKILACFLAAVVITAIIV-FSMT--PIYTATATLLI---ERKAPQVVKIQQVLSE
A0A2V2DJ66      --ERLWYIIVTFIVIFSGIALYT-LRIT--PLYTSASSVLI------FREAAAPIDGPGS
R7L5A9          --ERFWYIIVTFFIIFAGVLLYT-FRIT--PIYTSAASVQI------LRDSDSPIDGPGS
A0A5R8KA81      --DKAWLIVLCLLVAAFIVAAML-VRSV--PLYQSRVVVQV---EQSETKVL------DS
A0A5B5WU87      IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPKESVAATVLAT
R7DZW0          IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPRESVAATVLAS
A0A2N8HID1      IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPRESVAATVLAS
A0A2N8HS06      IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPRESVAATVLAS
A0A6N2TNT9      IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPRESVAATVLAS
A0A3R5R2M8      --RFWFLIILAAIAGGSLAFYLA-GRQN--YVYQKTASVMM---RDAKSGTDASSERIMS
A0A411SUQ6      --RYWFIIILAALAGGTAAYYLA-GKQN--YIYQKTASVLM---RDAKTGSDASSERIMA
A0A2N8HZF2      --RYWFIIILAALAGGTAAYYLA-GRQN--YIYQKTASVLM---RDAKTSSDASSERIMA
A0A354E720      --RYWFIIILAALAGGTAAYYLA-GKQN--YIYQKKASVLM---RDSKTGSDASSERIMA
B2UPB6          --RYWFIIILAALAGGTAAYYLA-GKQN--YIYQKTASVLM---RDAKTGSDASSERIMA
A0A2V6JLK8      --IRWVLVLLAFLLVLITAAIFT-YFQP--REYKADVFVEV---KSTAENPRIF------
A0A2W5Z1A5      --VRWVLILLAFSLVLITAAVVT-YFQP--REYQSSAFIEV---RSTAQNPHIF------
A0A2V6EA09      --VRWGLISLAFFLVLITAAIVT-YFQP--REYKASAFIEV---KSTAENPRIF------
A0A2V6GQI7      --VRWGLISLAFFLVLITAAIVT-YFQP--REYKASAFIEV---KSTAENPRIF------
A0A3C1HEJ2      --EKAWVVVLCLLAAGFITYGYL-KRAP--VIYASTVTLKV---EEQSQKIL------SG
A0A522ULD9      --SRKEIVLAVALLVIITVTAWT-MTLP--RMYETEVKVSL---KEDQADVEVF------
A0A1V6JU76      --QRRWLVIATFVSVFVLCLVYL-FKAP--RIYSATARLQI---DRESAAS-------LN
A0A2A2XXW5      --ERRWLIVATWSVCIIAGVLYA-FQAT--PMFRAIARLQI---DPENQGV-------LN
A0A6N6Q6V0      --ERRWLIIVIFLGFVSAGFVYA-FRST--PIYESVARLEI---DPEGTGV-------LS
A0A1Q6UHJ9      --ERWAYILITALIILAGVILYT-LRVT--PIYMSVSRVQI------LRDSDVAIEGPGS
A0A2V2BXR0      --ERWAYILITALIILAGVILYT-LRVT--PIYMSVSRVQI------LRDSDVAIEGPGS
A0A2D8V0G3      --ERRWLVITTFISVVILSVLYL-YRAV--PIYQAKTVLQI---NKESTSI-------MD
A0A348S017      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A3C1UUV7      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A350I3V2      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A520RGV5      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A3D3XF90      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A2D7B522      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A356NIC2      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A2N8HDG3      --RRWYWILLFALIGGGAAYYLT-GRQN--YIFEKTASVIM---RESSKEST------SD
A0A146GCJ0      --SKAWLIAAVAVVVVIGAAAYA-FRLP--KIYESRALLQV---EQLAQKV-------VD
A0A2T6D6H8      --ARAWLVIVVAVIFFAAAFAYA-LRSP--KIYESRALIQV---EQASQNV-------VD
A0A3D1TI55      --ARKEIIITVSVLIILTVFIIT-LIMP--EKYRASVRITI---DQYRPDIELV------
A0A3E1ET42      --NRWGVILLTFFLIALASLVII-ALLD--KKYQSTTRFRV---LL-----------SSA
A0A2A2YDW8      --NRYGVILITLLLVFMTAAVIT-YVMP--RKFESRAVVQV---NP-----------SNR
A0A352XLN9      --NRYGVILITLLLVFMTAAVIT-YVMP--RKFESRAVVQV---NP-----------SNR
A0A3D0YP62      --NRYGVILLTFLLVFLTAAVIT-YVMP--KKYESAALVEV---KP-ISDIDPVGMRGGG
A0A3D3DV47      --NRYGVILLTFLLVFLTAAVIT-YVMP--KKYESAALVEV---KP-ISDIDPVGMRGGG
A0A2E5XJ49      --NRYGVILLTFLLIFMTAAVIT-YVIP--KQYESTALVQV---NHSFVELDPL---NGV
A0A2E6SBY8      --NRYGVILLTFLLIFMTAAVIT-YVIP--KQYESTALVQV---NHSYIELDPL---NGA
A0A2E5QMS4      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFVELDPL---NGA
A0A2E7YXQ3      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFVELDPL---NGA
A0A2E3H787      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFVELDPL---NGA
A0A2E7AGN1      --NRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NYSYIELDPL---NGS
A0A2E7AKY7      --NRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NYSYIELDPL---NGS
A0A3D4CU34      --NRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NYSYIELDPL---NGS
A0A2E8M146      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A355S8S2      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A2D6DVN8      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A3C1W2R2      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A2E3NAY6      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFVELDPL---NGS
A0A2E3II01      --NRYGVILLTFVLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A368B8C5      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A3R7RBB5      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A2A2QX62      --NRYGVILLTFLLVFMTALVIT-YVMP--KKYESTAVVQV---RPKGAGAVMM---PGT
A0A4Q3BWH6      ------------LLVFMTALVIT-YVMP--KKYESTATVQV---RPMGTGTQVI---PGV
A0A3N5WCF1      --NRYGIILLTLLLVFMTAAVIT-YVMP--KKYESQAVIEV---KPRMPGMSPL---GAA
A0A4Q3C1K5      -------ILLTLLLVFMTAAVIT-YVMP--KKFESEATIEV---KPRSAGISPL---GPG
A0A3R8IT45      --ERIWYIVVVFLVIFSSALVYT-FSQT--KIYRAMATAQI---LRKTATMF------SQ
A0A2A2PYE8      --ERIWYIVVVFLVVFSSSLVYT-LSDT--KIYQSSATVQI---FRRDPTVM-------Q
A0A2T6CN73      --ERIWYIVVVFLVVFSSALVYT-LSKP--KIYESTATVQI---FRRDPTIM-------P
A0A2G4G428      --ERIWWLVLSVLIFFTLSLVYT-YNMM--PEYKASGRLRV---FRLAPNISG-----SN
A0A6N6PCD8      --EKWWIIALCLFGMLALAGA---YLLRKVPVYTAATIVQV---TEAADNV-------IN
A0A139TV24      --RRWYWILFCALLGGTAAYYMA-ATQN--YVFEKTASVMMREASKD-SSTDRI------
A0A2N8HT11      --RRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDSSSSDRI------
R7DS70          --RRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDSSSSDRI------
A0A2N8HNL6      --RRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDSSSSDRI------
A0A6N6PAZ1      --GRWHWIVLGGVLGLLSASYYL-AKCP--KQYTATATLLI---KQQTASV-------MA
A0A6I1K459      --EKAWLVVCIMAAAAAAGIWTS-NRTP--PVYQSRAVMFF---DFGEQKV-------LN
A0A139TUL1      --RYWLWILAAALLGGAGAYFIF-ARQG--YLYEKTARIMLRDDKQKNSQV-------SE
A0A2N8HCB0      --RYWPWILACALLGGGLAYFIS-ARQG--YLYQKTARIMLRDDKQKNAQV-------SE
A0A2N8HP04      --RYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQV-------SE
A0A2N8HRJ0      --RYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQV-------SE
A0A6N2U9Y7      --RYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQV-------SE
A0A366HAG0      --NRLGLILASFIFIFAVAAVLT-YIMP--RKFRGRVEMVI---ERKLDDARVV----GN
A0A2U8DZK4      --LRKALILLILALVVITTIAVT-AFLP--KWYRSKASIRV---LKIGTTSAVF------
A0A2T6DFL8      --QRQWLIALILALVVVTTIGVT-AFLP--KGYRATTKVRV---ERPDGQVKLF------
A0A1D8AWD4      --LRKGLIFLVLGLVLLTTLGVT-ALLP--KWYLSTAKISV---QKPESEVKLF------
A0A4Q1C9S2      --LRKGLVFLVLALVVLTTLGVT-ALLP--KWYLSTTKISV---QKPESEVKLF------
A0A178IH18      --QRKFLILLVMALVVGTAAVVT-ALLP--KWYLSTINIRV---EKPEGKV-VF------
A0A2T6DT99      --LRKALIFLILSLVVVTTAVVT-ALMP--KWYVSTLNVRV---EKPEGEVKLF------
A0A1G3ZT33      --LRKALIFLILALVLLTTLGVT-ALLP--RWYLSTVAMRV---EKPESEVKLF------
A0A3E1E2T2      --LRKSLILLILSLVVITTVAVT-AFLP--RWYLATAKIRV---EKPESEVKLF------
B1ZMW1          --QRKALIALILGLVLITTIVVT-AFLP--RWYLATTKIRV---EKPEGEVKLF------
A0A3M1I8A3      --ERRWLVIMVLILSVAASVGYV-VKAP--RIFRATVRLQI---DPESETGV------NL
A0A4V0XS84      --DQRYLIVATFICVFASCVFYL-YKAP--RIYQATVSLQV---DKDSDNAL------SG
A0A351WE84      --SRKEIVMAVTLLIVITGVAVT-FMQP--KKYSSTVRILV---REDSMDVDVF------
D5ENH7          --ERIWWMIVAFFIIFSGAILYT-FNKT--KVYTAVAQVRL---LREDPAAMG------D
A0A0R2XQ77      --ERVWYLIVAFFIIFSGSILYT-FNKT--KVYTAVATVQL---LRDDPSAMA-------
A0A2E9IN28      --ERIWYLIVAFFIIFSGSILYT-FNKT--KIYTAAAQVQL---FRDDASALG------K
A0A6N4WTJ5      --ERIWYLIVAFFIIFSGSILYT-FNKT--KVYTAVAMVQL---LRDDPSAMAV----MG
A0A1V5QDZ6      --SRKEVILAVLLLVVVTGTSFT-LTLP--KKYMADARILV---RDDSLDVDVF------
A0A4Y8P964      --RYKAIVLISFLLILLFTIIFT-FTQQ--PVYQGVTTVKI---NFNKSEVLPY----KS
A0A3D4HF88      --ERIWFFLVIFLIVFLGSVLYT-FNTT--PLFTAGATVQV---LRDPVNPLG-----AG
A0A6N6ZHN8      --ERIWWLIISVIVVFIAMAVFT-FSSP--RQYRAMAAIEL---LRSPDEV-------LP
A0A6G6K641      --ERLWLIILFAIAGVVYAAYQS-NKAV--PIYASRAVLQF---ESPRRIMPL-------
A0A5B5WI95      ------RYWFIIMLAAVAGGMLA-FYLAGRQNYVYQKTASI---IMRDAKSGTDASSDRI
A0A2N8I9W1      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A4Q5IH27      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A2N8IBZ6      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A2N8IJW9      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A7G6DX28      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
R6J100          ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A1V6J089      --DRKEVILAVALLTIVSGTAYT-LMMP--KKYTALTQIQV---REDAMDVD------PF
A0A3C1BZR1      --DRKEVILAVALLTIVTGTAYT-LMMP--KKFTATTQLEV---REDAMDVD------PF
A0A7C4KLL2      --EKAWLIILCVVVALLVAAYHL-KNSP--RLYQAVATVQV---EQEEKKA-------VK
A0A1H6KPB7      --NRWKEAVLVFVLVFVAAAVAT-YLMP--PSYTSVINFEI---KKPGAIVSL-----SR
A0A2E9ISN4      IFRHWSWLVCSVVLCTLLGGLYA-YLAT--PIYRATARIEI---LNDS----------RV
B9XAX1          --EKWWLIVLVTCAVTLPAFWWV-RNVP--VGYQARAVLQV---EQEEQRL-------VG
A0A5R8KKM9      --NRLGLIFLCFLLVFAAAAVIT-HVMP--RKYRAVVEIEL---KRQLKDTNVFGQL---
A0A139TS01      --NRWKEVFLVFMLVLVISLVVT-LLMP--PSFRATSKFQI---KRPRPVMGI-----GT
A0A3E1EJT7      --ERKWYALAAFVVIVAGVSAYT-FLST--PIYAGQVTVQV---LKHGSQV-------MR
A0A7C3I5X9      --ERRWLVITTYVIVLALTGLYL-YWAP--KVYRATTRLQI---DPEAEAAV------NL
A0A2D5WGA5      --VRFINIMLVFLLTALTTTLVT-FLLD--KTYMSQSRISI---EKDTSDIA------PL
A0A2E7SSH2      --VRIATILLVFLLTAITTTAVT-FLIP--ATYMSLSRIAV---EKDTSDIA------PL
A0A349GXM8      --FRWQLIALCFLYTMLGAVAYL-YLAP--KTYESNTKIMI---YRDPLLT---------
A0A4P5YP61      --ERIWAVLLVLTLTTFLGGLYV-VRSP--KIYSATLTLQV---EQESKIVDL-------
A0A6B2LYM4      --ERIWWLVVSIFVVFLGFALYT-FNAP--KLYRAAASVEI---LRQKDQV-------FQ
A0A6D1VXB3      --RYKAVVVISFLLILLFTILFT-FTQK--PVYRGVATIKI---NFNKSEVLPY----KT
I0JYY7          --RYKAVVVISFLLILLFTILFT-FTQK--PVYRGVATIKI---NFNKSEVLPY----KT
A0A4R7S1J2      --TAREKLWLLILLPLIGAAVSYGYLKQAKPVFSSNATLEV---EEKQRVVDV-------
A0A2A2XV69      --IRLPLIVLVFLLVVITTGVVT-YFLP--KQYESSVTMQV---NQNDTYLQVF------
A0A651H7X9      --ERIWYIIIIFLAVFSAALIYT-LTRP--KVYEAVASVEI---LRTSPVV-------LQ
A0A4Y8P842      --FRRQALLF-FLVVLFIVLLFT-FTQK--PIYRGESLVKV---NSTKAEVVPY----KQ
B3DZK9          --FRKQALLF-FLVCLFVVFLFT-FSQK--PIYRGESVVKI---NSTKSEVVPY----KQ
A0A5E6MPC4      --RYRGAALLFFAAVFLLTVVAT-FSQK--PIYEGIAVVKIGTGAESSSIVPYRQIGQDQ
A0A6N6PKP9      --EKAWLLALVTVLGIAAAAFVV-RRSQ--KIYAATTTIQI---EEERQRV-------VR
A0A6N6Z250      --EHWLVVFTVAALAIFAAAAWTQLFME--PWYYAESTIRV---EQADRESDVLRPM---
A0A4V1SB02      --RYSWLIILIVAIMMGGTWAWL-SKQS--PVYASRAVLQV---DMDEGNL-------VN
A0A6N6QEJ2      --LRKAIILTVFLLVVGTVAVVT-HFLT--PLYLSTVGMKV---EKDTPDV-------GP
A0A3C1VB86      --DKSWLIVSCLVLALLAAAVYV-ERAP--RVYAATTTVQV---EQADAKV-------VK
A0A146G2Q9      --VRLPLIILVLLLVVITAGVVT-YFMP--KQYASTVTMQI---RQNDKVLQVF------
A0A2T6D3Y2      --VRLPLIILVLLLVVITAGVVT-YFMP--KQYASTVTMQI---RQNDKVLQVF------
A0A6N6P5E3      --VRLPLIILVFLLVVITAGIGT-YLTP--RQFLSSVTMQV---KEDNNKMQIF------
A0A2D5VY59      --IRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAI---EKDSADI-------TP
A0A2D8UZZ4      --IRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAI---EKDSADI-------TP
A0A353DV86      --IRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAI---EKDSADI-------TP
A0A2E5EPT8      --LRKGVIFVNFIFVVLVATFVT-YLLP--KTYKSTVRMDV---KKDTASDI------EL
A0A6J4HTK1      --VRWVLILLAFLLVLITAAVVT-YFQP--REFQSSVFIEV---RSTAQNVRLF------
A0A6N6PHJ5      --IRKTVIIAVFMLVVITATLVT-FILP--EQFASTATIKI---ERDKSDID------EM
A0A6M1RXR2      --IRKTVILAVFFLVVLTAVIVT-YMMP--QRYASTALIKV---ERDISDIR------GF
A0A7C3DXS4      --IRKTVILAVFFLVVLTATLVT-YMLP--QRYASTARIKV---ERDITDIR------GL
A0A2V2SDV4      --IRKAIILAVFLLVVITTVVVT-FIYP--ESFSGTARIRV---ERDQSDIS------GV
A0A2V5PK75      --IRKTVILAVFLLVVITATLVT-FILP--ESYSSKARI-------DSPDIS------GI
A0A1V6DME1      --IRKTVILAVFLLVVLTATLVT-WILP--VSYSSEARIKV---DRDVSDIP------GM
A0A3D3DIJ3      --IRKTVILAVFLLVVITATLVT-FILP--ESYSSKARIKI---DRDQTDIS------GL
A0A6I1K583      --MRGLLIFVVFALVVGTTAVLT-HWME--PTFMSTVRMDV---QKDVGDISSLMPQQQQ
A0A350EWA4      --IRKTVILAVFLLVVLTTTLVT-FLLP--ESYSSTVTIEV---KKDSSTL-------DR
A0A5B5WZ91      --NRWKEVFLVFMLVLVISLVVT-LLMP--PSFRATSKFQI---KRPRPVMGI-----GT
A0A2N8HD92      --NRWKEVFLVFLLVLVISVVVT-FLMP--PAYQTRCQFQI---KLPKPVMEI-----GQ
A0A2N8HIT2      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMEI-----GQ
A0A354EBD3      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A355VEB2      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A2N8IMT3      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
R6K1U5          --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A2N8IWC2      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A2N8I441      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A2N8I3A6      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A410SCC4      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A3R5VEW0      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A411SSG2      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
B2UKW3          --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A7C3HWX0      --IRKTVILAVFLLVVLTTVGVT-MMLK--PTYSSTARIEI---GKETKAIDPLGRT---
A0A1M6RLZ4      --NRYGIILLTFILVVVTAAVIT-YVMP--KKYESVAQIEI---KPLGIKTD------TV
A0A7C4KPD7      --VRKTVILTVFMLVVLTTTLVT-QFLP--PTYESVARIEV---EKDMPDVEGFRER-PV
A0A354T7G8      --NRIGLITLCFILIFAAAAILT-YIMP--RKYRGHVEMTI---ERITQDINVFDRNRGD
A0A512MBZ2      --NRFGLICLSFLLVFATAAIIT-YIMP--RKYRGRVEMKI---ERLQNKVQVFNRD-TS
A0A2E8MEZ0      --NRYGVILLTFLLVFMTAAVIT-SVMP--RKYESSSVVQV---HPSVLLMTPFLGG---
A0A6B3LBV6      --NRYEVILLSLLLVLITAGFIT-VMME--EKYESTVVVQL-------TDISQMGGDLTN
A0A2E3EC33      --NRYTVILLTFFLVIMTAAVIA-YLRP--PEYLGRVQIQV---QREARDLEVFRET-GS
A0A2E4GN01      --NRYSVXLLTFFLVXMTAMVIA-YLRP--PEYLGRVQIQV---QREARDLEVFRET-GT
A0A1Z8XU55      --NRYSVILXTFALVFMTALVIA-YLRP--SEYLGRVXIQV---QRVARDIEVFRET-GS
A0A2E1RQR9      --NRYSVILXTFALVFMTALVIA-YLRP--SEYLGRVXIQV---QRVARDIEVFRET-GS
A0A2E3ISQ4      --NRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQV---QREARDIEVFRET-GS
A0A2D6W6F4      --NRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQV---QREARDIEVFRET-GS
A0A2D8Z5A8      --NRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQV---QREARDIEVFRET-GS
A0A4Q2YKS3      --NRYGVILLTLLLVFMTAAVIT-YVMP--KKFESSAVIEV---KPRGQILSPFGERGSE
A0A6N6P3T8      --NRYGLILLTLLLVFMTASVIT-YVMP--KKYESYAKIEV---KPRGTLITVFKGM-ED
                                                                            

A0A2A2XVF1      IDGVSQENP-SSP-----DFINTVVQSITSRNLMLRVIDA--------NKLRTN------
A0A2V5UHJ2      SVDYNDYNN---------EFYKTQYEILKSRALAERVVRD--------EGLESH------
A0A2V5PST3      GARTAEGGGPY-------DYYQTQYKLLASSALAARVIAD--------LRLDSN------
A0A2V5PXM3      VQQEDPQSL---------EFLKTVEQTFESRSLFERVLDT--------NNLATD------
A0A1V5QB01      GVPMPYSLR-QVESQPMGDYLATQQLIIQSGQLISRARAR--------LNKPAE------
A0A1J4XH17      VRSVESNEV-RTS-----EDLNTQIKVLESSTLAKAVADR--------LQKENL------
A0A7C5LI63      AEVVVEQAR---------TFFATQLNIMQSQTMLRRVQQR--------MKKTPD------
A0A7C5P291      AELSREDER---------SFYSTQVEIMSSPTMLRRVQQR--------LKKTDD------
A0A139SU05      PETVVTTQTVMDATIRNELDLNTYIHQLTSNRVRTRVLES--------LTPEEV------
A0A139SPN4      PETIVTTQGVVDASIRNEIDLNTYIHQLTSNRVRTRVLES--------LTPEEI------
A0A1V6E7N1      PDRIVATEGVTRPEVQSEFDINTYLEILKSDKLRQRVVNS--------LSPQEV------
A0A2D9MYT1      MESFVMEGA-REQ-----DYLQTQYKNLQSRSLMEMALEETLQNAMILDGLKAG------
A0A290QGD9      VQSVTDNDV-RSL-----EDLNTIVQILESGTIIQKVSDR--------LTGEKL------
A0A1D8AS58      VQSVVNNEI-RSA-----EDLNTQVKVLESLAIVQRVADR--------LTGADL------
I6AQC1          TPELLPTNV-IST-----EDMNTMVKIFESPTIIQKVSER--------ITGDEL------
W0ITH7          TQNPIDNNV-LST-----EDMNTMVKIFESPTIIQKVSER--------ITGDEL------
A0A258ANJ7      ----------STPGLGDEKSVNTLIQAAKSREVIGRVISE--------LNLTQL------
A0A139TLN4      SNGIVNTAS---------TNLDNEIFLLSSYSLMEEVVRK--------LKLDVT------
A0A1G3ZFT0      GGGSGPSLG---------SPAAIQIALIKSRYILTPVIQS--------LHLNTNLSPSHP
A0A1Z8ZMT6      QSLEAAEDI-RSD-----FDRTELFLAVASDPTVRNLANLIPPEAPSIMEVFTA------
A0A2E8MCT7      QGLEAVEDI-RSD-----FDRTELFLAVASDPTVRNLANLIPPDPPSIMGIFTA------
A0A290Q2Z2      --QAQSSGY-YDP-----YFLQDQFKIMQSAKVLYPVIEN--------LGLNDK------
A0A2A2RGK2      FSQVRDEQI-RSI-----DMINTVVDLIRSYPFSQRVSAR--------LKLDQD------
A0A2A2XXF7      MEQVRDEQI-RSI-----DMINTVVDLLRSYSFAQRVSAR--------LKLDQD------
A0A2A2R5D6      MGNSRTDAP-FDL-----VFFTSEISTIQSKKILNPVIEK--------LGLQKE------
A0A3C1VJ32      GNSPAATSFGYDP-----YFIQTTFEIMQSQLVLSNVIAT--------MNLNVE------
A0A2N9NTX7      TQQQGSFSP-YDP-----YFMQTEFELMKSEVVLDKVIKN--------LNLNEE------
B9XK55          TQTPNYSGH-YDP-----YFIQTEFEVIQSEVILDRVIEG--------LNLNEA------
A0A4P5YMI6      FSGMSESKA-YDP-----FFVLTQFEKLQSTAVIYPVITD--------LGLREK------
A0A2E6T482      LGMQAGPTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK--------CDLTNK------
A0A3C0DQZ7      LGMQAGPTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK--------CDLTNK------
A0A1Z9CBK5      MGVQATQSS-FDP-----XFISTEFEKIQSQVVLDAVVES--------CELQEK------
A0A2D6ZI96      MGVQATQSS-FDP-----XFISTEFEKIQSQVVLDAVVES--------CELQEK------
A0A358KGZ3      LGMQATQSS-FDP-----YFISTEFEKIQSQKVLDEVVKS--------CELREK------
A0A2E9ZQX4      LGMQATQSS-FDP-----YFISTEFEKIQSQKVLDEVVRS--------CELREK------
A0A3D5JZU0      LGMQATQSS-FDP-----YFISTEFEKIQSQKVLDEVVKS--------CELREK------
A0A2E6HCR0      MGVQTAQSS-FDP-----YFISTEFEKIQSQIVLDAVVRS--------CELRDE------
A0A1Z8WN04      MGAQSSQSS-FDP-----YFISTEFEKIQSQIVLDAVVET--------CELREE------
A0A2D7L1N4      MGAQSSQSS-FDP-----YFISTEFEKIQSQIVLDAVVET--------CELREE------
A0A2E2R937      MGAQSSQSS-FDP-----YFISTEFEKIQSQIVLDAVVET--------CELREE------
A0A520QQY4      MGAQSSQSS-FDP-----YFISTEFEKIQSQIVLDAVVET--------CELREE------
A0A2D5MR66      MGVQASQSS-FDP-----YFISTEFEKIQSQIVLDAVVAT--------CELREE------
A0A2E0PDQ1      MGVQAAQSS-FDP-----YFISTEFEKIQSQIVLDAVVSS--------CELREE------
A0A2E2ZZP9      MGVQAAQSS-FDP-----YFISTEFEKIQSQIVLDAVVSS--------CELREE------
A0A7C4LRK7      YQGRQTPSF-HDP-----YWLTTQFEIIQSGAILHRVIKK--------LRLNER------
A0A2A2RGF2      LMPQQQQGG-FDP-----YFVMTQFEILQSKEVLYKVIDD--------LKLVPR------
A0A2G4I5Y6      LMPQQQQGG-FDP-----YFVMTQFEILQSKEVLYKVIDE--------LKLVQR------
A0A6N6PS97      LLQGQQQSS-YDP-----YFIRTEFEKIRGQRVLYPVIEE--------LSLSET------
A0A3M1I883      IGGQQRDPS-FDP-----YFMATEFEKIQSMSVLMPVIHS------PTNAAGEK------
A0A1V6JZ45      FLRPQVQNQ-FDP-----YFIQTEFEKIQSKPILYKVIES--------LDLRKT------
A0A7C7Z746      MVAQQRSDN-HDP-----YWIQTQFERIKSRQVLHRVVSN------QVVNLPNR------
A0A520RRW5      LMGLQAAQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA--------LGLNHK------
A0A356NPK0      LMGLQAAQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA--------LGLNHK------
A0A2D7B5P5      LMGLQAAQQ-HDP-----YWVLTEYEKIQSKKVIHPVINX--------LGLNHK------
A0A3D3XGB5      LMGLQAAQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA--------LGLNHK------
A0A2V6F8A1      LGITQNSTQ-YDP-----FFLQTEFEKIRSQKVLYKVIDN--------LKLNER------
A0A2V5TNH4      IGFAQNNSA-YDP-----FFIQTEFEKIRSRKVLYKVIEN--------LKLNER------
A0A2V5X5Q6      IGFTQNNSA-YDP-----FFIRTEFEKIRSRKVLYKVIEN--------LRLNER------
A0A4P5QM05      VGTQTSSGR-IDP-----QFVATQIQVLKKAEILNPVIEK--------LNLVKE------
A0A4Q3C001      FESSA-QRS-YDP-----AFVATEFHTLRKSDILYPVIDQ--------LELVKY------
B4DB23          FGPGQFRQT-YDP-----QFVATQFQILQKTEILYPVIER--------LDLIKE------
A0A6B3L938      GDAERDSMI-FRD-----EIIGTIASKITGQGQFVKVIQR---PEVQALEKVIPPPLSLK
A0A2V5URB2      SIEADER-----------SYYESQYEMLKSRSLAAEVIKG--------QGLDRN------
A0A2V2DJ66      SDRTRNDKV-LSV-----EDFNTQVKILESNEVIRAVRSR--------LKEDDL------
R7L5A9          TERSRNNVI-MSM-----EDFNTQVKLFESAEIVKAVKSR--------MKEDEL------
A0A5R8KA81      VQEVNPQDL-RMN-----DLLATIMENLKNRDLLLRVVRR--------AELGKD------
A0A5B5WU87      SNGIVNTVA---------TNLDNEMFLLSSHSLLETVVRK--------LKLDVT------
R7DZW0          TNGIVNTGA---------TNLDNEIFLLSSHSLLKTVVRN--------LKLDVT------
A0A2N8HID1      TNGIVNTGA---------TNLDNEIFLLSSHSLLKTVVRN--------LKLDVT------
A0A2N8HS06      TNGIVNTGA---------TNLDNEIFLLSSHSLLKTVVRN--------LKLDVT------
A0A6N2TNT9      TNGIVNTGA---------TNLDNEIFLLSSHSLLKTVVRN--------LKLDVT------
A0A3R5R2M8      ELGIDSGA----------ANLANESFVLKSTAIMQKVVED--------LKLNTS------
A0A411SUQ6      ELNIDPNA----------ANLANESLVLKSTALMNKVVED--------LNLNTS------
A0A2N8HZF2      ELGIDSGA----------ANLANESFILKSTALMKKVVED--------LNLNTS------
A0A354E720      ELNIDPNA----------ANLANESLVLKSTALMNKVVED--------LNLNTS------
B2UPB6          ELNIDPNA----------ANLANESLVLKSTALMNKVVED--------LSLNTS------
A0A2V6JLK8      GQGDPNQPI-HDP-----QLAPTVYQVIQRTGILYPVIEQ--------LKLQDK------
A0A2W5Z1A5      SQIDPSQPV-HDP-----TLAPTVFQVIQRTGILYPVIDE--------LKLQEK------
A0A2V6EA09      GN-DLHQPV-HDP-----ELAPTVFQVIQRTGILYPVIDD--------LKLQDK------
A0A2V6GQI7      GN-DLHQPV-HDP-----ELAPTVFQVIQRTGILYPVIDD--------LKLQDK------
A0A3C1HEJ2      LQEGVRDDG-ERP-----EDLKTIIETLKSRAVIERVIET--------NHLATD------
A0A522ULD9      -GPGGAAFS-YNP-----YFLRTQFEIIQSRQILYKVVDN--------LNLTKE------
A0A1V6JU76      LNEV-VMSM-TDQ-----DYLQTQYRNLLSRSLLEIVIKR--------EKIN-E------
A0A2A2XXW5      LNSM-ALGN-SDQ-----NYLTTQYRNLESRSLILAVMNK--------LKLETD------
A0A6N6Q6V0      LRDMVTIGS-KDQ-----EYLQTQYRNLQSRSLIDKVIQK--------LRLD-E------
A0A1Q6UHJ9      TDRSRNNTV-LTI-----EDFNTQVKILESNEIIKAVKSR--------MKEDEI------
A0A2V2BXR0      TDRSRNNTV-LTI-----EDFNTQVKILESNEIIKAVKSR--------MKEDEI------
A0A2D8V0G3      VGSQVVFNS-NDQ-----EYLQTQYKNLLSRSLIESVITD--------LELKQD------
A0A348S017      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDEE------
A0A3C1UUV7      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDEE------
A0A350I3V2      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDEE------
A0A520RGV5      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDEE------
A0A3D3XF90      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDEE------
A0A2D7B522      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDEE------
A0A356NIC2      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDEE------
A0A2N8HDG3      RIKVDLGMD-SGA-----ANLANESFILRSSTVMRSTVED--------LALNIS------
A0A146GCJ0      IADVSQENP-QST-----DFLKTVVEALKSRKLLARVVKA--------EGLDKD------
A0A2T6D6H8      IDDIARENP-QTT-----DFVNTVVQALTSRKLMLRVVKA--------TGLDHN------
A0A3D1TI55      --DRGRQSQ-YDP-----YFYLTQFELIRSRPVLTGVIRD--------MNLQEV------
A0A3E1ET42      IDPFQTNEI-SNRSAYSGNWLETEFKTVTAHETLSLVIKK--------LNLDQT------
A0A2A2YDW8      FGTAFGDDN-NSQIQMTPQFFATQFEIIRSQMTLRRVVDK--------LRLTNR------
A0A352XLN9      FGTAFGDDN-NSQIQMTPQFFATQFEIIRSQMTLRRVVDK--------LRLTNR------
A0A3D0YP62      IGTPM------TR-----QFMNTQFEIIVAPETLGRAIDK--------IQLETS------
A0A3D3DV47      IGTPM------TR-----QFMNTQFEIIVAPETLGRAIDK--------IQLETS------
A0A2E5XJ49      AGAPMTGAS-PSH-----AYIYNQFKIIESEKTLARVVER--------LDLTTR------
A0A2E6SBY8      AGPPMTGAS-PSH-----SYIQNQFKIIESEKTLARVVER--------LDLXTR------
A0A2E5QMS4      AGHPMTGAS-PSH-----AYIQNQFKIIESEKTMLRVVER--------LDLTTR------
A0A2E7YXQ3      AGHPMTGAS-PSH-----AYIQNQFKIIESEKTMLRVVER--------LDLTTR------
A0A2E3H787      AGRPMTGAS-PSQ-----AYIQNQFKVIESEKTLLRVVER--------LDLTTR------
A0A2E7AGN1      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLSRVVET--------LDLTTR------
A0A2E7AKY7      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLSRVVET--------LDLTTR------
A0A3D4CU34      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLSRVVET--------LDLTTR------
A0A2E8M146      VGQPMTGAS-PSH-----AYIQNQFKIIESETVLNRVVES--------LDLTTR------
A0A355S8S2      VGQPMTGAS-PSH-----AYIQNQFKIIESETVLNRVVES--------LDLTTR------
A0A2D6DVN8      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLLRVVEQ--------LDLPTR------
A0A3C1W2R2      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLLRVVEQ--------LDLPTR------
A0A2E3NAY6      VGQPMTGAS-PSH-----AYIQNQFKIIESERTMSRVVER--------LDLTTX------
A0A2E3II01      VGQPMTGAS-PSH-----AYIQNQFKIIESERTMSRVVER--------LDLPTR------
A0A368B8C5      VGQPMTGAS-PSH-----AYIQNQFKIIESERTMGRVVER--------LDLTTR------
A0A3R7RBB5      VGQPMTGAS-PSH-----AYIQNQFKIXESERTMGRVVER--------LDLTTR------
A0A2A2QX62      EPRGQ--YE-MTS-----TFFPTEFEVIKAQKTLDSAIEN--------LDLVNR------
A0A4Q3BWH6      TDNRS--ME-NGA-----TFLPTEFAVIKAQKTLDAAIEN--------LDLVNR------
A0A3N5WCF1      MTETSGGGR-MSP-----QFFGTEFEKIKSRNSLAKVVDN--------LQLVNR------
A0A4Q3C1K5      FSDNQ--NL-MTP-----QFFGTEFEKIKSYNSLSKVVAK--------LELMSK------
A0A3R8IT45      SREMLDSTM-FST-----EDINTMVKVFESSIIIQKVSER--------ITGEEL------
A0A2A2PYE8      VQQVVDTDI-RSA-----EDLNTQIKVIESVTMIQRVAER--------ITGDDL------
A0A2T6CN73      GQQVVDTDI-RST-----EDLNTQVKVIESEAIIESVASR--------ITGQEL------
A0A2G4G428      TAAESNFSI-TSA-----DDFYTAVESMRSSTIIEAVSRQ--------LTTAEK------
A0A6N6PCD8      IPGVAQDNF-KSD-----IALKSVEGAMNSNSLLLRVAKL--------NDLETE------
A0A139TV24      --MVELGVD-SGA-----ANLANESFILRSSTVMRHTVED--------LKLNVS------
A0A2N8HT11      --KVELGMD-SGA-----ANLANESFILRSSTVMRNTVED--------LTLNVS------
R7DS70          --KVELGMD-SGA-----ANLANESFILRSSTVMRNTVED--------LTLNVS------
A0A2N8HNL6      --KVELGMD-SGA-----ANLANESFILRSSTVMRNTVED--------LTLNVS------
A0A6N6PAZ1      RDQIEEIDM-RSA-----EAMNTVAERIRRMDLLERVASR--------HDVRELPGLMPI
A0A6I1K459      IEDVDKREK-GGV-----DLLNTIANNIRSSGIIKRVVTA--------HNLTRH------
A0A139TUL1      IILSDLGVR-AGE-----ANLANESYVVQSSEVMGRVVKG--------LELGVS------
A0A2N8HCB0      IILSDLGFK-PGE-----ANLANESYVVKSSEVMGRVVKG--------LGLDVS------
A0A2N8HP04      IILSDLGFK-PGE-----ANLANESYVVKSSEVMGRVVKG--------LGLDVS------
A0A2N8HRJ0      IILSDLGFK-PGE-----ANLANESYVVKSSEVMSRVVKG--------LGLDVS------
A0A6N2U9Y7      IILSDLGFK-PGE-----ANLANESYVVKSSEVMSRVVKG--------LGLDVS------
A0A366HAG0      ANLQDDNLA-STD-----SFLKTQFEIITKRRTLDRVVDK--------LDLLEK------
A0A2U8DZK4      --QAQSNDY-YDP-----YFVQDQLRTIKSPKIINPVIER--------LKLNEK------
A0A2T6DFL8      --QAQTSPS-YDP-----VFLQDQFKIMQSEKILYPVIER--------LDLNRK------
A0A1D8AWD4      --QAQSNTY-YDP-----YFIQDQFRIIQAEKILYPVIES--------LGLNEI------
A0A4Q1C9S2      --QAQNNSY-YDP-----YFIQDQFKIIQSEKIIYPVIDA--------LGLNAI------
A0A178IH18      --ENQANNY-YDP-----YFLQDQFKVIQSPKILNPVIEN--------LGLNRR------
A0A2T6DT99      --QNQQSAY-YDP-----YFLQDQFKIMQSAKILYPVIER--------LQLNEK------
A0A1G3ZT33      --QAQSSSY-YDP-----YFLQDQFKTIQSDIILKPVIEI--------LNLNAV------
A0A3E1E2T2      --QAQSSSS-YDP-----YFLQDQFKILQSEKILYPVIKN--------LKLSTV------
B1ZMW1          --QAQSSSY-YDP-----YFLQDQFKIMQSEKILYPVIEN--------LGLNTR------
A0A3M1I8A3      RDGFGGVSR-MDP-----EYLQTQYKNLLSRSLLERVVKA--------ERLEQD------
A0A4V0XS84      IKGVVVQNR-QDP-----DYLQTVAKNLKSRTLMKALIAD--------LKLDED------
A0A351WE84      --ERQMIQG-YNP-----FFLRTQERILKSTPLLYAVIDN--------LNLQAV------
D5ENH7          QVDLAQDSI-RTA-----EDLNTQISLLNSSKIIQQVERR--------MSEEQR------
A0A0R2XQ77      SAEMEMNQI-RSS-----EDLNTQISVLNSGAIVQGVERR--------LQDDER------
A0A2E9IN28      GAEMEQNQI-RGA-----EDLNTQISVMESATIIKGVEQR--------LQDEMR------
A0A6N4WTJ5      AGELEPNQI-RSA-----EDLNTQISVLNSGKIIQGVERR--------LQDDER------
A0A1V5QDZ6      --ERQIPQA-YNP-----FFLRTQYEVIQSRKVLYQVVEN--------LDLQKV------
A0A4Y8P964      VGEDQAGLF-DYE-----NYFKTQVEILKSRSLAQRVVER--------LDLDEHPD----
A0A3D4HF88      AEDITKEEI-RTS-----EDLNTQIKILESLAIVNSVADR--------IKGAER------
A0A6N6ZHN8      FKDVVDLDM-RSS-----EDYNTQVKVLQSSEIINRVADR--------IKGPTK------
A0A6G6K641      -DTVQQDDL-SNE-----QSLNTLIETLNSRTMLQRVAIR--------LKLDRD------
A0A5B5WI95      MSELGIDSG-AAN-------LANESFILKSTAVMKKVVED--------LKLNTS------
A0A2N8I9W1      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNTS------
A0A4Q5IH27      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNTS------
A0A2N8IBZ6      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNTS------
A0A2N8IJW9      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNTS------
A0A7G6DX28      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNTS------
R6J100          MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNTS------
A0A1V6J089      YQRDINRMG-YNP-----FFLMTQEKILKSKPVLTTVIRN--------LNLQKV------
A0A3C1BZR1      YERQASRMG-YNP-----FFLMTQEKIMKSRPVLTAVIRN--------LNLQKV------
A0A7C4KLL2      VDPIVREDL-RSS-----ETLNTIVQKFKSRALLERVVET--------NRLAQN------
A0A1H6KPB7      GAERVLQNN-ASE-----NYIPTQFEILVSDMNLMAVSKK--------LNLAQQ------
A0A2E9ISN4      ETRATTQYD-RQE-----RSLSRQMLLLNSNRLHQQVRAN----------LAEE------
B9XAX1          IEEVSRQDL-RTG-----EMLNTIVQNVKNTKVLGRVVRN--------IGLATN------
A0A5R8KKM9      ---NQNNNL-AGD-----GFLKTQLEIIQKPKTLERVVEK--------LKLLEL------
A0A139TS01      GEDVVASSN-ITD-----NYIPMQYSVLTSSEVLKVVSKK--------LNLAAE------
A0A3E1EJT7      VADVVDSNI-TSE-----PDFNTQIKVLESLTILQNVANR--------LTPDEL------
A0A7C3I5X9      GGVTVQSIQ-ANQ-----DYLQTQYRNLLSRSLLNVVIRK--------ERLTED------
A0A2D5WGA5      LGMQTGPTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK--------CELEDK------
A0A2E7SSH2      MGMQATQSS-FDP-----YFISTEFEKIQSQVVLDEVVKK--------CDLKKR------
A0A349GXM8      ----VSNEG-AQW-----TSLHTHTYMLNNEKLHERVMNK----------LAEA------
A0A4P5YP61      -TKFKPDEQ-TTT-----EILKTFEQTIVSRPVLERVAAT--------NQLTKNGEFLTI
A0A6B2LYM4      IQDIVRQEV-ANA-----EDFNTQIKILESLNIVQAVDER--------LKGNLR------
A0A6D1VXB3      VGEDQAGLF-DFE-----NFFKTQVEILKSRSLAQRVVER--------LDLDEHPD----
I0JYY7          VGEDQAGLF-DFE-----NFFKTQVEILKSRSLAQRVVER--------LDLDEHPD----
A0A4R7S1J2      -KEVTDKDW-ANT-----EAMNTLAATMRSSTFLERLIDR--------EKLQTRPDL---
A0A2A2XV69      -DDRGGGRG-FDP-----RFITTQFEIIQRKEILYPVIEA--------LGLEQT------
A0A651H7X9      VQDVLDPTI-RTT-----EDFNTQVRRMESISLIQRVASR----------LTGE------
A0A4Y8P842      VSNDEPGLF-DWE-----TFFKTQCEIIKSRSLAQRVVER--------LDLDEHPD----
B3DZK9          VSNDEPGLF-DWE-----TFFKTQCEIIKSRSLAQRVVER--------LELDEHLD----
A0A5E6MPC4      IGQESANAF-EYD-----TFFRTEIEILKSRAMAERVVDR--------LNLEEHPDWVGL
A0A6N6PKP9      ADPRGMDEL-STE-----KELKTIVENLESPALMLRLARH--------PELAEI------
A0A6N6Z250      -----GMQT-IDR-----TFINNQFETIQSRTVLLPVIER--------LQLERR------
A0A4V1SB02      IEGLDSTPI-KGT-----DQLNTVVQSLTSNKVLLAVANH--------TNYGKE------
A0A6N6QEJ2      FLQGPSQTG-FDP-----YFFNTEFEVLKSRRILDKVSER--------LHLAKV------
A0A3C1VB86      VEQVVSEDM-RSQ-----ETLNTVAQKLSNLALLTQVLEE--------NHLLPP------
A0A146G2Q9      --GQGGVQG-LDP-----RFLATQFEIIQRKEILYPVIDA--------LGLDRK------
A0A2T6D3Y2      --GQGGVQG-LDP-----RFLATQFEIIQRKEILYPVIDA--------LGLDRK------
A0A6N6P5E3      --GMDSGQH-YDP-----RFSTTQFQIIQRKEILYPVIDA--------LKLMQK------
A0A2D5VY59      LIGMQMSQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA--------LELRNR------
A0A2D8UZZ4      LIGMQMSQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA--------LELRNR------
A0A353DV86      LIGMQMSQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA--------LELRNR------
A0A2E5EPT8      LGGTPQGPD-FDP-----FFILTQFERLQSAEVLYPVIEK--------MNLGRV------
A0A6J4HTK1      GGGDPNAPV-HDP-----QLAPTVYQIIQRTGILYPVIED--------LKLQDK------
A0A6N6PHJ5      AGNSRIS-S-FDP-----YFIQTEFEVIQSETILSNVVDV--------LGLNDK------
A0A6M1RXR2      VDPLYNP-G-YDP-----YFIETEFQVINSEVVLTNVVNE--------LDLMRR------
A0A7C3DXS4      TDPLYSP-G-YDP-----YFIETEFEVINSELILTNVIHD--------LNLMVK------
A0A2V2SDV4      LQGQAFPSS-YDP-----YYINTEFELIQSEVILQPVITK--------LDLNKV------
A0A2V5PK75      AKRMPTA-G-YDP-----YFIQTEFETIQSERVLGKVIDK--------LELNDD------
A0A1V6DME1      TQTPLLP-G-YDP-----YFIQTEFEVIQSERILSNVVHQ--------LNLSVE------
A0A3D3DIJ3      ADRSTLA-G-YDP-----FFIQTEFELIQSELILGKVVAD--------LDLNTE------
A0A6I1K583      GG--------FDP-----YFVMTQFEILQSKEVLYKVIDD--------LKLVQR------
A0A350EWA4      IGGPTAVQG-FDP-----YFLQTEFEKIQSKTVLYQVITN--------LNLADF------
A0A5B5WZ91      GEDVVASSN-MTD-----NYIPMQYSVLTSSEVLKVVSKK--------LNLAAE------
A0A2N8HD92      GGDVVATSN-VTA-----NYIPMQYSVLTSTEVLKIVSKK--------LNLAAE------
A0A2N8HIT2      GGDVVASSN-VTA-----NYIPMQYSVLTSTEVLKVVSRK--------LNLAAE------
A0A354EBD3      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A355VEB2      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A2N8IMT3      GGDVIATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
R6K1U5          GGDVIATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A2N8IWC2      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A2N8I441      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A2N8I3A6      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A410SCC4      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A3R5VEW0      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A411SSG2      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
B2UKW3          GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAAE------
A0A7C3HWX0      ----QVQQP-YDP-----YFITTEFEKIQSSAVLYPVIER--------LRLDTN------
A0A1M6RLZ4      LGQDTSGRL-MTR-----QFFATQFQLIESEENLKRAAIR--------CQLPER------
A0A7C4KPD7      LSNFDP------------YWMQTQFEIIKSSTVLDAVINK--------LKLNER------
A0A354T7G8      SLAFTQE------------YIKTQFETITKPSTLYPVIQS--------LDLAKR------
A0A512MBZ2      DMLAGSD-----------VFVKTEFESINKPETLYPVIEK--------LDLQKK------
A0A2E8MEZ0      -SQMTPGST-MTA-----RYMENEFETITAPETLAEAAEN--------IDLPRR------
A0A6B3LBV6      TLTEGQKMF-ASR-----NFIANQFERMTSQQVLQRVVRD--------EDLVQK------
A0A2E3EC33      VGNLGTESL-PYM-----TFMQTQFEIIQSRETLKEVINNGKDSLGQPLDLXAK------
A0A2E4GN01      VGNLGSESL-PYM-----TXMQTQFEIIQSRETFKEVINNGKDSLGRPLXLMEE------
A0A1Z8XU55      VGNLGSEQL-PYM-----TFMQTQFEIIQSRETLKQVISKGKDSAGNPLDLKKA------
A0A2E1RQR9      VGNLGSEQL-PYM-----TFMQTQFEIIQSRETLKQVISKGKDSAGNPLDLKKA------
A0A2E3ISQ4      VGNLGSEQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGENSAGNLLDLKKS------
A0A2D6W6F4      VGNLGSDQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGVDSAGNLLDLKKS------
A0A2D8Z5A8      VGNLGSDQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGVDSAGNLLDLKKS------
A0A4Q2YKS3      ASGMDRMTP---------RFFETEFEKIKSSKSLEKVVNN--------LDLVKR------
A0A6N6P3T8      TSGFGRSTV---------NFFNTEFEKIKSRNSLMKVIDN--------LDLANN------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      ----------------------------------------------------PLFGGGKT
A0A2V5PST3      ---------------------------KIFTGASITSDNPIKRVRSWILGTLNSLISPVA
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      -------------------------RRNPKQLIGETGLSETNVIERLHQISKAGFFGLTG
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      --YWKKSGFRKEEIYDRSPIAVHFSERGNPAEAGFRVIPVSDTEFRLESGVNDSRPERET
A0A1G3ZFT0      QSRWSRILSRSQPEAEMTLFTFPPEDNRPYYLVSEKGNKISLFDSNHQRILEGKIGERLA
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ---W--------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      PKYW--------------------------------------------------------
A0A2V5URB2      --------------------------------------------------------PQFT
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      --YWKKDKFRKVEVYEDSPIAVQFTPEGGAADARFCVVPLSGKEFRLEKDEKDRGGQETG
R7DZW0          --YWKKNGFRKVEIYQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETG
A0A2N8HID1      --YWKKNGFRKVEIYQDSPIAAQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETG
A0A2N8HS06      --YWKKNGFRKVEIYQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETG
A0A6N2TNT9      --YWKKNGFRKVEIYQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHETG
A0A3R5R2M8      --YWQAQDFREIDLYRNSPILAVFEEIGSNRSCRISVTPVGEQSFILAYSNSREEPAFLK
A0A411SUQ6      --YWQKKDFRELDLYHATPLLVHFEQIDKQRACTLHITPLDEKRFTLGHPNDQGELILLE
A0A2N8HZF2      --YWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLE
A0A354E720      --YWQKKDFRELDLYHASPLLVNFEQIDKQRACTLHITPLDEKRFTLGHPNNQGELILLE
B2UPB6          --YWQKKDFRELDLYHATPLLVHFEQIDKQRACTLNITPLDEKRFMLGHPNDQGELILLE
A0A2V6JLK8      ---W--------------------------------------------------------
A0A2W5Z1A5      ---W--------------------------------------------------------
A0A2V6EA09      ---W--------------------------------------------------------
A0A2V6GQI7      ---W--------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ---W--------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      --YWKQQDLRQIDLYRDSPITVTFDGIAENRFCNVDITLQEGNTLVLTYHDINGNPVQEK
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ---W--------------------------------------------------------
A0A3E1ET42      ---W--------------------------------------------------------
A0A2A2YDW8      ---W--------------------------------------------------------
A0A352XLN9      ---W--------------------------------------------------------
A0A3D0YP62      ---W--------------------------------------------------------
A0A3D3DV47      ---W--------------------------------------------------------
A0A2E5XJ49      ---W--------------------------------------------------------
A0A2E6SBY8      ---W--------------------------------------------------------
A0A2E5QMS4      ---W--------------------------------------------------------
A0A2E7YXQ3      ---W--------------------------------------------------------
A0A2E3H787      ---W--------------------------------------------------------
A0A2E7AGN1      ---W--------------------------------------------------------
A0A2E7AKY7      ---W--------------------------------------------------------
A0A3D4CU34      ---W--------------------------------------------------------
A0A2E8M146      ---W--------------------------------------------------------
A0A355S8S2      ---W--------------------------------------------------------
A0A2D6DVN8      ---W--------------------------------------------------------
A0A3C1W2R2      ---W--------------------------------------------------------
A0A2E3NAY6      ---W--------------------------------------------------------
A0A2E3II01      ---W--------------------------------------------------------
A0A368B8C5      ---W--------------------------------------------------------
A0A3R7RBB5      ---W--------------------------------------------------------
A0A2A2QX62      ---W--------------------------------------------------------
A0A4Q3BWH6      ---W--------------------------------------------------------
A0A3N5WCF1      ---W--------------------------------------------------------
A0A4Q3C1K5      ---W--------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      --YWKKRDLRQIDLYRESPVEVIFENIPSDRSCSFDITLKGDSALSLTYQGSDGKPVQLE
A0A2N8HT11      --YWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEK
R7DS70          --YWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEK
A0A2N8HNL6      --YWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEK
A0A6N6PAZ1      ETDW--------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      --YWEKRNIRKVELYHTTPLKVEFGEEVDFQPCSLAVTPLNGREFSLSYREKGGRETALA
A0A2N8HCB0      --YWEKRNIRKVDLYHTTPLKVEFSEEAAFQPCSLAVTPLNGREFSLSCREKEGGENVLH
A0A2N8HP04      --YWEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTPLNGREFSLSYRAKESGENVLH
A0A2N8HRJ0      --YWEKRNIREVDLYHTTPLKAEFSEQVAFQPCSLAVTPLNGREFSLSYRAKESGENVLH
A0A6N2U9Y7      --YWEKRNIREVDLYHTTPLKAEFSEQVAFQPCSLAVTPLNGREFSLSYRAKESGENVLH
A0A366HAG0      ---W--------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ---W--------GQ----------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ---W--------GE----------------------------------------------
A0A4Y8P964      ---WLGLKKPSITK----------------------------------------------
A0A3D4HF88      ------------KM----------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      --YWYSQDFRKIELYNSSPILAVFEEIGKQRSCSFSITPRGEQNFILAYTTSQKKTTTLE
A0A2N8I9W1      --YWQKKDFREIDLYKTSPLLVHFERIDKQRACTLHITPLDEKRFMLSHYNNQGESVQLE
A0A4Q5IH27      --YWQKKDFREIDLYKTSPLLVHFERIDKQRACTLHITPLDEKRFMLSHYNNQGESVQLE
A0A2N8IBZ6      --YWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLE
A0A2N8IJW9      --YWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLE
A0A7G6DX28      --YWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLE
R6J100          --YWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQLE
A0A1V6J089      ---W--------GA----------------------------------------------
A0A3C1BZR1      ---W--------GM----------------------------------------------
A0A7C4KLL2      ------------PA----------------------------------------------
A0A1H6KPB7      ---W--------------------------------------------------------
A0A2E9ISN4      ---W--------KK----------------------------------------------
B9XAX1          ------------SF----------------------------------------------
A0A5R8KKM9      ---W--------SL----------------------------------------------
A0A139TS01      ---W--------GM----------------------------------------------
A0A3E1EJT7      ------------RL----------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ---W--------KP----------------------------------------------
A0A2E7SSH2      ---W--------KE----------------------------------------------
A0A349GXM8      ---W--------AD----------------------------------------------
A0A4P5YP61      YERKKGLFDAVAGT----------------------------------------------
A0A6B2LYM4      ---NRFLAPYEKGL----------------------------------------------
A0A6D1VXB3      ---WLGLKKESFRK----------------------------------------------
I0JYY7          ---WLGLKKESFRK----------------------------------------------
A0A4R7S1J2      ---F--------GG----------------------------------------------
A0A2A2XV69      ---W--------KK----------------------------------------------
A0A651H7X9      ------------EM----------------------------------------------
A0A4Y8P842      ---W--------IG----------------------------------------------
B3DZK9          ---W--------LG----------------------------------------------
A0A5E6MPC4      KPGW--------RK----------------------------------------------
A0A6N6PKP9      ---P--------AF----------------------------------------------
A0A6N6Z250      ---L--------SA----------------------------------------------
A0A4V1SB02      ---I--------AQ----------------------------------------------
A0A6N6QEJ2      ---Y--------AG----------------------------------------------
A0A3C1VB86      ---E--------GT----------------------------------------------
A0A146G2Q9      ---W--------GM----------------------------------------------
A0A2T6D3Y2      ---W--------GM----------------------------------------------
A0A6N6P5E3      ---W--------DL----------------------------------------------
A0A2D5VY59      ---W--------MK----------------------------------------------
A0A2D8UZZ4      ---W--------MK----------------------------------------------
A0A353DV86      ---W--------MK----------------------------------------------
A0A2E5EPT8      ---W--------GA----------------------------------------------
A0A6J4HTK1      ---W--------AK----------------------------------------------
A0A6N6PHJ5      ---W--------GK----------------------------------------------
A0A6M1RXR2      ---W--------GE----------------------------------------------
A0A7C3DXS4      ---W--------GA----------------------------------------------
A0A2V2SDV4      ---W--------GA----------------------------------------------
A0A2V5PK75      ---W--------GK----------------------------------------------
A0A1V6DME1      ---W--------GK----------------------------------------------
A0A3D3DIJ3      ---W--------GR----------------------------------------------
A0A6I1K583      ---W--------DQ----------------------------------------------
A0A350EWA4      ---Y--------RD----------------------------------------------
A0A5B5WZ91      ---W--------GM----------------------------------------------
A0A2N8HD92      ---W--------GM----------------------------------------------
A0A2N8HIT2      ---W--------GM----------------------------------------------
A0A354EBD3      ---W--------GM----------------------------------------------
A0A355VEB2      ---W--------GM----------------------------------------------
A0A2N8IMT3      ---W--------GM----------------------------------------------
R6K1U5          ---W--------GM----------------------------------------------
A0A2N8IWC2      ---W--------GM----------------------------------------------
A0A2N8I441      ---W--------GM----------------------------------------------
A0A2N8I3A6      ---W--------GM----------------------------------------------
A0A410SCC4      ---W--------GM----------------------------------------------
A0A3R5VEW0      ---W--------GM----------------------------------------------
A0A411SSG2      ---W--------GM----------------------------------------------
B2UKW3          ---W--------GM----------------------------------------------
A0A7C3HWX0      ---W--------AR----------------------------------------------
A0A1M6RLZ4      ---W--------NL----------------------------------------------
A0A7C4KPD7      ---F--------AE----------------------------------------------
A0A354T7G8      ---W--------EL----------------------------------------------
A0A512MBZ2      ---W--------SL----------------------------------------------
A0A2E8MEZ0      ---W--------GL----------------------------------------------
A0A6B3LBV6      ---W--------AL----------------------------------------------
A0A2E3EC33      ---W--------GL----------------------------------------------
A0A2E4GN01      ---W--------GV----------------------------------------------
A0A1Z8XU55      ---W--------GV----------------------------------------------
A0A2E1RQR9      ---W--------GV----------------------------------------------
A0A2E3ISQ4      ---W--------GV----------------------------------------------
A0A2D6W6F4      ---W--------GV----------------------------------------------
A0A2D8Z5A8      ---W--------GV----------------------------------------------
A0A4Q2YKS3      ---W--------GK----------------------------------------------
A0A6N6P3T8      ---W--------SL----------------------------------------------
                                                                            

A0A2A2XVF1      ---------------------------PAFVAPGAKPTEIQLADKLRGKVRAVLRRGTR-
A0A2V5UHJ2      NDAAKEGLVAGFWKELKNWAKGFMPATPTPSTPDPIPLSTRLAGSYLLMLEVRPVVSTS-
A0A2V5PST3      KFFRESRQESAESDTPDAAARGGNLVDRQETDKNKPVVSRGLVGHYMSFLQVNSIEKTR-
A0A2V5PXM3      ------------------------PRFLKIDDGAPRPTREKLVTRLSKMVDAKLRKGTR-
A0A1V5QB01      -----------------------------------------EVSRTITRISVAPVGKTA-
A0A1J4XH17      ------------------------TDVFLAPYSVSNKSKEAIAEILFHNRKIVPERSSL-
A0A7C5LI63      -----------------------------------------EIRENLVNLKVSAVSGSD-
A0A7C5P291      -----------------------------------------EVRENLTNLKISPIRGTQ-
A0A139SU05      -----------------------AIIQRPYLKSQAPGEPLPPLAAMLGLLSIDPVRNSF-
A0A139SPN4      -----------------------AIIQRPYLKSQPPGEPLPPLAAMLGLLSIDPVRNSF-
A0A1V6E7N1      -----------------------KILQRPFLTKLSPGATPPSAGAALGSMVPSPVRNSF-
A0A2D9MYT1      YAGGDAPALSREENRPLATGLFAFPPKPKDGEEPEDLTYEEQLKRLSDAVSVSPIRLSR-
A0A290QGD9      ------------------------AQFMAPYLKGGSGDPLTPAEVLFKNRRVIPRRMSL-
A0A1D8AS58      ------------------------ELFMAPFKSPGAEVPITAAEVVYLNRKIVPVRLSL-
I6AQC1          ------------------------RRFMQPYEKGRFGDPLTPLEVLGENRSIVPFRMSL-
W0ITH7          ------------------------RRFMQPYEKGRFGDPLTPLEVLGQNRSIIPFRMSL-
A0A258ANJ7      ------------------------PSFSGGHPADSKEARDNAIFMVSSMIRISLRKDTR-
A0A139TLN4      GVFGREIEFCSHTFTVEKTPRFDSRSLDAPVIVRKTFIKNAAIALIGGLTVNKASGKTN-
A0A1G3ZFT0      NQDKSIQLQINQIS----------ARAGTKFTLMQYPINDRMVRSMARRITIDDPEKLG-
A0A1Z8ZMT6      ------------------------KKAEEKKVFAEAPAPEQLAGIISGWTSSEVRRGTR-
A0A2E8MCT7      ------------------------KEPVKKKVFADAPEPEQLSGMISGWTSSEVRRGLR-
A0A290Q2Z2      -------------------------IGRSIGAYAPLATDETYNYLLKKMLRVESPRGSS-
A0A2A2RGK2      -----------------------PRFLSAVGISAKDATNDRTAGALSGMVGVIYRPQTR-
A0A2A2XXF7      -----------------------PRFLAAAGISARDASPDRVAAALSSMSASVYRLNTR-
A0A2A2R5D6      ---------------------------GTRLFGGSNLPMDKAFVLLNNRVDVNVQRNSD-
A0A3C1VJ32      ------------------------WGKK--YNNGETLKTTETMEILKQRMGLVPVRNTK-
A0A2N9NTX7      ------------------------WG-K--LEGGAPLKKQQTIDKLKRMMDPRQVRNTS-
B9XK55          ------------------------WK-Q--YNNGQKLKTSQSRAQLKRMMELHPDRNTS-
A0A4P5YMI6      ------------------------WAQR--YGSPVPLLDTEAYGVLTKRLDLRQVRNTS-
A0A2E6T482      ------------------------WDPN---EKG--LDLIKAREILKKTIDVRQYRNTS-
A0A3C0DQZ7      ------------------------WDPN---EKG--LDLIKAREILKKTIDVRQYRNTS-
A0A1Z9CBK5      ------------------------WKEH---YGGEELDEVRARKHLEKVIDVSQYRNTS-
A0A2D6ZI96      ------------------------WKEH---YGGEELDEVRARKHLEKVIDVSQYRNTS-
A0A358KGZ3      ------------------------WKKH---YGGKQLTDVEARKHLEKVIDVSQYRNTS-
A0A2E9ZQX4      ------------------------WKKH---YGGKQLTDVEARKHLEKVIDVSQYRNTS-
A0A3D5JZU0      ------------------------WKKH---YGGKQLTDVEARKHLEKVIDVSQYRNTS-
A0A2E6HCR0      ------------------------WKDD---NGGEPLTELVARKRLEKVIDVSQYRNTS-
A0A1Z8WN04      ------------------------WKDD---NGGESLSELRARKLLEKVIDVSQYRNTS-
A0A2D7L1N4      ------------------------WKDD---NGGESLSELRARKLLEKVIDVSQYRNTS-
A0A2E2R937      ------------------------WKDD---NGGESLSELRARKLLEKVIDVSQYRNTS-
A0A520QQY4      ------------------------WKDD---NGGESLSELRARKLLEKVIDVSQYRNTS-
A0A2D5MR66      ------------------------WKDD---NGGEALTELRARKRLEKIIDVSQYRNTS-
A0A2E0PDQ1      ------------------------WKDD---NGGELLTELRARKRLEKVIDVSQYRNTS-
A0A2E2ZZP9      ------------------------WKDD---NGGELLTELRARKRLEKVIDVSQYRNTS-
A0A7C4LRK7      ------------------------FAER--DKLPVPYRLDETMILLKRDVDITTYRNTS-
A0A2A2RGF2      ------------------------WDQK--YRLGQ--SKVKAYEVLTKLIDPRQVRNTS-
A0A2G4I5Y6      ------------------------WDQK--YRLGQ--SKLKAYQVLTKLIDPRQVRNTS-
A0A6N6PS97      ------------------------LSKR--YRLTSKLSQEDTFQIIKKTIDLQETRNTS-
A0A3M1I883      --------------LPPDRQFIPAWSKRLGLRDGELLNEQEAYQYLLRNMEVKQSRNTK-
A0A1V6JZ45      ------------------------WGQR--LKN--AVSEPEAYLLLRRNLDVRQSRNTS-
A0A7C7Z746      ------------------------WSEK--YNAGRTLTTEQTYQILKSKIDTSPTRNTS-
A0A520RRW5      ------------------------WMER--FKTDTPLTTNETFQVLKNSIDVDQYRNTS-
A0A356NPK0      ------------------------WMER--FKTDTPLTTNETFQVLKNSIDVDQYRNTS-
A0A2D7B5P5      ------------------------WMER--FKTDTPLTTNETFQVLKNSIDVDQYRNTS-
A0A3D3XGB5      ------------------------WMER--FKTDTPLTTNETFQVLKNSIDVDQYRNTS-
A0A2V6F8A1      ------------------------WGER--YNNGVALSKAETFDVLKGKIDVRQTRNTS-
A0A2V5TNH4      ------------------------WGGR--YNNNIPLKTPETFDILQGKIDVRQTRNTS-
A0A2V5X5Q6      ------------------------WGER--YNNNIPLKTPETFDILHGKIDVRETRNTS-
A0A4P5QM05      -----------------------------LSPPGQTMPLQWVTEILSRSMVVQEQRNTT-
A0A4Q3C001      -----------------------------YSGDGPPLPKQTVLRLLNADLVLQEVRNTS-
B4DB23          -----------------------------FSPPGQRLPLQQVYIQLRNSMKLNEVRNTG-
A0A6B3L938      -----------------------RDESSREFQSAAETSETDFLELLYSGISVSNQRGTT-
A0A2V5URB2      GQARHKNFAAELWSRATAWLNSLSSQPVTANAPDVYGINSQLIDAYQGMVEIEPLKRSR-
A0A2V2DJ66      -----------------------RKLMAPYKDMFTFGPRKTEEEILQMNRRVIPERMSL-
R7L5A9          -----------------------KRFIAPYHNMFTFGIRKSEEELLMDNRSIIPQRMSL-
A0A5R8KA81      --------------------------MTFPEVRDYIMTEPELVDALESEIDITIRKGTR-
A0A5B5WU87      TFGKEVRFDSLTFIVEKTPRFSEAALNVPVIV--RKTSVRNAAVGLRSGLTVKKANGKNN
R7DZW0          VFGKEIRFDSQAFIVEKTSKFDESSLNVPVIV--RRTSVKNAAMGLGSGLTVRKASGKND
A0A2N8HID1      VFGKEIRFDSQAFIVEKTPKFDESSLNVPVIV--RRTSVKNAAMGLGSGLTVRKASGKND
A0A2N8HS06      VFGKEIRFDSQAFIVEKTPKFDESSLNVPVIV--RRTSVKNAAMGLGSGLTVRKASGKND
A0A6N2TNT9      VFGKEIRFDSQAFIVEKTPKFDESSLNVPVIV--RRTSVKNAAMGLGSGLTVRKASGKND
A0A3R5R2M8      GEYGQPISLPFATVSIHPTSVMNADWNGQTVIIRHVPSQDTARALLANFSVARPDAKDSS
A0A411SUQ6      GFYGKPLTLPFATISVHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESS
A0A2N8HZF2      GFYGKPLTLPFAVISIHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESS
A0A354E720      GFYGKPLTLPFATVSVHPTSLMTDAWNGKTVIVRHSPVLETANALLHGLTITRPDSKESS
B2UPB6          GFYGKPLTLPFATISVHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESS
A0A2V6JLK8      -----------------------------ARD-GRPPSREIAYQMLRNRLDVDEVRNTD-
A0A2W5Z1A5      -----------------------------ANHSAGPLSREQTYAILRGKLEVDEVRNTN-
A0A2V6EA09      -----------------------------GKDLGRP-SREQTYKLLLSRLDVEEVRNTD-
A0A2V6GQI7      -----------------------------GKDLGRP-SREQTYKLLLRRLDVEEVRNTD-
A0A3C1HEJ2      -------------------------PRVVEPEIQGILSRAKLVARVSDLIAPRLRPATR-
A0A522ULD9      --------------------------GKKFNEDKSPINRSLAFSILSGALRVQPYRDTS-
A0A1V6JU76      --------------------------------DSRYRDSPDVARALAEDIRINPIRLSR-
A0A2A2XXW5      --------------------------------DERYTKSVDKVTAVTKDIKIVPIRLSR-
A0A6N6Q6V0      --------------------------------DGRYKKALDKISAVNEDIRIDPIRLTR-
A0A1Q6UHJ9      -----------------------VRFMAPFNDMFTLGPRKTEEELLAENRTIAPERMSL-
A0A2V2BXR0      -----------------------VRFMAPFNDMLTLGPRKTEEELLAENRTIAPERMSL-
A0A2D8V0G3      ---------------------------------EVFKGAENIVNAVRDCITISPIRLSR-
A0A348S017      ---------------------------------GRYAQSQNVINAVRNDISISPVRLSR-
A0A3C1UUV7      ---------------------------------GRYAQSQNVINAVRNDITISPVRLSR-
A0A350I3V2      ---------------------------------GRYAQSQNVINAVRNDITISPVRLSR-
A0A520RGV5      ---------------------------------GRYAQSLDVINAVRNDITISPVRLSR-
A0A3D3XF90      ---------------------------------GRYAQSLDVINAVRNDITISPVRLSR-
A0A2D7B522      ---------------------------------GRYAQSLDVINAVRNDITISPVRLSR-
A0A356NIC2      ---------------------------------GRYAQSLDVINAVRNDITISPVRLSR-
A0A2N8HDG3      GTFHSPIHLPFATVTVYPTSNMTETVPGTTITVRRTPVNAAADQLLANFTVMRPDAKESS
A0A146GCJ0      ------------------------PDFAPPRKDGSPYSEIELVDKLAQKIDVQLIRGTR-
A0A2T6D6H8      ------------------------PEFAPPRSNGGKYTDIELADRLASKVSAKLRRGTR-
A0A3D1TI55      --------------------------GRQFNDNQEEMDLESTISRLRSMVETVQVRGTT-
A0A3E1ET42      -----------------------------------GLTFDEALTKLERMIETETERGTE-
A0A2A2YDW8      -----------------------------------NVTEEDALMTLTGIVQAQNIRGTD-
A0A352XLN9      -----------------------------------NVTEEDALMTLTGIVQAQNIRGTD-
A0A3D0YP62      -----------------------------------GQDRKTVIDVLRQIVRTTQRRGTD-
A0A3D3DV47      -----------------------------------GQDRKTVIDVLRQIVRTTQRRGTD-
A0A2E5XJ49      ----------------------------------SGYDRDMALLKVKKILKTEQIRNTD-
A0A2E6SBY8      ----------------------------------SGYDRDMALLRVKKILKTEQIRNTD-
A0A2E5QMS4      ----------------------------------RGYDRDMALVKLKQILKTEQIRNTD-
A0A2E7YXQ3      ----------------------------------RGYDRDMALVKLKQILKTEQIRNTD-
A0A2E3H787      ----------------------------------RGFDRDMALLKLKSILKTEQIRNTD-
A0A2E7AGN1      ----------------------------------SGFDEDMALIKLKSILKTEQIRNTD-
A0A2E7AKY7      ----------------------------------SGFDEDMALMKLKSILKTEQIRNTD-
A0A3D4CU34      ----------------------------------SGFDEDMALIKLKSILKTEQIRNTD-
A0A2E8M146      ----------------------------------NGFDQNMALLKLKSILKTEQIRNTD-
A0A355S8S2      ----------------------------------NGFDQNMALLKLKSILKTEQIRNTD-
A0A2D6DVN8      ----------------------------------NGFDRNMAVLKLKSILKTEQIRNTD-
A0A3C1W2R2      ----------------------------------NGFDRNMAVLKLKSILKTEQIRNTD-
A0A2E3NAY6      ----------------------------------NNFDRNMALLKLKSILKTEQVRNTD-
A0A2E3II01      ----------------------------------NGFDRNMALLKLKSILKTEQIRNTD-
A0A368B8C5      ----------------------------------NNFDRNMALLKLKSILKTEQVRNTD-
A0A3R7RBB5      ----------------------------------NNFDRNMALLKLKSILKTEQVRNTD-
A0A2A2QX62      -----------------------------------NSDRESVRGTLRGIVSAQNIRGTS-
A0A4Q3BWH6      -----------------------------------NTDLESVRGILKGIVEAQDIRGTS-
A0A3N5WCF1      -----------------------------------NVDKEAALGILKGIVGTQNIRGTD-
A0A4Q3C1K5      -----------------------------------GVDKDTAIKILKGIVQTQNLRGTD-
A0A3R8IT45      ------------------------KKFMEPYEKGRFGDPLTPLEVLGQNRKIVPLRLSL-
A0A2A2PYE8      ------------------------RAFLAPYERAGTDITYVA-EILAKNRKIIPQRLTL-
A0A2T6CN73      ------------------------REFLAPYDTGAPEKPSVA-RLLKLNRRVIPQRLTL-
A0A2G4G428      -----------------------KEVLAPYQSGNIFSGPLSEQEVFSRQRSIMPQRQTL-
A0A6N6PCD8      ------------------------DPAFRPAPGDPPRTDAELAEIMQRQLQAKLKRGSR-
A0A139TV24      EELKKPVHLPFATITVYPTSHMPETIPGTTITVRRVPINAAADQLLANFTVKRPDAKESS
A0A2N8HT11      GKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESS
R7DS70          GKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESS
A0A2N8HNL6      GKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESS
A0A6N6PAZ1      ---------------LPDWLSHKLGKKSADTDHQPPPPPAALGGMASQWLTVSIRRNTR-
A0A6I1K459      ---------------------------PYFTGGTNTLTESQVMAAVGGMLDARLRRFTR-
A0A139TUL1      GKFGIPLELPFATVTVRTTSHFSSGSIGRPIFVERLSVKEACAQMLGRLSVTRPDSKESS
A0A2N8HCB0      GKFGVPLKLPSATVKVCPTSYFSSGSMGRTIFVERVSVKEAAAGMLGRLSVTRPDSKESS
A0A2N8HP04      GKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGRLSVTRPDSKESS
A0A2N8HRJ0      GKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGQLSVTRPDSKESS
A0A6N2U9Y7      GKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGQLSVTRPDSKESS
A0A366HAG0      ----------------------------------NLKSKQAAAGKLIGNLDAQSSIKSD-
A0A2U8DZK4      ------------------------LAAVLEIPGPLPVDFTYDYLIKKRIVSVESPKTSS-
A0A2T6DFL8      ------------------------IAALKDSPAAFPSAVTYAILTRK-MLRVESQRASS-
A0A1D8AWD4      ------------------------LGKQLNDGVALPSAITYRYLISK-MLRVEAPRASS-
A0A4Q1C9S2      ------------------------LGKQLNNGAPLPSAITYKYMLDK-MVRPDAPRASS-
A0A178IH18      ------------------------IAALLGASAPYPTDVTYEYLTKK-MLRVEMPRNTS-
A0A2T6DT99      ------------------------LAASQGSSVPLPTDVTYLLLVNK-MIRIETPRGSS-
A0A1G3ZT33      ------------------------LGKMLNNGEPLPTSITAQYLLRK-MLRVESQRSSS-
A0A3E1E2T2      ------------------------LAPALDSPEPLPDAITYHYLLQK-MLRVESQRSSS-
B1ZMW1          ------------------------LAPLLGATGPLPSAMTYRYLLNK-MLAVESQRSSS-
A0A3M1I8A3      ---------------------------------PRYSKEMDIVAALAKDITVTPIRMTR-
A0A4V0XS84      ---------------------------------IRYSRAKDLIKVLSEDLTVAPIRATR-
A0A351WE84      ----------------------------QYNDDKSPITKEDALATLSSSIKIEQDRDTS-
D5ENH7          -----------------------KKFMQPYEGAFSFSGPLTASEILGKYRKIMPQRMSL-
A0A0R2XQ77      -----------------------ERFMAPYADVLSFTGPLSPAALLAQNRRIMPQRGTL-
A0A2E9IN28      -----------------------ERFMAPYTDALSLSGPLTPLEILGRNRSIMPKRMSL-
A0A6N4WTJ5      -----------------------ERFMAPYTDALSLSGPLSPVEILGKYRKVMPQRMSL-
A0A1V5QDZ6      ----------------------------EVNDDGSPLPLERAHAMLSRSLKVEQFRDTS-
A0A4Y8P964      ------------------------HSKNSSEEEETSSIINSYTKRILDNLRIEPVKNTR-
A0A3D4HF88      -----------------------------LMEPYKGDEEVTINEVLYENRDVVPLRASL-
A0A6N6ZHN8      ---------------------QRLIQPYEDELESTLSGAPEVPSILARNRSVVPERSSR-
A0A6G6K641      ------------------------FVFLPRPAGRDANPLDVVVGRLQGCVSSGVRGRTR-
A0A5B5WI95      GTYGQSIALPFATVSIHPTSLMNEEWDGKPIIINHLTVLETAHGLLKNFSVTRPDVKESS
A0A2N8I9W1      GFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS
A0A4Q5IH27      GFYGKPLTLPFAVISIHPTSLMTDTWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS
A0A2N8IBZ6      GFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS
A0A2N8IJW9      GFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS
A0A7G6DX28      GFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS
R6J100          GFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS
A0A1V6J089      ------------------------QLNEDKSAITP----ELALQILQRSIRVEQDRDTM-
A0A3C1BZR1      ------------------------EFNEDKSPVAP----ELALQILSRSLRVEQDRDTT-
A0A7C4KLL2      ------------------------FVPQDGSVTR-----DEVIARLGTLTKAELRRGTR-
A0A1H6KPB7      -----------------------------------QTDDATAASILRGMIQVMPVRGKD-
A0A2E9ISN4      ------------------------KL-------------TEPERYVEFLVTSVPGSNGT-
B9XAX1          ------------------------FLPGNTNVLSE----AKLVNALAGMIVTKLRPETR-
A0A5R8KKM9      ------------------------PANGR----------QFAIGRLQGHLEVNSSARSE-
A0A139TS01      ------------------------TD-------------DLAATNLAGMIKVSPLRATD-
A0A3E1EJT7      ------------------------LLEPYKSHAGEP---PSPASIIYHNRQIIPQRLSL-
A0A7C3I5X9      ---------------------------------PRYQKHVDVARAVADDISVTPLRMTR-
A0A2D5WGA5      ------------------------ANGDPLSD-------VNARKILEKSIDIRQYRNTS-
A0A2E7SSH2      ------------------------LYKWDLND-------QQARKQLEKVIDVSQYRNTS-
A0A349GXM8      ------------------------R--------------LGGRHRMNPKIAISQVRGINP
A0A4P5YP61      ------------------------AAPEKEISI------DGIAGTLAAITESRMRRGTR-
A0A6B2LYM4      ------------------------DATLRGT--------RSVGQILYSNRAISPVRLSL-
A0A6D1VXB3      ------------------------HSINPSEGIEPTSEINLYAEYLLKNLQVTPVRNTR-
I0JYY7          ------------------------HSINPSEGIEPTSEINLYAEYLLKNLQVTPVRNTR-
A0A4R7S1J2      ------------------------KLPSAEDAL------PQAVGILSGALKAAPRVGTR-
A0A2A2XV69      ------------------------LYGIAGK--------EQTIFRLRKMIDVREIRNTE-
A0A651H7X9      ------------------------RRFMAPYETGDASDPVTPIEIIGQNRRIMPLRLSL-
A0A4Y8P842      ------------------------LKPKKTAPLPSS---EKLAEIVQNNLHVLPVRGTR-
B3DZK9          ------------------------LKPKKNGPLPSS---EKLSEIVQNNLHILPVRGTR-
A0A5E6MPC4      --------------------------AAKRANLEEEPYISPVAGLLVGNLRIEPVRNTR-
A0A6N6PKP9      ------------------------RAQIAGIDSE-----SRLQAIVGGKISVKIRVGTR-
A0A6N6Z250      ------------------------ALGLNGTLDRE----QTYLYLTRKMLQVEDRPNTS-
A0A4V1SB02      ------------------------SQKSNGQAGTDID--SVIVDTLNSKLKVTLRRNTR-
A0A6N6QEJ2      ------------------------RAKVPEINI------QQTYEVLSRAVEVRQRRNTS-
A0A3C1VB86      ------------------------VVTNGSKTVTR----ENIISQFEKNVKTSLRRNTR-
A0A146G2Q9      -----------------------------PSR-------EQAYFRLVRMINIQEIRNTE-
A0A2T6D3Y2      -----------------------------PSR-------EQAYFRLVRMINIQEIRNTE-
A0A6N6P5E3      -----------------------------NSK-------DIAYLKLRSMLTVSEVRNTD-
A0A2D5VY59      -----------------------------RYNLKQPLTLNEAFNVLKKSIEVDQYRNTS-
A0A2D8UZZ4      -----------------------------RYNLKQPLTLNEAFNVLKKSIEVDQYRNTS-
A0A353DV86      -----------------------------RYNLKQPLTLNEAFNVLKKSIEVDQYRNTS-
A0A2E5EPT8      ------------------------RYGIGEFTP------QKTKLLLEKRIDPTQVRNTS-
A0A6J4HTK1      ------------------------DGHRPSR--------EQAYNRLRSKLDVDEVRNTD-
A0A6N6PHJ5      ------------------------KYN-DGQKFKT----QESVGILKSRLNLRPRRNTA-
A0A6M1RXR2      ------------------------KYA-GGEPLKM----TEALMLLRSRMDLSPRRNTS-
A0A7C3DXS4      ------------------------KYA-GGEPLKM----QEALMLLRSRMDLRPRRNTS-
A0A2V2SDV4      ------------------------KYGPNGAPLQS----TDTMKLLQARMGLQPVRNTS-
A0A2V5PK75      ------------------------KYH-GGVKLKT----PDTIVMLKGRMDLRPVRNTK-
A0A1V6DME1      ------------------------KYA-GGERLKT----QETMTLLRNRMDLNPVRNTS-
A0A3D3DIJ3      ------------------------KYA-SGERLRT----PETIALLKQRIDLRTVRGTS-
A0A6I1K583      ------------------------KYRLGQSK-------FKAYQVLIKLIDPRQVRNTS-
A0A350EWA4      -----------------------------ARKLEVNLKPEEAYMLLKGDLSVSQMRNTE-
A0A5B5WZ91      ------------------------------TD-------ELAATNLAGMIKVSPRRATD-
A0A2N8HD92      ------------------------------TD-------EKAASNLAGMIKVAPVRATD-
A0A2N8HIT2      ------------------------------TD-------EMAASNLAGMIKVAPVRATD-
A0A354EBD3      ------------------------------TD-------EMAATNLFGMIKVAPVRATD-
A0A355VEB2      ------------------------------TD-------EMAATNLFGMIKVAPVRATD-
A0A2N8IMT3      ------------------------------TD-------EMAATNLFGMIKVAPVRATD-
R6K1U5          ------------------------------TD-------EMAATNLFGMIKVAPVRATD-
A0A2N8IWC2      ------------------------------TD-------EMAATNLADMIKVAPVRATD-
A0A2N8I441      ------------------------------TD-------EMAATNLADMIKVAPVRATD-
A0A2N8I3A6      ------------------------------TD-------EMAATNLADMIKVAPVRATD-
A0A410SCC4      ------------------------------TD-------EMAATNLADMIKVAPVRATD-
A0A3R5VEW0      ------------------------------TD-------EMAATNLADMIKVAPVRATD-
A0A411SSG2      ------------------------------TD-------EMAATNLAGMIKVAPVRATD-
B2UKW3          ------------------------------TD-------EMAATNLAGMIKVAPVRATD-
A0A7C3HWX0      ------------------------YYNPENEPIRPDEARQLTYQLLRRNMDVRQTRNSS-
A0A1M6RLZ4      -----------------------------PM--------QEVVSIMTKSLNTNQERGTD-
A0A7C4KPD7      -----------------------------RDGLQVPYRMDETRLLLRRMVDLNLYRNTT-
A0A354T7G8      -----------------------------PSR-------QAALAKLRANLETQSMLRSD-
A0A512MBZ2      -----------------------------PSR-------QAALGKLQGNLNAQSMPRSD-
A0A2E8MEZ0      -----------------------------DMD-------S-AIKTLENVVETIPIRGTD-
A0A6B3LBV6      -----------------------------TDE-------NQAIAKLRDSVETENRRGTD-
A0A2E3EC33      -----------------------------TSE-------EDAFXILKKKVETQXVRGTD-
A0A2E4GN01      -----------------------------SSE-------DDAFRXLKKKVETQDVRGTD-
A0A1Z8XU55      -----------------------------NSD-------EDAYRILKXKVETQDVRGTD-
A0A2E1RQR9      -----------------------------NSD-------EDAYRILKKKVETQDVRGTD-
A0A2E3ISQ4      -----------------------------PTN-------EDAYQILKRKVETQDVRGTD-
A0A2D6W6F4      -----------------------------PSD-------EDAYRILKRKVETQDVRGTD-
A0A2D8Z5A8      -----------------------------PSD-------EDAYRILKRKVETQDVRGTD-
A0A4Q2YKS3      -----------------------------DRD-------QIVAELKYKIITTQNIRGTD-
A0A6N6P3T8      -----------------------------DRE-------TVFNILT-SIVRTDNIRGTD-
                                                                            

A0A2A2XVF1      LIDIIVEDKDPV------MARDLAASFVKEFLRENFSQRLSVSRVATDFLQEESQKLKKK
A0A2V5UHJ2      LVVIKFTTPDPA------LSARLANAHASSYVRYGIDLRSQTNSEASEFLQEKLTELKER
A0A2V5PST3      LVEIAFVTPNPA------LSQKLADAHIKAFIRMNLEGRFQLTKEARDFLDIKNAELKAR
A0A2V5PXM3      LIDVKVEHTSPE------MAALIANSL-------------------LNFLRNEEKRLKVK
A0A1V5QB01      FLAITVESLDPV------LGSDMANALADEYLDFKAEERLNTSQATVVSLTQQANRVHEE
A0A1J4XH17      MIMLAYNHPDPE------IAAKVANMFAEEYINYNMTLNIDGSMKAIFDLKERAKEQQKV
A0A7C5LI63      IILISVDSPSRE------FARDFANALAQEYLLFRDEERARSAESALLMLTREVNRLSQE
A0A7C5P291      IILISVDSPSRD------FARDFANALAEEYFRFREEQRAASSESALLMLTREINRLSQE
A0A139SU05      ILRLTVGHQDPE------AAAILAQRHVDQFLSYLLENISGVNDTAVDFLRERAEQLRLE
A0A139SPN4      ILRLTVGHQDPE------AAAILAQRHVDQFLSYLLDNISGVNDTALDFLHERAEQLRLE
A0A1V6E7N1      LISVSVNHQDPE------AAALIANRYIDQFMQQIMDSTMGKNEYATDFLRKRSDDLRKE
A0A2D9MYT1      LVDVSVESPNRN------EAALIANTVISKFLEQDNNRKRGKLANAVDFLREEATNLSTA
A0A290QGD9      IIEVQYRHPDRV------LASDIANMFVDEFIAYNSRVRIDESMKAVDELRARVNDQRKK
A0A1D8AS58      VLQVQFSHPDKL------MAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERADQQKKR
I6AQC1          LVAIEYRHPDRL------IAAKVANLFLEEFVQFNTRQRVDQTFGILEDLKLRAESQRKT
W0ITH7          LVAIEYRHPDRL------IAAKVANLFLEEFVQFNTRQRVDETFGILEDLKLRAESQKKK
A0A258ANJ7      LIDFNVTGADPE------QVAALSNQAVLSLVSELESQKSKTLQGAIQALVAEGQRLQDK
A0A139TLN4      LINISVRCNNPV------KAENVLHNLVRFYNEASLDEKKKRGMNTDKFIEERLGVINEE
A0A1G3ZFT0      LLTLAYQDTNPH------LAARVVNEIAKVTQHKNTEKKSLEASKILSFLSKQLPLAKQD
A0A1Z8ZMT6      LIDISVNHTDPD------VAQVIANQIIQQFINIREGVNEEGKKSDLQHLLTAAKERESE
A0A2E8MCT7      LIDISVNHTDPD------VAQVIANQIVKQFINIREGVNEEGKKSDLQHLLAAAKERESE
A0A290Q2Z2      MIEVGVYSQDAA------LAAAIANEIARVYSDDRIMFATSEQREGLTQLRKELESQERT
A0A2A2RGK2      LIDVSITSRDPN------LSVKLANAYADEYIRYVFEKRSDAAKSATQFLVEEADRLRKK
A0A2A2XXF7      LIDLMITSADPN------LSVKLANAYCDEYIRYVFERRSDASKSATQFLLEEADRLRKK
A0A2A2R5D6      ILEIRVKSDLPK------EASDIANAIMDVYIEMRRADLQTRESRGFKTLDDEIAKQGEV
A0A3C1VJ32      LISITVYSDDKK------EAADLANSIAEAYRTYRIQTSQQQATTGLEVYQTQYLEESNR
A0A2N9NTX7      LVEIWVTSFNKE------EAAKLANEIAEAYQAHRLEERAELTTGGIKSLEERWKEQEAS
B9XK55          LIEIKIYSNDKK------EAAAIANEVAIVYQKYRLDQKLDITGAGIKVFKQQVQEQDDL
A0A4P5YMI6      LIEIRVFSEIPA------EAREIAQKIAEVYRDNRLNAKRSMSAGGIKKLQEKLETHEKN
A0A2E6T482      IIELRAYDRDKE------LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRMEEINKK
A0A3C0DQZ7      IIELRAYDRDKE------LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRMEEINKK
A0A1Z9CBK5      IIELRAYDRDRG------LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMTTINEE
A0A2D6ZI96      IIELRAYDRDRG------LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMTTINEE
A0A358KGZ3      IIELRAYDRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMEKTNDE
A0A2E9ZQX4      IIELRAYDRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMKKTNDE
A0A3D5JZU0      IIELRAYDRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMEKTNDE
A0A2E6HCR0      IIELRAYDGDED------LAREIAQALAEQYKNYRSNLQKRRVEAGINKLKERMEKTDEE
A0A1Z8WN04      IIELRAYDGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNE
A0A2D7L1N4      IIELRAYDGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNE
A0A2E2R937      IIELRAYDGDEN------LAREIAQALAEEYKKYRSNLQKXRVEAGINXLKERMEKTNNE
A0A520QQY4      IIELRAYDGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNE
A0A2D5MR66      IIELRAYDGDEN------LAREIAQALAEEYKNYRSKLQKGRVEAGIGKLKERMEKTNDE
A0A2E0PDQ1      IIELRAYDGDEN------LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERMEKTNEE
A0A2E2ZZP9      IIELRAYDGDEN------LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERMEKTNEE
A0A7C4LRK7      IIEIKVFSPKPE------EAAEIANEIANAYKEYRQETRMEVARSGVKTLQDEYAEKEKE
A0A2A2RGF2      IIEINVYSKDKA------EAAEIANKIAEIYKENREAQRKLQAEKGLKILRDRLADQDAL
A0A2G4I5Y6      IIEINVYSKDKE------EAAEIANKIAEIYKENRESQRKLQAEKGIKILRARLLDQDAL
A0A6N6PS97      LIEIRAYSEDPN------EASAIANKVAEIYQRVRLENRKSSTQRGIDALKLEFTERSKT
A0A3M1I883      LVEITVYSPIPE------EAADLANLIAASYKNWRQHSRREHMTNAIAVLQQKLEEQNAR
A0A1V6JZ45      LIEIRAYSENRD------EASAIANEVANVYKESRVEEKQRQTSAGISKLRAKLDEQAEA
A0A7C7Z746      LIEIKVYSDKPE------EAAELAQLIADEYKDLRKITRTHLIEGALIKLREELTIIENQ
A0A520RRW5      LIEIKAYSKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNK
A0A356NPK0      LIEIKAYSKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNK
A0A2D7B5P5      LIEIKAYSKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLXQQNK
A0A3D3XGB5      LIEIKAYSKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNK
A0A2V6F8A1      LIEIRVYSDAKDK--PAQEAAEIANQIATVYRDTQLGLKQEMSQKGIEVLRKELSQNDEK
A0A2V5TNH4      LIEIRVYSDAKEKEKPAQEAAEIANEIANVYRDTRLELKQEMSRKGIQVLREELQQNEEK
A0A2V5X5Q6      LIEIRVYSDAKEKDNPAQEAAKIANEIANVYRDTRLELKQEMSRKGIKVLKQELEQNDEK
A0A4P5QM05      LVDIGVYHTKPE------LAAVIANTIAVTYRDKRIEELRKNTDQTLKEMKDELKTKEDE
A0A4Q3C001      FIEIGVYNTDPQ------TAANIANTIAVVYQNKRLEEQQGNVDRSLAQFRDEVEKQRKV
B4DB23          LIEVGAKDTDAQ------RAANIANAIAVVYQEERQHELDKNVARGLEQLKDEVDRRRKE
A0A6B3L938      LINIEMTHPDPE------TAKTIANAVMMVYIEGEQARRAGGSSDAFRILKAEADDVALE
A0A2V5URB2      LVRISISSADPV------LAASVANAHAIAYVRQGLKLGSQANEEARKFLETKLAELKDR
A0A2V2DJ66      MIRVTYTHPNAE------MAARIADLFVNEYITYTRMTRVQTLLDSIEELRTKVAQQETK
R7L5A9          IVTVIFEHPDNN------MAARIANLFATEFINYTHQKRVQALMGSIDELRTKVSQQEAK
A0A5R8KA81      LIEVSVEDQVPE------RAQKIAGMLIEESIGQNIESRANAGTLANEFLAAESKRLAKA
A0A5B5WU87      LVNVSIRCNNPV------KAEVILHSIVHFYNEASLKEKNTRGTKTNKFIGERLAVISEE
R7DZW0          LINISMRCNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEE
A0A2N8HID1      LINISMRCNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEE
A0A2N8HS06      LINISMRCNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEE
A0A6N2TNT9      LINISMRCNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEE
A0A3R5R2M8      LLEMTLTASNPQ------KAEDVLNHLIEVYNQISIDEKKQSALKTRKFIEGRLAELEKS
A0A411SUQ6      LLEMTLTSSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGAS
A0A2N8HZF2      LLEMTLTSSNPQ------KAEDTLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAA
A0A354E720      LLEMTLTSSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLQELGAS
B2UPB6          LLEMTLTSSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGAS
A0A2V6JLK8      LLQISVYDGSPQ------LAADIANKIVSVYQDRRVEEEKEILNRAVTAMNEEVGKQQKR
A0A2W5Z1A5      LLQISVFDSNPQ------LAADIVNKIIAVYQDKRVEEEKDILNRAVGSMNEEVDKQQKK
A0A2V6EA09      LLQISVFDANPQ------EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVAREQKA
A0A2V6GQI7      LLQISVFDANPQ------EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVAREQKA
A0A3C1HEJ2      LIDVTVQHSDPQ------LTEQIANSLAREFLQRRFEQQISASESATSFYRQKEQELLET
A0A522ULD9      LISIIVRMEDAA------EAALVANEIAKVYREHRLSEKRSQMMRGMEALEGEIEKQQDK
A0A1V6JU76      LVDVVVEHPNAS------KAAGIANALVEEFIEQNLVQKQKRTMDMLFFLRSQANGLEVD
A0A2A2XXW5      LVEVQVTHPKGE------QAQRIADTILQVFLQQNLDDKKSKALQGLKILEQEATGKEVE
A0A6N6Q6V0      LVEVKARHPVQS------RARDMADTLLDIFLEDNQTRKSLKAMSGYRALKVEAQAQEAD
A0A1Q6UHJ9      IIRIAFEHPDPD------MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKVSQQEAK
A0A2V2BXR0      IIRIAFEHPDPD------MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKVSQQEAK
A0A2D8V0G3      LVEVSVEHPSPL------QAAAIANKLMQNFLTRNLDKKKQRAFESYKWLQNEVNQLADD
A0A348S017      LVEISVQHPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEE
A0A3C1UUV7      LVEISVQHPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEE
A0A350I3V2      LVEISVQHPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEE
A0A520RGV5      LVEISVQHPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEE
A0A3D3XF90      LVEISVQHPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEE
A0A2D7B522      LVEISVQHPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWXDTEVDGLQEE
A0A356NIC2      LVEISVQHPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEE
A0A2N8HDG3      ILQMTLTSTNPV------KAADTLNKLIAVYNDHSTAERRTTAVKTKDFIREQRAQVGAD
A0A146GCJ0      LVQIVVEDKNPE------KAQKIAATFVKEFFRENFDQKLALSRVANEFLQDEADKLKVK
A0A2T6D6H8      LIELTVEDKNPE------LAQKIAFSIVREFLRENFDQKLALSRVANEFLQEESEKLKAK
A0A3D1TI55      IIEVQVTSRDSA------EAAAIANKIAEVFQETRLASVKKKYSDALVQMQEEMDQQKFK
A0A3E1ET42      IMTVIVSSVRRD------EAAAIANEVREAYDAQRQEIEAERIRRLTQTLDAKIKSSEND
A0A2A2YDW8      LIEITVLHPGAE------DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAVLEHSDV
A0A352XLN9      LIEITVLHPGAE------DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAVLEHSDV
A0A3D0YP62      LIEISVRHRKKE------EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQNKSDR
A0A3D3DV47      LIEISVRHRKKE------EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQNKSDR
A0A2E5XJ49      HIEIRIRHQKPE------DAQLIAQEIAKSYQLVRNADERARAGEALDALEAEVRSQEDL
A0A2E6SBY8      HIEIRIRHQKPE------DAQLVAREIAKSYQLVRNSDERARASEALDALEAEVRSQEXL
A0A2E5QMS4      HIEIRIRHQNSE------DARDVAKEIAESYQXGRNADERNRAGEALDALEAEVRSQEDL
A0A2E7YXQ3      HIEIRIRHQNSE------DARDVAKEIAESYQLGRNADERNRAGEALDALEAEVRSQEDL
A0A2E3H787      HIEIRIRHQKQE------DARDIAKEIAESYQLGRNADERKRAEEALDALESEVRSQEDL
A0A2E7AGN1      HIEIRIRHQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDL
A0A2E7AKY7      HIEIRIRHQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDL
A0A3D4CU34      HIEIRIRHQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDL
A0A2E8M146      HIEVRIRHQNRD------DARNIAKAIAESYKEGRNEDERKRAGDALDALESEVRSQEDL
A0A355S8S2      HIEVRIRHQNRD------DARNIAKAIAESYKEGRNEDERKRAGDALDALESEVRSQEDL
A0A2D6DVN8      HIEIRIRHQNRD------DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEVRSQEDL
A0A3C1W2R2      HIEIRIRHQNRD------DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEVRSQEDL
A0A2E3NAY6      HIEIRIRHQNRD------DARDIAKAIAESYQEGRNEDERKRAGDALDALEAEVRSQEDL
A0A2E3II01      HIEIRIRHQNRD------DARDIAKAIAESYQEGRNEDERKRAGDALDALESEVRSQEDL
A0A368B8C5      HIEIRIRHQNRD------DARDIAKAIADSYQEGRNEDERKRAGDALDALESEVRSQEDL
A0A3R7RBB5      HIEIRIRHQNRD------DARDIAKAIADSYQEGRNEDERKRAGDALDALESEVRSQEDL
A0A2A2QX62      LIEIRVRYNDPK------DAQAIASAVSEAYRERRTALQSEVASQAMDQLGKAVVQQKDL
A0A4Q3BWH6      LIEIRVRYNDPK------DAQKIAKEVAEAYRERRRKLQGDHANQTLDELRKAVLVQEDL
A0A3N5WCF1      LISIRVRHTNKV------DARDIAEEVARAYKEYRAEIETRDADRQLQELNKAVRDQEDK
A0A4Q3C1K5      LIQIRVRHTSKE------DARNVTDEVAKAYRDYRLEIENRDADKALYELNKAVRDQEDK
A0A3R8IT45      IVGVEYTHPDRL------IATKVANLFLEEFITFTSRQRIDQTFTILEDLKLRAETQKKK
A0A2A2PYE8      VVTVAYQHPDRF------VAAKVANLFAEAYLDHNISLRTQESNNAVEGLKGTVEEQQKR
A0A2T6CN73      MVWIAYKHPNRF------VAAKVANHFARAYIDYNTQLRISEGVKAVEDLKGPVETQRKL
A0A2G4G428      VVNVEFTHPNRE------LARQVTTLFCKAIQKNSEDERLVITNPLVEKYRMDIDSVEDK
A0A6N6PCD8      LIEISFDSVNPE------RAAKVARTLVEEYTKGYFEQNAKSATAANDFLRKQAAELKER
A0A139TV24      LLQMTLTSSNPD------KATDTLNKLIEIYNEHSREERRAIAVKTKEFIRRQLEQIGEE
A0A2N8HT11      ILQMTLTSTNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGAD
R7DS70          ILQMTLTSTNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGAD
A0A2N8HNL6      ILQMTLTSTNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGAD
A0A6N6PAZ1      LLDITITHPVPE------VAKAFADAVAREYLAEIANARSAGRSNSIDLLEKESKEARSS
A0A6I1K459      LIDVTAESGDPA------LAQTLAQAVVEEYIKQNSEDRTGVGQNAGQFLMAEEMRIKER
A0A139TUL1      LLELTLRLSHPQ------KAEDVLNYLIEVYNDHSRREKQIASTRAEDFIVKRIEKLGGQ
A0A2N8HCB0      LLELTLRLSHPQ------KAEDALNYLIEVYNDHSRREKQLAASRAEEFIVKRIGKLGGQ
A0A2N8HP04      LLELTLRLSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQ
A0A2N8HRJ0      LLELTLRLSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQ
A0A6N2U9Y7      LLELTLRLSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQ
A0A366HAG0      FITLDYYDEDPD------LAALIANTIADSYKETRLETDNARINKAIEGLNIQIAAKELQ
A0A2U8DZK4      IVEITIDTRDPA------LSAAIANEIVGVYTEDRINLATAAQKADLAELNNQLAAQEKI
A0A2T6DFL8      VIEINVDAEDPQ------LAADIANEVARTYSADRIALATSDQSEGMAQLRQELLKQEQA
A0A1D8AWD4      IIEIDVYARDQR------LAADIANAIARVYAEDRITLATSDQREGLAQLRKELDKQELA
A0A4Q1C9S2      IIEINVFARDNR------LAAEIANAIARVYAEDRIALATADQREGLAQLRKELVKQEQA
A0A178IH18      LLEVNVFSRDAA------LAAAIANEIARAYSEDRIAFATAEQRAGLDQLRRELAGQERA
A0A2T6DT99      LIEIEVSAQDPA------LAAAIANEIGTAYSADRIDFATSQQREGLAQLRKELEKQEKV
A0A1G3ZT33      IIEIDVYAQEPA------LAARIANEIARVYSENRINFATAGQREGMTELKKQLAAQEEV
A0A3E1E2T2      LIEISVYSEDPT------LGAVIANEIARVYSDDRINLATSDQREGFVKLRGELIAQEQV
B1ZMW1          LIEINVYAQEPP------LAAAIANEIARVYSDDRIALATSEQREGLAHLRKELEAQEQV
A0A3M1I8A3      LVEVSVEHTDPR------KAKDIVDRLANEFIERNRLLKTGRMMSTLQVLRSQAQQMERE
A0A4V0XS84      LIEIKANHTDPQ------KAAKIVNTLVSIFMKQNTDDQSSKSQETFKLLTDEAKSMKVK
A0A351WE84      LINISVTQEDRE------LAARIANEMAAVYREQRLDVKRSELRRAIEVLDNEVQKQQEK
D5ENH7          MVSVTYTHPDSQ------MAADIANLFADEFINYKLTENIDASMVAVEGLRIRADRQKER
A0A0R2XQ77      MIGVGYNHPDPV------IAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQQKER
A0A2E9IN28      MIHIAYSHPDPI------VAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRIRADQQKER
A0A6N4WTJ5      MIGVAYTHPDPV------IAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQQKER
A0A1V5QDZ6      LISIQVYREDPT------EAARIANSIAQVYHDQRLSMKRRELKRAIEALEGELAKQQEK
A0A4Y8P964      LVKIKFDSVNAE------AAAQIANAYAEAFIAFGLDRKLEANQHARQFLAKQLDSMRKK
A0A3D4HF88      LIAVTYTHPDAR------IAAHVANLFADEYINYNLRLTIENSMKAVEDLKLRVNQQRSE
A0A6N6ZHN8      IVNVAFTHPNPQ------VAQEVSNLFAEEFIDFNRTKAIEGNLRATEGLRDEAAKQSER
A0A6G6K641      LIDIRAEHTDPE------TARKLADGVAEEYLRFTIETRNRSNQMANQMLMEEATRLKEK
A0A5B5WI95      LLEMTLTANNPQ------KAADVLNQLIAVYNQVSIDEKKLAAQKTKKFIEGRLEELEKS
A0A2N8I9W1      LLEMSLTASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAA
A0A4Q5IH27      LLEMSLTASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAA
A0A2N8IBZ6      LLEMSLTASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAA
A0A2N8IJW9      LLEMSLTASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAA
A0A7G6DX28      LLEMSLTASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAA
R6J100          LLEMSLTASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAA
A0A1V6J089      LMNISATSEDPK------QAAAIANEIANVYRERRLADKRREIQHAIDAMSNEVRKQQER
A0A3C1BZR1      LMNISATSEDPK------LAAEIANEVANVYRDRRLLAKRREIQRAIDAMSNEVRKQQER
A0A7C4KLL2      LIDILAVHTDPK------LAADIANSLAEQYMAYDIQTVSATTKGAYSYLRDETERLKKK
A0A1H6KPB7      LVDVKVVGSDPA------LVKLICDAVTECYKEGREAQENEVLDKAIATIQEELTRRENE
A0A2E9ISN4      MIDCLVDSVAAE------YSKAYLVEMIQGYRSLRMEELMEVNQSALLGLKNEETRVLED
B9XAX1          LVDITVTHPNAE------MAQKLANAVAQEFILESLDQRFSNTKAANELLYAEAGKLKQK
A0A5R8KKM9      IINITYYDEDPQ------LAADIANAVAESYRETRIQVDRDLADNSIKEFNIQVAAKEQL
A0A139TS01      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVLREQEDI
A0A3E1EJT7      MTAIEFRHPNPK------IAARVANLIAVEYIAYNSRLRVEESLKAVDDLKDRADQQRKR
A0A7C3I5X9      LVDVGVEHTSPT------KAAAIANTLATEFIDWMAGQRQERTSKMLYFLRNQASGLEGE
A0A2D5WGA5      IIELRAYDRDPN------LAQDIAQALAEEYKNHRTSLQKERVKTGIDTLTNRMEKINIE
A0A2E7SSH2      IIELRAYDGDKQ------LAQEIAQALAEAYEEYRQSLQQKRVQAGIDKLKERMEKTNEE
A0A349GXM8      MVSVAVQSRNKD------YTAAFLSLLIDEHREEWQTVQRQARNSAGGMLEQELARLDQK
A0A4P5YP61      LIDVSVEHPNAA------MAALLANSIFKQYVQLSYEQYVSSGLTASQFLVEEAEKLKKK
A0A6B2LYM4      VVNIIFTHPDKE------VAAVVANYFAEEYIDFNRNQQIEGSLRAVDDLRSQADQQLAK
A0A6D1VXB3      LVQIKFDSVNAQ------AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQLDSMRKK
I0JYY7          LVQIKFDSVNAQ------AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQLDSMRKK
A0A4R7S1J2      LLDITATHGDPI------VARDLAVATAKGVMKWDLEQRSQSVGVANEFLMQEAERLRKK
A0A2A2XV69      LIQISVLDQDRN------EASEIANRIAEEYQRRRIGEQQGTVNRSLIQLKDEVAKQSRR
A0A651H7X9      VISVQYRHRDPV------LAARVADLFVEEFINLNTQMRIQESLRAVEDLRDRAEQQRKV
A0A4Y8P842      LIRICYDSPNSF------GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQIELMKKK
B3DZK9          LIRICYDSPNSF------GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQIELMKKK
A0A5E6MPC4      LVKIRCESPSAF------GAAQLANVYAQSFITFGLDRKLEANRYARKFLAGQLETLRKK
A0A6N6PKP9      LIDITVEDENPA------LAQKISQLVVSEFMRASSESGAQNSRGAHEFLRQEADRLKLT
A0A6N6Z250      VLDIGVWAPDRE------LSADIANEIARVYEQNRIAFANTTQNEALGKLQEQLDLQDAR
A0A4V1SB02      LIDIVAEENSPK------KAQALANEVVNQFFLLQGSDKSGVSKDAFVALKAQEEDLRKK
A0A6N6QEJ2      IIEISAYDQDAA------LAADIANRIAEAYEQDRDLDRNDRLLRGLTTLSNALSNLEEQ
A0A3C1VB86      LIDITVRNTDPG------LAARLANSLVKNYLGQDALVQSSVNEEAGVFLRREADRLKKK
A0A146G2Q9      LIHITVFSTDNK------EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVEKQQAI
A0A2T6D3Y2      LIHITVYSTDNK------EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVEKQQAV
A0A6N6P5E3      LIQISVLDQDRQ------EAADLANTIAVEYQKKRIDEQQGWVARSLVQLEDEVNKQRKK
A0A2D5VY59      LIEITAYSQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEK
A0A2D8UZZ4      LIEITAYSQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEK
A0A353DV86      LIEITAYSQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEK
A0A2E5EPT8      IIALTVYSEDKK------EAAEIANTIAKVYAETREQNRITQVRKGIAKMREKLGEASNS
A0A6J4HTK1      LLQISMYSTDPQ------EAADIANKIVAVYQDKRVDEEKEILNRAVASMNEEVGKQQKK
A0A6N6PHJ5      LIDVQVFSENPT------DASDLANAVAETYRQWRLEKGQRLGKGGVKALEDQLKIEDEK
A0A6M1RXR2      IIEIRVISEDPQ------EAADIANAVARSYERYRIEQRKKLSMGGIAVLVDRLEEHQKR
A0A7C3DXS4      IIEIRVVSEDAQ------EAADIANAIALSYQQHRIEQRKQLSMGGIAVLVERLEEHQRR
A0A2V2SDV4      LIEIRVTTDKPE------EAAKLANEIAQAYCDYRVEHRKQMTMGGVDALEKKFTEQQGK
A0A2V5PK75      FIEIVVYSENKD------EAARLANAIAEAYQEHRQEQREKLSQGGIDAMEKRLKEQEEK
A0A1V6DME1      LITIRVFSQDAE------EAARIANEIAETYKEYRLAQRRELTMGGIRILEDRFQDQEKK
A0A3D3DIJ3      LIEIVVYSEKPE------EAARIANAIADAYKTHRQEQRAQLSRGGIKALEERFAEQEAK
A0A6I1K583      IIEINVYSKDKA------EAAEIANKIAEVYKASRDELRLRLVDQGLKTLREKLTEHHGF
A0A350EWA4      LIEITVFNENKA------MARNIANEIAKVYREWRMNLSDERFQEGFDAINQQLEKAESD
A0A5B5WZ91      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVLREQEDI
A0A2N8HD92      LVDVIVSGPDPK------LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVLREQEDT
A0A2N8HIT2      LVDVIVSGPDPK------LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVLREQEDT
A0A354EBD3      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A355VEB2      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A2N8IMT3      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
R6K1U5          LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A2N8IWC2      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A2N8I441      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A2N8I3A6      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A410SCC4      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A3R5VEW0      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A411SSG2      LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
B2UKW3          LVDVIVSGPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDA
A0A7C3HWX0      LVEIRVFSRSPA------EAAEIANAIAESYKGWRLTNRMEETYKGIEVLEIELGHQSNR
A0A1M6RLZ4      LVEIAFVHSNRE------DVKMITQAIADSYREMRIEDEEKRRTEASYELEKKIQAQEDL
A0A7C4KPD7      IIEIRVESQKPE------EAAEIANSIAEAYRDYRQRTRLTMVSKGIETLQDELKSKEQE
A0A354T7G8      FVSIDYYDQDSQ------LAANIANEIAKSYMEQRNNIETEKKQKALTVLQQQISDQEEL
A0A512MBZ2      FVIIEFYDQDAA------LAADVANAVASSYMTQRIEIDSSQKREALERMQKQIAEQESL
A0A2E8MEZ0      FIEITVTHANPE------DAKEIAEAVSQAYIERRNSTEEGRAQEALEALNQELQDQGDL
A0A6B3LBV6      IVEIRVRDTDAD------LAAQIANSLYRAYAEALDDEVNLINAQSTGDLDAQLDEQSEK
A0A2E3EC33      LIDIEVYDTDAQ------LAADIANALANAYQARRQNEEKERADTALEKLDTQIMAQMTR
A0A2E4GN01      LIDIEVFDTDAQ------LAADLANALAXAYQXRXQNEEKXRADKALEXLXTXIXAQMTX
A0A1Z8XU55      LIDIEIYDTDPK------LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQIKKQEGR
A0A2E1RQR9      LIDIEIYDTDPK------LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQIKKQEGR
A0A2E3ISQ4      LIEIEVYDTDPN------LAADIANAVAKAYKIRRQRVEKERADTALALLDLQIQQQEKR
A0A2D6W6F4      LIDIEVYDTDPN------LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGR
A0A2D8Z5A8      LIDIEVYDTDPN------LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGR
A0A4Q2YKS3      LISIKVRHVNKE------DARDVATEVSEAYRQYRNDLEGQEAEKAMEELSKAVREQEDI
A0A6N6P3T8      LITISVRHSDKD------EARDIAAEVARAYKEYRSETENKEGDLALLELKKAVRAQEDI
                                                                            

A0A2A2XVF1      LEESEIKLQRYKEQNQAVSLEE-----------------RQNITVERLRELSSKATEAKS
A0A2V5UHJ2      VQQSEAALNSYRKEKGIISVDD-----------------KSNVIIERLLDLNKGLTAAEG
A0A2V5PST3      LERAEAELNRFRQTHGVVSIEK-----------------GENIVIDRLVDLNRNLTTARA
A0A2V5PXM3      LEQSERAMQEYKEQTKSVSLED-----------------RQNVVVEKLKELNQKVTEAKS
A0A1V5QB01      LKRAEERALEFARQNSVIAIQE-----------------RGNVAARILGTLSSQAAQFRT
A0A1J4XH17      VENIETQMAEYREKYGTVSLEQ-----------------QADIDHQELTEINKTVTDARR
A0A7C5LI63      VKAAQDRYLTYAKEHNLPVLQDTAASWKQLYSLQLNSYVKLRHALELAKAKETALEK-SD
A0A7C5P291      LKSANDKLLNYAKEHNMAMLERQEQVYQWKYWQIMNNLGKATVELAEAKTRKQMLDSGTD
A0A139SU05      SEAKAQRQQEYMQRHNLISLDN-----------------STSIVDSRLLAVNGSLTQARL
A0A139SPN4      SEAKAQKQQEYMEKNNLISLDS-----------------STSIVDNRLLTINGALTAARL
A0A1V6E7N1      SEAAALQVQRFMEVHKLVSLDE-----------------STNLVNARLQTVSTELTRVRL
A0A2D9MYT1      VHTNYMALHNFKLEWDIISLED-----------------SQNTTLQALLKAQTDYDAAHS
A0A290QGD9      VEELATRLQTYRETHKMVSLDQ-----------------RRDMVTETLKARNIIVTQTNA
A0A1D8AS58      VEEMAIILQNYREKNQQVSLDQ-----------------RKDIVTEKLKALNAYVTQTTS
I6AQC1          VEDLNRQMQAYREKYNMGSLDK-----------------TKDIQTRKLMEQGSLVTQSGA
W0ITH7          VEDLNRQMQAYREKYNMGSLDK-----------------TKDIQTRKLMEQGSLVTQSGA
A0A258ANJ7      LKKSEIAMHDYKRSNQAISLDE-----------------RKDLVLSKLKELGSELNQQSK
A0A139TLN4      MGENDLAIENLKKESNILTDLST----------------ALTEEYENSLNDKKDLRELTL
A0A1G3ZFT0      LTRAELALNRYHTTSGKIDTK------------------------LEIKNLIQEIMVIEK
A0A1Z8ZMT6      LETARRRAGTY-------------------------------------------------
A0A2E8MCT7      LETARRRAGSY-------------------------------------------------
A0A290Q2Z2      VSLQRDMVEQLRKDLGISGVDLNAR--------------YSDMEIETLRQMQNSLIALSV
A0A2A2RGK2      LRVSEEAMQSFRERERAASIET-----------------MLSSAQSQVGEVSNNQSLIQR
A0A2A2XXF7      MRVSEEAMQSFRERERAASIEN-----------------MLASAQSQIAEILGVQNEIQK
A0A2A2R5D6      VQRAKDYVEELRKSLNLNMVGGGEN--------------ETQMIEEEWKRKSALLDDVRA
A0A3C1VJ32      IEMLQANVDNLRRTLDINN--GTASSPEP----------ELTVEQLRSY--QAQKLESEQ
A0A2N9NTX7      VGKAQSNVDYLRDKLKISDPNSGAEMPGP----------LLTTESLHRI--EGLRIESSA
B9XK55          IAKQEAKVDKLRKDLKVTDL-GGESATGP----------QQTLEPMNVMHYNTLRIDAET
A0A4P5YMI6      IREKQKVVEAIRKDTGITLI--TPEGAGA----------YNTLATETLRHLDSLRNTAHL
A0A2E6T482      ITGLQGNVDRMRTELGISDA----AGEES----------YSIIEPEIVRRYESELITAKG
A0A3C0DQZ7      ITGLQGNVDRMRTELGISDA----AGEES----------YSIIEPEIVRRYESELITAKG
A0A1Z9CBK5      IGAMQANVDXLRVQLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKG
A0A2D6ZI96      IGAMQANVDXLRVQLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKG
A0A358KGZ3      ITAMQANVDDLRAKLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKG
A0A2E9ZQX4      ITAMQANVDDLRAKLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKG
A0A3D5JZU0      ITAMQANVDDLRAKLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKG
A0A2E6HCR0      ISVMQAKVDDLRVKLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKG
A0A1Z8WN04      ISLMQAKVDSLRVTLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKS
A0A2D7L1N4      ISLMQAKVDSLRVTLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKS
A0A2E2R937      ISLMQAXVDSLRVTLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKS
A0A520QQY4      ISLMQAKVDSLRVTLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKS
A0A2D5MR66      ISVMQAKVDALRVKLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKS
A0A2E0PDQ1      ISLMQAKVDSLRVKLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKS
A0A2E2ZZP9      ISLMQAKVDSLRVKLGISDA----AGEDS----------YSIVEPEIVRRYESELITAKS
A0A7C4LRK7      YQKSMDEVKRLREELQVYDI--DPYSGRV----------LGTLEQETLRRLEAIQIEAHA
A0A2A2RGF2      VRTALTNVNQIHQDKGLNVI---HEVGGS----------VMSLETDTIRALESQLIEIRG
A0A2G4I5Y6      VRTALTNVNQIHQDKGLNVI---HDGGGT----------IMSLETDTIRSLESQLTDIRG
A0A6N6PS97      VEKLQQKVDGLRKDLGVSDV-----GDSS----------QVTLEPETMRMFERDRVNAKQ
A0A3M1I883      VERLQKQLDQLRLELNIPDT-VAGTAGAY----------SISTERERLSTLLQALQQARS
A0A1V6JZ45      VAKLQDNVDQLRAELNIPDS--INDASVY----------QTSLEREKVSAMAQELTRAHS
A0A7C7Z746      IDSQQTAVDQLRDELKITDV--SIEGIPS----------YAFLEPENVKQMEGAKTRAQL
A0A520RRW5      VQTKQKDLDKLREDLNISDI-YSAEGSSI----------GMTTEPQIVMKLEQERTVAEA
A0A356NPK0      VQTKQKDLDKLREDLNISDI-YSAEGSSI----------GMTTEPQIVMKLEQERTVAEA
A0A2D7B5P5      VQTKQKDLDKLREDLNISDI-YSAEGSSI----------GMTTEPQIVMKLEQERTVAEA
A0A3D3XGB5      VQTKQKDLDKLREDLNISDI-YSAEGSSI----------GMTTEPQIVMKLEQERTVAEA
A0A2V6F8A1      IKEAEAKVDELRKEYSISDI--SAEGPYA----------ISTLEPQTVRSLEEQRIRAEA
A0A2V5TNH4      VKAAEAEVDQLGKEYKVSNG--SLEGA--------------TLEPQTVRSLEEQRIRVEA
A0A2V5X5Q6      VKAAEIAVDQLRKEYKISDI--QPEGAYA----------YSTLEPQTVRSLEEQRIRVEA
A0A4P5QM05      MARLFQEASRIRQDESISDPDPDSSNAA-----------LSITAPTGIATGETQLAETRA
A0A4Q3C001      VEDAAVLAAKIRQEDGIVDPDIENPTAL-----------ISGGD-RSIVSSETAVNEARN
B4DB23          MEDTSAVAMQIRAREGIVDSDPDKENSV-----------ISGGEGGNVLQRQQQVNEQQI
A0A6B3L938      LESAERSFHVYRAALAL-------------------------------------------
A0A2V5URB2      VQKSEEALNHFRRAKGIISLND-----------------KENIVVDRLADLNKRLTEAEA
A0A2V2DJ66      VKELDRRLVEYREKNGAISLDQ-----------------MDDVDRRELQEMNTILTTDKR
R7L5A9          VKELDKKLVEYREKNGAVSLDT-----------------LDDVDRTELRDINAILTNDKR
A0A5R8KA81      LADSELALQNYKDERQAVSLEE-----------------KQNIVTEKLRDLNVRLTQSKT
A0A5B5WU87      MRKNDLAVEKLKKETNILTDLST----------------ALTEEYENSINDKKDLRELAL
R7DZW0          MKKNDLAIEDLKKETDVLTDLST----------------ALTEEYENSLNDKKDLRELEL
A0A2N8HID1      MKKNDLAIEDLKKETDVLTDLST----------------ALTEEYENSLNDKKDLRELEL
A0A2N8HS06      MKKNDLAIEDLKKETDVLTDLST----------------ALTEEYENSLNDKKDLRELEL
A0A6N2TNT9      MKKNDLAIEDLKKETDVLTDLST----------------ALTEEYENSLNDKKDLRELEL
A0A3R5R2M8      LNKADKELTDFKAKSDIVKDTET----------------TMSADFSSSQVLEKEIFELET
A0A411SUQ6      LSDVDKKLTEFKTKSDIVKDADT----------------TMSADFSTSQALEKEIFDLET
A0A2N8HZF2      LSDVDKKITEFKTKSDIVKDTDT----------------TMSADFSTSQALEKEIFDLET
A0A354E720      LSDVDKKLTEFKTKSDIVKDTDT----------------TMSADFSTSQALEKEIFDLET
B2UPB6          LSDVDKKLTEFKTKSDIVKDADT----------------TMSADFSTSQALEKEIFDLET
A0A2V6JLK8      VEEAGAEMAKIRDEEHIVDLNPEGTED------------SQAPVNSIVVKQEAEVNDAET
A0A2W5Z1A5      VDDAAVEVARIRDTEHIIDLNPEGTED------------SKTPLDTVVVKQEAEVNDVEA
A0A2V6EA09      VSDAAAEVARIRDQEHIIDLNPEGMED------------TQTAVNSIVLKQEEGVNEAEM
A0A2V6GQI7      VSDAAAEVARIRDQEHIIDLNPEGMED------------SQTAVNSIVLKQEEGVNEAEM
A0A3C1HEJ2      IKTLESLLQEFKKNHPGISEE------------------EQAILSKQIGELNQRIAASEF
A0A522ULD9      VNKAEEDLEHIRKDLGVSSVG------------------GMQIDKMKLQAMQGDLIAARV
A0A1V6JU76      VAKAEEDIQNYRAQVKFVSLDS-----------------SYNIVAEALSQSQAQYAMAKA
A0A2A2XXW5      LEALQGKLQKYRKDKGMVSLKD-----------------AQNIDAATMRDLKIAYETLRS
A0A6N6Q6V0      LTRAIQNLAEYRVRQGALSLDQ-----------------DVNVVYLGYRQAKEVYEAQRA
A0A1Q6UHJ9      VKELDKRLVEYREQYKAISLEN-----------------LDDVDRNELRDINTILTSDKR
A0A2V2BXR0      VKELDKRLVEYREQYKAISLEN-----------------LDDVDRNELRDINTILTSDKR
A0A2D8V0G3      VRATRLSVFQFREDNQMPSLEE-----------------SQNTLSQALFLASDGFQKASD
A0A348S017      VKNSRLAVFRFREKNKMPSLEE-----------------SQDTVSKALFAASQSHQLAND
A0A3C1UUV7      VKNSRLAVFRFREKNKMPSLEE-----------------SQDTVSKALFAASQSHQLAND
A0A350I3V2      VKNSRLAVFRFREKNKMPSLEE-----------------SQDTVSKALFAASQSHQLAND
A0A520RGV5      VKNSRLAVFRFREKNKMPSLEE-----------------SQDTVSKALFAASQSHQLAND
A0A3D3XF90      VKNSRLAVFRFREKNKMPSLEE-----------------SQDTVSKALFAASQSHQLAND
A0A2D7B522      VKNSRLAVFRFREKNKMPSLEE-----------------SQDTVSKALFAASQSHQLAND
A0A356NIC2      VKNSRLAVFRFREKNKMPSLEE-----------------SQDTVSKALFAASQSHQLAND
A0A2N8HDG3      LKQVDQKMDDIKIKNDIIADTEA----------------SISADFNAAQTLDNSIFELQT
A0A146GCJ0      LEASERKLQAYREDNKAVSLEE-----------------RQNIIVEKLRELNSKVTEAKS
A0A2T6D6H8      LETSERKLQAYREQNKAVSLEE-----------------RQNIIVEKLRELNTKVTEAKS
A0A3D1TI55      VRELEDNVEDLRLQNQIVFGAT-----------------GAELSKERLDQLQLELERARL
A0A3E1ET42      LEAARIVMNEVARKHGIV---------DNSYQGGQGFTAVVTTKPEEYADSLRSQGVLEQ
A0A2A2YDW8      VEEKRKQRDNLQRRA--PSV-------VRDFLTGN----AGNGYQSMQANVESQVEAAKT
A0A352XLN9      VEEKRKQRDNLQRRA--PSV-------VRDFLTGN----AGNGYQSMQANVESQVEAAKT
A0A3D0YP62      VAELRKRLMDIAEKVGVIWV-------ESERGGET----IG-GELELRQLAERQLYEAER
A0A3D3DV47      VAELRKRLMDIAEKVGVIWV-------ESERGGET----IG-GELELRQLAERQLYEAER
A0A2E5XJ49      VEDKRRHFHTIVKAVGVPYI-------EGVFPSGR----MGQSEEEILKMAVMQQFEHEK
A0A2E6SBY8      VEDKRRHFHAIVKAVGVPYI-------EGVFPSGR----MGQSEEEILKMAVMQQFEHEK
A0A2E5QMS4      VEDKRRHFHSIVKAVGIPYI-------EGVYSSGR----MGQSEEYILKSAEMQQFGAEE
A0A2E7YXQ3      VEDKRRHFHSIVKAVGIPYI-------EGIYSSGR----MGQSEEYILKSAEMQQFGAEE
A0A2E3H787      VEDRRRHFHAIVKAVGIPYI-------EGIXTSGR----MGQSEENILKTAEMQQFAAEX
A0A2E7AGN1      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILKTAEMQQFTAEE
A0A2E7AKY7      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILKTAEMQQFTAEE
A0A3D4CU34      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILKTAEMQQFTAEE
A0A2E8M146      VEDKRRHFHAIVKAVGIPYI-------EGVLTSGR----MGQSEEAILKSAEMQQFTAEE
A0A355S8S2      VEDKRRHFHAIVKAVGIPYI-------EGVLTSGR----MGQSEEAILKSAEMQQFTAEE
A0A2D6DVN8      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILRTAEMQQFTAEE
A0A3C1W2R2      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILRTAEMQQFTAEE
A0A2E3NAY6      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILRSAEMQQFTAEE
A0A2E3II01      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILRTAEMQQFTAEE
A0A368B8C5      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILRTAEMQQFTAEE
A0A3R7RBB5      VEDKRRHFHSIVRAVGIPYI-------EGVLTSGR----MGQSEETILRTAEMQQFTAEE
A0A2A2QX62      VEDKRKLLSQIIRQEGIIYQG------DSSVFQGT----SGFDKADEAETAAREYDRLDR
A0A4Q3BWH6      VEDKRKLLSQIIRTENIIYWG------DPSVSQGA----RGFTKADDAENAAKVYVETEQ
A0A3N5WCF1      VEERRKVLATIVRNKGIIYRG------QDAFY-ES----GGVDEDQGARNALQIYHDIEQ
A0A4Q3C1K5      VEERRKVLATIVRTKGIIYKG------QDSFY-GQ----SGVDEDQEARDAMQTYSQLQQ
A0A3R8IT45      VEELQFQMQAYREKYGL-TLD-------------P----KKDILTKKLVEQGSVLTQTQS
A0A2A2PYE8      VERMARELQEYKEKNNMVSLD-------------Q----RKDIVSESLKAINAEKTRAQI
A0A2T6CN73      VERLASELQRYKEQHKMVSLD-------------Q----RKDIVSESLKAINLEVARASI
A0A2G4G428      IRKLYDKRNELIKGQKLLSIA---------------------KDTNTLTAERAALVRARE
A0A6N6PCD8      LAKSEQTLQEYREKHGTVFND------------------KQDVTLDYLKQLNIKLEEARS
A0A139TV24      LKRLDSERDDIKFENDIIADT------------QA----SLSADFSTAQTLDNSIFELQT
A0A2N8HT11      LKEVDQKMDDIKIKNDIIADT------------EA----SISADFNAAQTLDNSIFELQT
R7DS70          LKEVDQKMDDIKIKNDIIADT------------EA----SISADFNAAQTLDNSIFELQT
A0A2N8HNL6      LKEVDQKMDDIKIKNDIIADT------------EA----SISADFNAAQTLDNSIFELQT
A0A6N6PAZ1      IQAARGALSLYARTLEV-------------------------------------------
A0A6I1K459      LLKAERSVQQYLATNNISLQQ------------------GQDILTEEFRTLSENCTAAKT
A0A139TUL1      LGGVDKQVIDYKRHSRIVKDM------------ST----TLEATFSKLQEIGTELFSTRT
A0A2N8HCB0      LGGVDKQVIDYKRNSRIVKDM------------DT----TLDATFNRVQEIGTELFSTRT
A0A2N8HP04      LGGVDKQVIDYKRNSRIVKDM------------DT----TLDATFNRVQEIGTELFSTRT
A0A2N8HRJ0      LGGVDKQVIDYKRNSRIVKDM------------DT----TLDATFNRVQEIGTELFSTRT
A0A6N2U9Y7      LGGVDKQVIDYKRNSRIVKDM------------DT----TLDATFNRVQEIGTELFSTRT
A0A366HAG0      AKQSMERMIQLKKDLDLVTLPTSMDAK---GAQDD----VMTPESAMLLDTQRDVATLQK
A0A2U8DZK4      VIAQRDTVERLRAELSISGID---------LTNPR----NNSMEIERLRQMQSTLVALTV
A0A2T6DFL8      VTRQRDAVEKLRKELNISGVD---------L-NAR----YSDMEIETLRQMQNTLIALSV
A0A1D8AWD4      VTTQRDHVEKLRKELDIAGVD---------L-SQR----YSDMDIETLRQMQNSLIALRV
A0A4Q1C9S2      VTDQRDHVEKLRKELDIAGVD---------L-SQR----YTDMDIETLRQMQNSLIALRV
A0A178IH18      VATQRDLVEKLRAQLNISGVN---------LVTPQ----GGDIEIETLRQMQNTLVALRV
A0A2T6DT99      VTSQRDLVEKLRKDLNISGVD---------L-SAR----YSDMEVETLRQMQNSLIALSV
A0A1G3ZT33      VSKQRDLVEKLRRDLNISGVD---------L-NAR----YSDMEIERLRQMQNSLIALRV
A0A3E1E2T2      VMLQRDTVERIRKDLNISGVD---------L-NAR----YSDMEIETLRQMQNSLIALSV
B1ZMW1          VSAQRDTVERLRKDLNISGVD---------L-NAR----YSDMEIETLRQMQNSLIALSV
A0A3M1I8A3      VTELEEAVQQYREKQNFVSFD-------------A----GSNPVAQSLSQVQARYADAKA
A0A4V0XS84      VDRDEEAVHKFKEGHQVVSFD--------------------ETENVVLLALKQRQLDLEK
A0A351WE84      VDQAESELERIRQEVGVSFLG-------------Q----GFRADKVRLQQLEADRIASRV
D5ENH7          VEELELELAEYREEHNAVSLD-------------S----QENIAREQLGSLNQIKLESKN
A0A0R2XQ77      VEELELKMAEYREDNNAVSLD-------------S----QENIAGTQLSTLNTIKLENKN
A0A2E9IN28      VEELELKLAEYREENNAVSLQ-------------S----DENIAGAQLARLNEIKLSNKN
A0A6N4WTJ5      VEELELKLAEYREDNNAVSLD-------------T----SENIASAQLASLNEMKLSNKN
A0A1V5QDZ6      VEKSEEELERIRKDLGVSVLS-------------Q----GVRADKLRLSQMEADRIAARV
A0A4Y8P964      LALAEERLANFTEQTGIVKFPGVDRSP----------------AEQELNRVSEAMSKARF
A0A3D4HF88      VEALETRLAEYKERTGSISVE-------------E----REDIDLQEIMQLNQVLTTTKQ
A0A6N6ZHN8      IKDIERRLADFKQKNGTISVD-------------E----RQNIAREQLTSLNNQKIEAQQ
A0A6G6K641      VSRSQLALQEFRERTGLVSLE-------------K----DQDIVVTRFKQLNERLNEARS
A0A5B5WI95      LNKAGKELTDFKTKNDIAGNA------------ET----TISADFSSAQALEKEIFDLET
A0A2N8I9W1      LSDVDKKITEFKTKSDIVKDT------------DT----TMSADFSTSQALEKEIFDLET
A0A4Q5IH27      LSDVDKKITEFKTKSDIVKDT------------DT----TMSADFSTSQALEKEIFDLET
A0A2N8IBZ6      LSDVDKKITEFKTKSDIVKDT------------DT----TMSADFSTSQALEKEIFDLET
A0A2N8IJW9      LSDVDKKITEFKTKSDIVKDT------------DT----TMSADFSTSQALEKEIFDLET
A0A7G6DX28      LSDVDKKITEFKTKSDIVKDT------------DT----TMSADFSTSQALEKEIFDLET
R6J100          LSDVDKKITEFKTKSDIVKDT------------DT----TMSADFSTSQALEKEIFDLET
A0A1V6J089      VEEAEAELERIRQERGIALIG----------RGLM----SIRVESTRLNALENERSAARV
A0A3C1BZR1      VEEAESELERIRQERGISLIG----------RGNM----SIRVEATRLNMLEGERSGARV
A0A7C4KLL2      LEESERNLQKYREEAGIVSLQ-------------Q----SQDVLAPQLRELAAKVAQARS
A0A1H6KPB7      LLAKTDTLRKYMTTSDYIGLLSDTGNT-----IPT----TVNNEEAVLTERRNKLSALDD
A0A2E9ISN4      LEQAKQDLETFERENQILFEK-------------E----RADMDIAFVNQLLARLKSVRL
B9XAX1          VEMSERNLQAYKESNKTVSLE-------------D----RQNIIVEKLKGLNQKYTSAKA
A0A5R8KKM9      AQQARNKMFAVKKDLGIIELP----GDNRATGQDV----IDTVESATLIDRERDIYKLTN
A0A139TS01      VNDKMMALKKLIVENDYLPSTMYRSGD---NRSVM----TGAMEDEDFRNSKAQLMKFEK
A0A3E1EJT7      VDEIANSLLAFRQRGNLISLV-------------Q----SKDIVTEKLKALNMMGTQTNA
A0A7C3I5X9      VSQAETDLHNYRMRTKYVSLE-------------K----GDSIIAEALSQSQTRYVEAKA
A0A2D5WGA5      ITGMQGRVDRLRTDLGISDAAGEESYS--------------IIEPEIVRRYESELITAKG
A0A2E7SSH2      ISSMQSNVDALRAKLGISDAAGEDSYS--------------IVEPEIVRRYESELITAKG
A0A349GXM8      IRTAEDDLIEYQRLHDIARVE-------------A----RGTMESRHLSALMERRNQLTT
A0A4P5YP61      MLSSEKALQTYREKVGSAAISLDDKKD---------------IVGQKLKEMSKKVTEAKS
A0A6B2LYM4      IKEMEMRLADFKEKYDTLSVD-------------R----SQDIDNQQLISLNTRLEQDKQ
A0A6D1VXB3      LALAEEKLATFTEQTGIVKFPGVDRSP----------------AEQELNRVSEAVSKARF
I0JYY7          LALAEEKLATFTEQTGIVKFPGVDRSP----------------AEQELNRVSEAVSKARF
A0A4R7S1J2      VELSEQALQKYRVENNAVSLE-------------E----NQNLVVSQLQDISSKLSQQTN
A0A2A2XV69      VDELRAEAQRIRIENEIQDLNPDSVVD------------PMQAANEVLLSVEQQVSTERL
A0A651H7X9      VEDLELRLQAFREDANMISLD-------------Q----RRDIVTEKLKMLNMMLTEAAA
A0A4Y8P842      VTESEAKLARFMEKTGIVKLPGINSSP----------------TEKELAQVGDALSKARF
B3DZK9          VTESEAKLARFMEKTGIVKLPGVNSSP----------------TEKELAQVSDALAKARF
A0A5E6MPC4      VAQSEERLADFMAETGIVRVSQMDKSP------------AEQELGRLSEAIFRARLDLLR
A0A6N6PKP9      LAKSEQALQRYKEQNQAVSLE-------------E----KQNIVVERLKDLNTKVTAAKA
A0A6N6Z250      VQEQRDKVEALRQELGLAGYE---------LDRRD----AAQPEVEALRQLERTLVNLRV
A0A4V1SB02      MAESDNALADYRQQHKAVSLD-------------E----KSNVLADRVKDLNNQVGTATN
A0A6N6QEJ2      VRVAQTNVDHLRMFLKVPDAA----------ETPS----LVSLNTQTMAKLELSRTEYRT
A0A3C1VB86      LEASDQALQDYRKQVGSVSLE-------------Q----SQDVITPQLQDLNERLTQSKA
A0A146G2Q9      VTKLQETMTRIRQETGIQDLNPDTADG------------GTQAENSILLQVEQQVSQESL
A0A2T6D3Y2      VTKLQDTMTKIRQETGIQDLNPDTADG------------GTQSENSILLQVEQQVSQESL
A0A6N6P5E3      TEDLRDEMTRIRLEAKINDLNPESMED------------PRMAEENILVADEATVNDMRL
A0A2D5VY59      VRLKQADLDQLREELNISDIYSAEGSS-------I----GMTTEPQIVLRLEQERTVAEA
A0A2D8UZZ4      VRLKQADLDQLREELNISDIYSAEGSS-------I----GMTTEPXIVLRLEQERTVAEA
A0A353DV86      VRLKQADLDQLREELNISDIYSAEGSS-------I----GMTTEPQIVLRLEQERTVAEA
A0A2E5EPT8      VVQAQADVQRVREELKFDVIME--------TPGKV----ALALDSERVRALEMLNIEMNA
A0A6J4HTK1      VDESAAEVARIREAEGIIDLNPEGTED------------AQTPVNTIVMEQEKMLNEAET
A0A6N6PHJ5      IAKVKDELDKIRVENKISDVDTAGTAP------------MMLSESEEFRRYLSSRFEKDQ
A0A6M1RXR2      IDETQRELDRLRRELQISDVDAAGTGP------------SLLLESETVRRMEALRIEAKS
A0A7C3DXS4      IDETQKELDRLRRELEISDVDAAGTGP------------SLLLEAETVRRLEALRIEAKS
A0A2V2SDV4      VSEAQSNVDVLRFKLQISDPVVTENTP------------GTLMTGDTLRRFESLRIEGLR
A0A2V5PK75      VAKKAEEVEKLREELQVPDSMSLEAAP------------VQLLSAETIHKVESLRIENEA
A0A1V6DME1      VQAAQREVDELRAKLEISDADAAGTSP------------TTLLEAEVLRRLKAQQIEGEA
A0A3D3DIJ3      VKAAQERVDNLRKELNISDAMASGDGP------------SPLMTAETLRKIESLRIESQA
A0A6I1K583      VEVAKSNVNQILKDKGIILTM---------DTPGM----IGTLDIDTMRAMEQENIQLAT
A0A350EWA4      LKESEAEVNRLRASLEITDID------------------EASSRNEQFFDMQTIQQFRNK
A0A5B5WZ91      VNDKMMALKKLIAENDYLPSTMYRSGD---NR-VM----TGAMEDEDFRNSKAQLMKFEK
A0A2N8HD92      VNEKMMALKKLIAESSYLPTT-WRNGE---NRNTL----TAGMEEEDFRNAKSQAMAFEK
A0A2N8HIT2      VNEKMMSLKKLIAESSYLPTT-WRNGE---NRSTL----TAGMEEEDFRNAKSQAMQFEK
A0A354EBD3      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A355VEB2      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A2N8IMT3      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
R6K1U5          VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A2N8IWC2      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A2N8I441      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A2N8I3A6      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A410SCC4      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A3R5VEW0      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A411SSG2      VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
B2UKW3          VNEKMMALKKLIAESSYLPTS-WRNGE---HRSTL----TAGMEEEEFRNAKAQAMDFER
A0A7C3HWX0      VAELRRKLDDTRAKLSIPE----GAGERVSYSASL----EREMVNSLAA----QLTYAQG
A0A1M6RLZ4      VADHRNRLATMSQKTGI-----PYAGDKNSIGAGS----NPAELNFRENERLYQEALRDR
A0A7C4KPD7      YSVKESNVVQLRKSLEINDID-PYSGRVYGTLDSE----TIRRLDAVHVDAQARYV----
A0A354T7G8      RRLAQVRSQEARRKAGIVGDW-IAGGGSSLNPGGE----MRSEKDSMVISREQALMLADQ
A0A512MBZ2      RDQARAKMLEAKKKAGIVGDW-IAGGGPSITPGVS----LATSKDGMVASREQAMLQSDL
A0A2E8MEZ0      VQDYRKALTVLIQQYGIPY---FDGRD-----SGQ----VGQAEELMYRRAQEKLDTLEQ
A0A6B3LBV6      VSEARIKMHNAMRELKVID---VGKG---FYYSDE----VVTPEDRIIQTGQERLATLEY
A0A2E3EC33      LEKARDMMINLMEELNIVD---LSLGEPTWLRGSQ----PNTGIASLVMTAKQKEFQAEG
A0A2E4GN01      XEXSRDMMIGLMXELNIVX---LSLGEPTWLRGSQ----PXTGXASLVMTAKQKEFXAEX
A0A1Z8XU55      LEAARNNMIELMEELNIVD---LSLGEPVWLRGSQ----PNTGTASLVLAAKQREFAAEE
A0A2E1RQR9      XEAARNNMIELMEELNIVD---LSLGEPVWLRGSQ----PNTGTASLVLAAKQREFAAEE
A0A2E3ISQ4      LEDARSVMIKLMEDLNIVD---LSLGEPVWLRGSQ----PNTGTASLVMAAKQREFAAEE
A0A2D6W6F4      LEKARNNMIELMEELNIVD---LSLGEPVWLRGSQ----PNTGTASLVMAAKQREFAAEE
A0A2D8Z5A8      LEKARNNMIELMEELNIVD---LSLGEPVWLRGSQ----PNTGTASLVMAAKQREFAAEE
A0A4Q2YKS3      VAERRKALSNIVREKEII-----YRGSESIFGNTG----VFEDDSARSAADAFAKLEQQK
A0A6N6P3T8      VEERRKVLANIVRAKGII-----YYGQDSYYRNAN----TEDDNGAKSAQETFTQLETEK
                                                                            

A0A2A2XVF1      ERLRLESDIEQVRKVPAN------------------------------------------
A0A2V5UHJ2      DRIAWEAQVRAARG----------------------------------------------
A0A2V5PST3      QRLEAESLNSVVQN----------------------------------------------
A0A2V5PXM3      LRILHETSYNQALQ----F-----------------------------------------
A0A1V5QB01      QKMFLEAQQPLLSRASDEAVLAALGPAGSGIPGVGLMSIAA-------------------
A0A1J4XH17      DFDIAQSRKNLVDQYIK-------------------------------------------
A0A7C5LI63      TSAFIALVNQPPAAPATETTATPPTTPVPAPG----------------------------
A0A7C5P291      TATLLALLTPAATQPA---VVSPPAAEEPAENQPLTAGAEVTITVDQDNSLTRTVKVDEN
A0A139SU05      RLLEVESLAKQVDD----------------------------------------------
A0A139SPN4      RLLEVESIAKQVAD----------------------------------------------
A0A1V6E7N1      ARLELESQVKQIET----------------------------------------------
A0A2D9MYT1      RAVEAQASADEAQR----------------------------------------------
A0A290QGD9      RFKDAEVRWKQIQE----------------------------------------------
A0A1D8AS58      RLNEAEVRWRQVQE----------------------------------------------
I6AQC1          RLSEATVRWQQVDE----------------------------------------------
W0ITH7          RLSEATVRWQQVED----------------------------------------------
A0A258ANJ7      ERLTLETQLQACKE----------------------------------------------
A0A139TLN4      EIKSIEYLKEYLEKE---------------------------------------------
A0A1G3ZFT0      QLINLRMTKHEMF-----------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      DAIGRKTRYERFKS----I-----------------------------------------
A0A2A2RGK2      RIEQIDSDLAVIRA----------------------------------------------
A0A2A2XXF7      RIQQIESDLAVVRT----------------------------------------------
A0A2A2R5D6      EYLGRQVRYERLNR----L-----------------------------------------
A0A3C1VJ32      AYNVSLVQLQDLQTIQQT------------------------------------------
A0A2N9NTX7      ELVKMETLLSKLEELQRT------------------------------------------
B9XK55          QYIKEEKLLSQLKQLKSD------------------------------------------
A0A4P5YMI6      EFIEKDTRLAALRKIPRN------------------------------------------
A0A2E6T482      IHTTQATLLEGLKAQSRE------------------------------------------
A0A3C0DQZ7      IHTTQATLLEGLKAQSRE------------------------------------------
A0A1Z9CBK5      LYTQQATLLQGLQEQSVE------------------------------------------
A0A2D6ZI96      LYTQQATLLQGLQEQSVE------------------------------------------
A0A358KGZ3      LYTQQATLLQGLQEQSLE------------------------------------------
A0A2E9ZQX4      LYTQQATLLQGLQEQGLE------------------------------------------
A0A3D5JZU0      LYTQQATLLQGLQEQSLE------------------------------------------
A0A2E6HCR0      LYTQQATLLKGLKEQSFE------------------------------------------
A0A1Z8WN04      LYTQQATLLQGLKEQGDE------------------------------------------
A0A2D7L1N4      LYTQQATLLQGLKEQGDE------------------------------------------
A0A2E2R937      LYTQQATLLQGLKEQGXE------------------------------------------
A0A520QQY4      LYTQQATLLQGLKEQGDE------------------------------------------
A0A2D5MR66      LYTQQATLLQGLQEQSSE------------------------------------------
A0A2E0PDQ1      LYTQQATLLQGLQDQDSE------------------------------------------
A0A2E2ZZP9      LYTQQATLLQGLQDQGSE------------------------------------------
A0A7C4LRK7      DFVQMEKLYSSLTNLSRA------------------------------------------
A0A2A2RGF2      LFTKKQTSVVELKKLKPE------------------------------------------
A0A2G4I5Y6      IYIKKQTSFVELKKLKPE------------------------------------------
A0A6N6PS97      MFAQTKTLHDELSGMTRP------------------------------------------
A0A3M1I883      DLVYWKSKLQELERIRDK------------------------------------------
A0A1V6JZ45      EYVYFLTKLEDLKKLDRT------------------------------------------
A0A7C7Z746      EYEFAKARLNLLINKTPE------------------------------------------
A0A520RRW5      NLIRYETLFKELTSLTLE------------------------------------------
A0A356NPK0      NLIRYETLFKELTSLTLE------------------------------------------
A0A2D7B5P5      NLIRYETLFKELTSLTLE------------------------------------------
A0A3D3XGB5      NLIRYETLFKELTSLTLE------------------------------------------
A0A2V6F8A1      EFSGLAGMLNGLLQLRADK-----------------------------------------
A0A2V5TNH4      EFSGLAGLLNGLLKLREEK-----------------------------------------
A0A2V5X5Q6      DYSGLAGLLNGLLKLREEH-----------------------------------------
A0A4P5QM05      LVDRLRSQLMRVEK----L-----------------------------------------
A0A4Q3C001      KTEELRTKLRQIES----L-----------------------------------------
B4DB23          KVVELERQLEMINS----L-----------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ERIGLEAQARLIKR----------------------------------------------
A0A2V2DJ66      TYDAAAIQWSLLQE----------------------------------------------
R7L5A9          IFDAASTQWTLMQE----------------------------------------------
A0A5R8KA81      DRIRLENDREQVKT----------------------------------------------
A0A5B5WU87      EIKSIEYLKQYLEE----E-----------------------------------------
R7DZW0          EIKSIEYLKDYLEQ----E-----------------------------------------
A0A2N8HID1      EIKSIEYLKDYLEQ----E-----------------------------------------
A0A2N8HS06      EIKSIEYLKDYLEQ----E-----------------------------------------
A0A6N2TNT9      EIKSIEYLKDYLEQ----E-----------------------------------------
A0A3R5R2M8      QIKLSSVLADNLKE----------------------------------------------
A0A411SUQ6      QIKLASTLADNLKE----------------------------------------------
A0A2N8HZF2      QIKLAAILADNLKE----------------------------------------------
A0A354E720      QIKLASTLADNLKE----------------------------------------------
B2UPB6          QIKLASTLADNLKE----------------------------------------------
A0A2V6JLK8      KVTTLSSKLAQIEN----L-----------------------------------------
A0A2W5Z1A5      KVATLQSQLSQIEH----L-----------------------------------------
A0A2V6EA09      TIEALGSRLEQIRK----L-----------------------------------------
A0A2V6GQI7      TIEALGSRLEQIRK----L-----------------------------------------
A0A3C1HEJ2      NAQSLDRDLSRMTG----L-----------------------------------------
A0A522ULD9      DMLVRKSRLDQIQN----------------------------------------------
A0A1V6JU76      QAQTTQTIVEELDR----H-----------------------------------------
A0A2A2XXW5      TADVAKQIAQQAQE----W-----------------------------------------
A0A6N6Q6V0      RADAAEKLAEEAKG----W-----------------------------------------
A0A1Q6UHJ9      AYDAASTQWNLVQE----------------------------------------------
A0A2V2BXR0      AYDAASTQWNLVQE----------------------------------------------
A0A2D8V0G3      EAAQAVKVVETVDN----L-----------------------------------------
A0A348S017      EAEQAQKAIDEVDK----M-----------------------------------------
A0A3C1UUV7      EAEQAQKAIDEVDK----M-----------------------------------------
A0A350I3V2      EAEQAQKAIDEVDK----M-----------------------------------------
A0A520RGV5      EAEQAQKAIDEVDK----M-----------------------------------------
A0A3D3XF90      EAEQAQKAIDEVDK----M-----------------------------------------
A0A2D7B522      EAEQAQKAIDEVDK----M-----------------------------------------
A0A356NIC2      EAEQAQKAIDEVDK----M-----------------------------------------
A0A2N8HDG3      QMKLADGLKESLNA----------------------------------------------
A0A146GCJ0      KRLQLEADIDQLKR----V-----------------------------------------
A0A2T6D6H8      KRLQLEADIEQLKR----V-----------------------------------------
A0A3D1TI55      DLWTAEAQLQKVES----------------------------------------------
A0A3E1ET42      QVIRLRSQLESLMK----L-----------------------------------------
A0A2A2YDW8      TLAELDSMIASIDR----L-----------------------------------------
A0A352XLN9      TLAELDSMIASIDR----L-----------------------------------------
A0A3D0YP62      ERDQLKFQIDKLLA----V-----------------------------------------
A0A3D3DV47      ERDQLKFQIDKLLA----V-----------------------------------------
A0A2E5XJ49      SKRQLENQINQLVN----L-----------------------------------------
A0A2E6SBY8      AKRQLENQINQLVS----L-----------------------------------------
A0A2E5QMS4      RKAELENQIQQLLT----L-----------------------------------------
A0A2E7YXQ3      RKAELENQIQQLLT----L-----------------------------------------
A0A2E3H787      KKXXLENQIERLLT----L-----------------------------------------
A0A2E7AGN1      KKGQLENQIEQLLT----L-----------------------------------------
A0A2E7AKY7      KKGQLENQIEQLLT----L-----------------------------------------
A0A3D4CU34      KKGQLENQIEQLLT----L-----------------------------------------
A0A2E8M146      KKGQLENQIEQLLT----L-----------------------------------------
A0A355S8S2      KKGQLENQIEQLLT----L-----------------------------------------
A0A2D6DVN8      KKGQLENQIAQLLT----L-----------------------------------------
A0A3C1W2R2      KKGQLENQIAQLLT----L-----------------------------------------
A0A2E3NAY6      KKGQLENQIAQLLT----L-----------------------------------------
A0A2E3II01      KKGQLENQIAQLLT----L-----------------------------------------
A0A368B8C5      KKGQLENQIAQLLT----L-----------------------------------------
A0A3R7RBB5      KKGQLENQIAQLLT----L-----------------------------------------
A0A2A2QX62      EKIQLESQIETLLK----Y-----------------------------------------
A0A4Q3BWH6      EKIQLESQIETLLK----Y-----------------------------------------
A0A3N5WCF1      EKLQLESQISSLLK----Y-----------------------------------------
A0A4Q3C1K5      EKMQLASQINSLLK----Y-----------------------------------------
A0A3R8IT45      RLGEAEVRKNQVEA----R-----------------------------------------
A0A2A2PYE8      AMNAAEGRINQIKE----V-----------------------------------------
A0A2T6CN73      ALNAAENRRNQVAE----L-----------------------------------------
A0A2G4G428      DTRKAIDEMEIIWRLIGEY-----------------------------------------
A0A6N6PCD8      NRIKIESDLPILRK-AQTL-----------------------------------------
A0A139TV24      QIMLANDLENNLKA----------------------------------------------
A0A2N8HT11      QMKLADGLKENLDA----------------------------------------------
R7DS70          QMKLADGLKENLDA----------------------------------------------
A0A2N8HNL6      QMKLADGLKENLDA----------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ERLVMETDYEMTKR----------------------------------------------
A0A139TUL1      ELIQVKVLAGLLAE----------------------------------------------
A0A2N8HCB0      ELIQVKVLARLLAD----------------------------------------------
A0A2N8HP04      ELIQVKVLARLLAD----------------------------------------------
A0A2N8HRJ0      ELIQVKVLARLLAD----------------------------------------------
A0A6N2U9Y7      ELIQVKVLARLLAD----------------------------------------------
A0A366HAG0      QVRDLKAQHDQMMT----L-----------------------------------------
A0A2U8DZK4      DANSLKTRYESFRD----I-----------------------------------------
A0A2T6DFL8      DAIGRKTRWERFKS----I-----------------------------------------
A0A1D8AWD4      DAIGRKTRWERFRN----I-----------------------------------------
A0A4Q1C9S2      DAIGRKTRWERFRG----I-----------------------------------------
A0A178IH18      DAIGRRARYENFKK----I-----------------------------------------
A0A2T6DT99      DAIGRKTRYERFKS----I-----------------------------------------
A0A1G3ZT33      DAIGRRTRWERFKN----I-----------------------------------------
A0A3E1E2T2      DAIGRKTRWERFKD----I-----------------------------------------
B1ZMW1          DAIGRRTRWERFKS----I-----------------------------------------
A0A3M1I8A3      TAEIMQATIRELDA----H-----------------------------------------
A0A4V0XS84      AVSDSISKTQLANE----------------------------------------------
A0A351WE84      DMLVRKARLNQLES----L-----------------------------------------
D5ENH7          NYDQFETKWKLIDS----Y-----------------------------------------
A0A0R2XQ77      VYDNLETRMGLVET----F-----------------------------------------
A0A2E9IN28      LYDQLETKWNLIES----Y-----------------------------------------
A0A6N4WTJ5      VYDNLETRWNLIES----Y-----------------------------------------
A0A1V5QDZ6      DMLVRKAQLDQLVN----L-----------------------------------------
A0A4Y8P964      EMIRREVYLEKAKSAMEAG-----------------------------------------
A0A3D4HF88      VRDQSKHRWEQIQS----F-----------------------------------------
A0A6N6ZHN8      IFDRLSTRWNQVQQ----V-----------------------------------------
A0A6G6K641      RRMQLEVDMAGALK----------------------------------------------
A0A5B5WI95      QIKLAAVLADNLKK----------------------------------------------
A0A2N8I9W1      QIKLAAILADNLKE----------------------------------------------
A0A4Q5IH27      QIKLAAILADNLKE----------------------------------------------
A0A2N8IBZ6      QIKLAAILADNLKE----------------------------------------------
A0A2N8IJW9      QIKLAAILADNLKE----------------------------------------------
A0A7G6DX28      QIKLAAILADNLKE----------------------------------------------
R6J100          QIKLAAILADNLKE----------------------------------------------
A0A1V6J089      DMLVRKARMDQLED----L-----------------------------------------
A0A3C1BZR1      EMLVRKARMDQLEG----L-----------------------------------------
A0A7C4KLL2      DTARLQRQYQRLMA----------------------------------------------
A0A1H6KPB7      EITQLKTHINKLKS----L-----------------------------------------
A0A2E9ISN4      ERVLLENQYEQLSDADILTVNEALAATRETEG----------------------------
B9XAX1          DRIQMEADLKLIQS----L-----------------------------------------
A0A5R8KKM9      EIQSLRAQISQLQT----L-----------------------------------------
A0A139TS01      DEQELAAYVAEVQR----L-----------------------------------------
A0A3E1EJT7      HLKEAEVKWNQVQE----W-----------------------------------------
A0A7C3I5X9      RAQMAQTTVDELDR----H-----------------------------------------
A0A2D5WGA5      VHTTQSTLLEGLKA----Q-----------------------------------------
A0A2E7SSH2      LYTQQATLLQGLQG----Q-----------------------------------------
A0A349GXM8      ELMLLEAQYPALDGANAAVISDVARLTRATGE----------------------------
A0A4P5YP61      VRISLESDLAQIQQ----------------------------------------------
A0A6B2LYM4      LYDEASTVMAQINE----A-----------------------------------------
A0A6D1VXB3      EMIRREVYLEKAKAAMDAG-----------------------------------------
I0JYY7          EMIRREVYLEKAKAAMDAG-----------------------------------------
A0A4R7S1J2      DRVRLETDYAALLQ----M-----------------------------------------
A0A2A2XV69      RVSTLRAKYEQISK----L-----------------------------------------
A0A651H7X9      RRNEAAVRWNLVQQ----Y-----------------------------------------
A0A4Y8P842      EMIKKEVFYERAKNGLDSG-----------------------------------------
B3DZK9          EMIRKEVFYERAKNGLDMG-----------------------------------------
A0A5E6MPC4      REVRLERAKEAFAGGKAGV-----------------------------------------
A0A6N6PKP9      ERLRIEADRAQLDR----L-----------------------------------------
A0A6N6Z250      EALARKTRWEQFAS----V-----------------------------------------
A0A4V1SB02      QRTAIESDLAALKQ----I-----------------------------------------
A0A6N6QEJ2      QAATLEQLMEKVNS----K-----------------------------------------
A0A3C1VB86      SLVQAQGAYQDSLK----------------------------------------------
A0A146G2Q9      RVAALRAKYDQVSK----M-----------------------------------------
A0A2T6D3Y2      RVAALRAKYDQVSK----M-----------------------------------------
A0A6N6P5E3      KVASLQSKAQQIGL----M-----------------------------------------
A0A2D5VY59      KLIRFQTLFNELEA----M-----------------------------------------
A0A2D8UZZ4      KLXRFQTLFNELEA----M-----------------------------------------
A0A353DV86      KLIRFQTLFNELEA----M-----------------------------------------
A0A2E5EPT8      GLTSKKTQLEQLKS----L-----------------------------------------
A0A6J4HTK1      KVATLSTQLQGIEN----L-----------------------------------------
A0A6N6PHJ5      AYKKQKEVFEKLSA----I-----------------------------------------
A0A6M1RXR2      QYEAEAKLLEQLKS----V-----------------------------------------
A0A7C3DXS4      QYEAEAKLLEQLKS----V-----------------------------------------
A0A2V2SDV4      ELVSQQTLLDKLLA----F-----------------------------------------
A0A2V5PK75      DFVKQSTLLNKLKS----L-----------------------------------------
A0A1V6DME1      AYVREATLLQELKT----T-----------------------------------------
A0A3D3DIJ3      EYVRQATRLDRLKNLGKEL-----------------------------------------
A0A6I1K583      TYRRKQTRFDELKK----L-----------------------------------------
A0A350EWA4      HDLEKLEYEKMMKR----L-----------------------------------------
A0A5B5WZ91      DEQELAAYVAEIQR----L-----------------------------------------
A0A2N8HD92      DEKELASYVQELQR----L-----------------------------------------
A0A2N8HIT2      DEKELASYVQELQR----L-----------------------------------------
A0A354EBD3      REKELASYVQELQR----L-----------------------------------------
A0A355VEB2      REKELASYVQELQR----L-----------------------------------------
A0A2N8IMT3      REKELASYVQELQR----L-----------------------------------------
R6K1U5          REKELASYVQELQR----L-----------------------------------------
A0A2N8IWC2      REKELASYVQELQR----L-----------------------------------------
A0A2N8I441      REKELASYVQELQR----L-----------------------------------------
A0A2N8I3A6      REKELASYVQELQR----L-----------------------------------------
A0A410SCC4      REKELASYVQELQR----L-----------------------------------------
A0A3R5VEW0      REKELASYVQELQR----L-----------------------------------------
A0A411SSG2      REKELASYVQELQR----L-----------------------------------------
B2UKW3          REKELASYVQELQR----L-----------------------------------------
A0A7C3HWX0      EYVLYKSQFDRLRS----L-----------------------------------------
A0A1M6RLZ4      D--SLKSIVQRLGD----L-----------------------------------------
A0A7C4KPD7      ---ELNAQYSRLTN----M-----------------------------------------
A0A354T7G8      DTLTLQAEIDEIGK----L-----------------------------------------
A0A512MBZ2      EVQNLTSELEQLDK----L-----------------------------------------
A0A2E8MEZ0      TRDQIQIQIRKLID----T-----------------------------------------
A0A6B3LBV6      EISGMKSQLEGLQG----L-----------------------------------------
A0A2E3EC33      AIQNLRTTIKSLTD----L-----------------------------------------
A0A2E4GN01      AIQXLXTTIXSLTD----L-----------------------------------------
A0A1Z8XU55      AIQNLRSTISSLTQ----L-----------------------------------------
A0A2E1RQR9      AIQNLRSTISSLTK----L-----------------------------------------
A0A2E3ISQ4      AIQNLRSTIKSLTQ----L-----------------------------------------
A0A2D6W6F4      AIQNLRSTIKSLTQ----L-----------------------------------------
A0A2D8Z5A8      AIQNLRSTIKSLTQ----L-----------------------------------------
A0A4Q2YKS3      I--ELESQIKSLLN----Y-----------------------------------------
A0A6N6P3T8      M--QLESMIQSLLK----Y-----------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      -----ARTGEVAIAGLQLAG----------------------------------QNQAAP
A0A7C5P291      GNIDFPPLGRVQAGGRTPAGLRDHLQERLQKEFYLTSPVRVTLGTATAPVLTITDNTGAA
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------RSQVTP
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------IKPSES
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ---NTDELLRIGSVATIPQ------------VAEARRQLSDSNMEIAAMQ-DRYGERHPK
A0A2V5UHJ2      ---RNADEVPSVRNSAVIG--------------SLKAELGKFEAEYASLA-KEFKAGYPP
A0A2V5PST3      ---KSTQYLSQVLTQ--------------GMIPTLRSTLLTLEAEKIKQS-TVFKPDHPR
A0A2V5PXM3      ---SNNPAALLFLPAVAND----------PTVTDIRGNVGRLESDLANLR-QRYKEKHPK
A0A1V5QB01      ---MGVETNAPAPAVGGLEGLVEYGVVQQRGWQEQRRVKSLLEARLAEYR-TKFRDAHPL
A0A1J4XH17      ---SGGKLWDLSFINSIPQ------------VEQLLSDLATKNIEISSLE-KRYGAKHPK
A0A7C5LI63      VPEKTTVGDGASVYGAVLQAAPVMNDTIVKNLMELERRRTKLEARVSELL-TICKPKHPA
A0A7C5P291      APPPAAAPAANALSSPPPTLLRMMGDEHGQKLFEYENQRRQLLARLTELR-KIYRPKHPA
A0A139SU05      ---YQEAGANLLEITYIGN---------YNTVAPLRGQMTTLLQEQARLA-ERYLERHPR
A0A139SPN4      ---YQESGDNLLEITYIGS---------YGTVAPLRTQLSTLLQEQARLA-ERYLERHPR
A0A1V6E7N1      ---YQAEGRNLFEISSIAT---------YDQIPALNAQIAELTRTQTVLG-ERYLERHPL
A0A2D9MYT1      ---VFTETGEFGTIPDVAA---------DAEVKKMRGDLALALAELASLR-ERYLEKHPK
A0A290QGD9      ---LRAAGRDLTELSFIAI---------QPIIGELKKQQAEQKVVVAQLS-ERYRAKHPR
A0A1D8AS58      ---RKATPALLLELPFIAS---------QSLIVQLVQQVAAQKIVLAQMR-ERYRDKHPR
I6AQC1          ---RLKNNGDLLELPFIAS---------NPLVSQLASQIAMQTITIKQLR-ERYKEKHPK
W0ITH7          ---RIKANGDLLELPFIAN---------NQLVAQLASQVAMQTITVKQLR-ERYKEKHPR
A0A258ANJ7      ---GTLPRDELLSLPSIAS---------HPKVSGILSQIASQKSALAVLA-ERYKPKHPK
A0A139TLN4      ---AEFDSRLVPINSKIAD----------MGIRDQIGVFNDTLLKKTSLK-VNAGDNNPI
A0A1G3ZFT0      ---------------------------------------------------YQYTKSHPS
A0A1Z8ZMT6      -----------------------------TPALEAEKEMAVAEKAIQDLS-IRYGLKHPK
A0A2E8MCT7      -----------------------------TPALEAEKEMAVAEKAVQDLS-IRYGPKHPK
A0A290Q2Z2      ---PAEDRINLINSELIQD----------PNIQNLLQAYLIADQNVTKFR-ARLGAAHPE
A0A2A2RGK2      ---NTGEPEELLTLPSVAA---------EPKVAQYSESLNARQRDLTIVA-QRYRSKHPT
A0A2A2XXF7      ---NTGSVEELLFLPSVAA---------EPKVAQYSESLNARQRELTLIS-QRYRAKHPA
A0A2A2R5D6      ---STNEFLDAIVAMGIED----------ANLTSLRAKKYAAESDLEQMRKSGLEGNHPR
A0A3C1VJ32      ---NQSKLRDVLPGVVSDA----------E-LGSLLAQYHEAQRKIAALK-VDYSPANLD
A0A2N9NTX7      ---NPAALIQTIPITAPDS----------Y-LNSLMEQVTVADQRLVMVQ-KDYGPENDE
B9XK55          ---E---LKQAIPTAAPDA----------I-LIQLLQDLIGAETKLVTLL-ADYGDKHPE
A0A4P5YMI6      ------EIKEVIVTVYPDE----------L-LATLLQKQTLTIQELAAKS-KDLGAQHPE
A0A2E6T482      ------ELRASILTAHPDA----------Q-LDALIRELHTGEQTVANQS-IDLGEQHPR
A0A3C0DQZ7      ------ELRASILTAHPDA----------Q-LDALIRELHTGEQTVANQS-IDLGEQHPR
A0A1Z9CBK5      ------ELRESIMTANPDA----------Q-LDALIREYQTGQTTLANKS-IDLGEGHPT
A0A2D6ZI96      ------ELRESIMTANPDA----------Q-LDALIREYQTGQTTLANKS-IDLGEGHPT
A0A358KGZ3      ------ELRESIMTANPDA----------Q-LDALIREYQTGQTTLANKS-IDLGEGHPT
A0A2E9ZQX4      ------ELRESIMTANPDA----------Q-LDALIREYQTGQTTLANKS-IDLGEGHPT
A0A3D5JZU0      ------ELRESIMTANPDA----------Q-LDALIREYQTGQTTLANKS-IDLGEGHPT
A0A2E6HCR0      ------NLRESILTAYPDA----------Q-LDALVREYQTGQTTLANKS-IDLGEGHPT
A0A1Z8WN04      ------ELRNSILTAYPDA----------Q-LDALVREYQTGQNSLANKS-IDLGEGHPT
A0A2D7L1N4      ------ELRNSILTAYPDA----------Q-LDALVREYQTGQNSLANKS-IDLGEGHPT
A0A2E2R937      ------XLRNSILTAYPDA----------Q-LDALVREYQTGQNSLANKS-IDLGEGHPT
A0A520QQY4      ------ELRNSILTAYPDA----------Q-LDALVREYQTGQNSLANKS-IDLGEGHPT
A0A2D5MR66      ------ELRNSILTAYPDA----------Q-LDALVREYQTGQTTLANKS-IDLGEGHPT
A0A2E0PDQ1      ------ELRNSILTAYPDA----------Q-LDALVREYQTGQTTLANKS-IDLGDGHPT
A0A2E2ZZP9      ------ELRNSILTAYPDA----------Q-LDALFREYQTGQTTLANKS-IDLGDGHPT
A0A7C4LRK7      ------EFKRAIQTANPDQ----------H-LAVLMEELARAEHKRSLLE-PDYSADHPE
A0A2A2RGF2      ------QLRNVLGPPVVND----------EILARRLEEHSAAEKEFVSKG-KDLGPNHPD
A0A2G4I5Y6      ------QLKNALGPPVVND----------EILSRRLEEYSAAEKEFVSKG-KELGPNHPD
A0A6N6PS97      ------ELRRVIPVSAPDE----------A-LNTHLRDLAKIEQQLAQSR-KDYSDEHPE
A0A3M1I883      ---GLQDLRDAILTVMPSE----------ALLPKRIDDLDVVEQNLSKLL-KDYTPENPE
A0A1V6JZ45      ------SMREAVLVTMPTE----------ARLGELLGALSLAQQEVARLR-EDFSNDYPE
A0A7C7Z746      ------DLEVVLLTIQADP----------N-LETLLAEKYQAQQELTSLE-VFYGPENTD
A0A520RRW5      ------ELRNTLLTAMPGN----------LRLTSLLNEFDRGHQQLSQMK-AIHGPDHPQ
A0A356NPK0      ------ELRNTLLTAMPGN----------LRLTSLLNEFDRGHQQLSQMK-AIHGPDHPQ
A0A2D7B5P5      ------ELRNTLLTAMPGN----------LRLTSLLNEFDRGHQQLSQMK-AIHGPDHPQ
A0A3D3XGB5      ------ELRNTLLTAMPGN----------LRLTSLLNEFDRGHQQLSQMK-AIHGPDHPQ
A0A2V6F8A1      ---GDAELRKSILTAMNDE----------L-LSKLMMDLATTEANLAKLK-ETLGPQHPD
A0A2V5TNH4      ---GNTELRKSILTAINDE----------L-LSKLMMDLSTTEANLAKLK-ETLGPENSD
A0A2V5X5Q6      ---GDSELRKSILTAINDE----------L-LSKLMTDLSTTEANLAKLN-AGLGPRNPE
A0A4P5QM05      ---KPEELMEAARILGITD----------STVEKTLPLLQDAKAEEAKFFSAGLGENHPR
A0A4Q3C001      ---KADELLEVLRTLNIDE----------PTVRENLPLLQQAAAEEAKLLASGLGEAHPK
B4DB23          ---SPEQLQDALKTLGIDD----------TTVSRNLPLLQDAAAEHARLTNLGLGVNHPR
A0A6B3L938      -----------------------------------NQELNQFRTELSALR-QRYLPKHPR
A0A2V5URB2      ---RDYDSLPAVISNSLIQ--------------SLRAQVVQLESEHAKLA-AQFLPGYPR
A0A2V2DJ66      ---YKRDGRDLCTLPFIAD---------LPIISKLVSDRSQYQVSVSTLE-KRYKEKHPR
R7L5A9          ---YKRDGKDLCTLPFISE---------FQQIAKLLTDRSTQQVFIASLE-KRYKEKHPS
A0A5R8KA81      ---AGNDLYKLLSIPSIAN---------QRAVAELRSQISLAESEMANLS-QRYRPKHPR
A0A5B5WU87      ---AEHDAKLVPINSKIAD----------MGIRDQIGVFNDTLLKKTSLK-VNAGDNNPI
R7DZW0          ---AEHDARLVPINSKIAD----------MGIRDQISVFNDTLLKRTSLK-VNAGDNNPI
A0A2N8HID1      ---AEHDARLVPINSKIAD----------MGIRDQISVFNDTLLKRTSLK-VNAGDNNPI
A0A2N8HS06      ---AEHDARLVPINSKIAD----------MGIRDQISVFNDTLLKRTSLK-VNAGDNNPI
A0A6N2TNT9      ---AEHDARLVPINSKIAD----------MGIRDQISVFNDTLLKRTSLK-VNAGDNNPI
A0A3R5R2M8      ---AGRNGGLISVDTGLTD----------NGLSRQIENYNEAWLEYRKIA-GSAGSRNPI
A0A411SUQ6      ---SERKHGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
A0A2N8HZF2      ---TERKQGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
A0A354E720      ---SERKQGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
B2UPB6          ---SERKHGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
A0A2V6JLK8      ---KGDDLMRMLPTLDVQD----------PTVQKILPNYQDTVAQEALLLNSGLGEDHPK
A0A2W5Z1A5      ---KGEDLMRMFAALNIQD----------PTTLKILPNYQDAVAQEASLLNSGLGENHPK
A0A2V6EA09      ---KGEELMRMLATLNIQD----------PTIQKILPNYQEAVAQDAFFLNSGLGENHPK
A0A2V6GQI7      ---KGEELMRMLATLNIQD----------PTIQKILPNYQETVAQDAFFLNSGLGENHPK
A0A3C1HEJ2      ---GQNVPLLVTMPVVSAD----------PTVSAAMIAVLTQENAMDLVK-RDLKPKHPD
A0A522ULD9      ---LDGENLLSASQFIVGD----------VSLNSLRQQVTDTQVSLKLML-ENLGENHPD
A0A1V6JU76      ---IQAGNPLETFPKIAAD----------GKVNSLQLQLSGQENELAGLL-KRYKDKHPA
A0A2A2XXW5      ---VAAGKDITDFAPLAKD----------EQVAYLRKQVNDNSSKLAGLR-TKYRERHPR
A0A6N6Q6V0      ---RKSGRDLADFPEVAKD----------QVVNQLKVTLSQTASQFAGVT-NRYGPKHPT
A0A1Q6UHJ9      FKRDGKDLADLPFIAELPQ------------ISKLLTDKSSQQVFVASAE-KRYKEKHPR
A0A2V2BXR0      FKRDGKDLADLPFIAELPQ------------ISKLLTDKSSQQVFVASAE-KRYKEKHPR
A0A2D8V0G3      -------IAEAEADSRTLDLSVLPYIQNSPIIQQLRVSLAAAEAELASLE-VKYLEKWPA
A0A348S017      -------IREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQ-VKYLEKWPA
A0A3C1UUV7      -------IREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQ-VKYLEKWPA
A0A350I3V2      -------IREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQ-VKYLEKWPA
A0A520RGV5      -------IREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQ-VKYLEKWPA
A0A3D3XF90      -------IREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQ-VKYLEKWPA
A0A2D7B522      -------IREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQ-VKYLEKWPA
A0A356NIC2      -------IREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQ-VKYLEKWPA
A0A2N8HDG3      ---LGQKAGLISLDTGIAD----------SGVSRQIEAYNTAYLEYQKVA-GSAGGQNPI
A0A146GCJ0      ---EKGNLDALLAINSVSN---------LPQVALIREQLLNAEGDLAGLK-ERYLPKHPK
A0A2T6D6H8      ---EKANVDELLSINSVSQ---------LPHVAVIREQLVSAEAELAALK-DRYLPKHPK
A0A3D1TI55      ---LEGKQLEDAIPFLVND----------PSYNTLNQQLVEAEIAYRAAE-ENYGPKHPE
A0A3E1ET42      ---EGDQLIANAASLDVQN----------DTIKALYPEYQKSVIEESRLLNSGFGKNHPK
A0A2A2YDW8      ---SADEVIRYAANLEVAG----------QDLKSLFPEYQEQVRMLSGMQVQGLGPRHPN
A0A352XLN9      ---SADEVIRYAANLEVAG----------QDLKSLFPEYQEQVRMLSGMQVQGLGPRHPN
A0A3D0YP62      ---ADEDLPGLAA--DLPD----------VGFREAYNKFEDAKAELQTAKASGLGNKHPD
A0A3D3DV47      ---ADEDLPGLAA--DLPD----------VGFREAYNKFEDAKAELQTAKASGLGNKHPD
A0A2E5XJ49      ---KNEELMNFAEGLKLPG----------SAVPELHRAWMAGKRSIATMEASGLGRKHPN
A0A2E6SBY8      ---KNEELMNFAEGLKLPG----------SAVPELHRAWMAGKRSIATMEASGLGRKHPN
A0A2E5QMS4      ---RDDELIDFAEGLKLPG----------SQVPVLRARIQESKLNMAAMEASGLGRKHPS
A0A2E7YXQ3      ---RDDELIDFAEGLKLPG----------SQVPVLRARIQESKLNMAAMEASGLGRKHPS
A0A2E3H787      ---KDAELIDFAEGLQLPG----------SQVPVLRGRLQESKVNIAAXEASGLGRKHPQ
A0A2E7AGN1      ---RDEELIDFAEGLQLPG----------SQVPVLRSRFQESKVNIAALQASGLGRKHPS
A0A2E7AKY7      ---RDEELIDFAEGLQLPG----------SQVPVLRSRFQESKVNIAALQASGLGRKHPS
A0A3D4CU34      ---RDEELIDFAEGLQLPG----------SQVPVLRSRFQESKVNIAALQASGLGRKHPS
A0A2E8M146      ---QDEELIDFAEGLQLPG----------SQVPVLRGRYQESRVNIAALEASGLGRKHPS
A0A355S8S2      ---QDEELIDFAEGLQLPG----------SQVPVLRGRYQESRVNIAALEASGLGRKHPS
A0A2D6DVN8      ---RDEELIDFAEGLQLPG----------SQVPVLRARYQEGKVNIAALEASGLGRKHPS
A0A3C1W2R2      ---RDEELIDFAEGLQLPG----------SQVPVLRARYQEGKVNIAALEASGLGRKHPS
A0A2E3NAY6      ---RDEELIDFAEGLQLPG----------SQVPVLRARYQESKVNIAALEASGXGRKHPS
A0A2E3II01      ---RDEELVDFAEGLQLPG----------SQVPVLRARYQESKVNIAALEASGLGRKHPS
A0A368B8C5      ---RDDELVDFAEGLQLPG----------SQVPVLRARYQESKVNIAALEASGLGRKHPS
A0A3R7RBB5      ---RDDELVDFAEGLQLPG----------SQVPVLRARYQESKVNIAALEASGLGRKHPS
A0A2A2QX62      ---DGAQLLAHASGLSLPD----------NVIPVLLPQFQSAKREYDSAMSSGLGERHPK
A0A4Q3BWH6      ---DGPQLMNYASGLSLPD----------NIIPVLLPQYQEQKRTYEAMKSQGRGERHPM
A0A3N5WCF1      ---DSDQLMVYAGGLNLPD----------NIIRTLYPQYQEAKRQLDGLKISGLGDRHPT
A0A4Q3C1K5      ---DSDQLMVYAAGLDLPD----------NLIRNLYPLYLEAERTLESLKIKGLGDRHPT
A0A3R8IT45      ---IKAGGDLTELPFIAAN----------HLVAQLSQLVSMRKIEVKQLR-DRYKDKHPK
A0A2A2PYE8      ---RQRSGDLTELPFIASQ----------PQVVQLGQLLAERKIAIATLR-ERYRDKHPK
A0A2T6CN73      ---KARGGNLTELPFIATQ----------ATIVELLKQLAAQKVQLEQLG-ARYRAKFPK
A0A2G4G428      ---KQTGKDLYDVAQVRSD----------ERVASFGSKISDLRVAVRTME-EKYTDEHPT
A0A6N6PCD8      ---PPEELLAIQSVSGLPD------------VQEALKLITTKESEFSQIK-KRYLELHPK
A0A139TV24      ---VSKKAELISLDTGIAD----------SGVSRQIEAYNTAYLEYQKIA-GSAGSQNPI
A0A2N8HT11      ---LGHKAGLISLDTGIAD----------SGVSRQIEAYNAAYLEYQKVA-GSAGGQNPI
R7DS70          ---LGHKAGLISLDTGIAD----------SGVSRQIEAYNAAYLEYQKVA-GSAGGQNPI
A0A2N8HNL6      ---LGHKAGLISLDTGIAD----------SGVSRQIEAYNAAYLEYQKVA-GSAGGQNPI
A0A6N6PAZ1      -----------------------------------HKTLDIKENELAALQ-RRYLPKHPK
A0A6I1K459      ---VGSKVSELLTLVSIAR---------TPEVQSLKEKIQAQETSLANLK-LRYREKHPA
A0A139TUL1      ---GGRERDMIPANIGIQD----------AGIAKQIELFNDNFLQYKKLS-ASAGKQNPM
A0A2N8HCB0      ---RSRQQDMIPANIGIQD----------AGIAKQIELFNDNFLQHKKLF-ASAGRQNPM
A0A2N8HP04      ---RSRQQDMIPANIGIQD----------AGIAKQIELFNDNFLQHKKLF-ASAGRQNPM
A0A2N8HRJ0      ---RSRQQDMIPANIGIQD----------AGIAKQIELFNDNFLQHKKLF-ASAGRQNPM
A0A6N2U9Y7      ---RSRQQDMIPANIGIQD----------AGIAKQIELFNDNFLQHKKLF-ASAGRQNPM
A0A366HAG0      ---EGDELIRLAGEMKVEN-------ETIRRMGPTYQELLLKQQSLAT---AGLGRKHPT
A0A2U8DZK4      ---PPDKRLSLVNAQLIED----------PGTQRLQQIYLEAEQNVTKLS-ARLGEAHPE
A0A2T6DFL8      ---PAGERQSLVNSELIPD----------QNIQNLLQAYLVADQKVTQLQ-GRLGEAHPD
A0A1D8AWD4      ---PAADRRNLVNSELIQD----------TNIQNLLQAYLISDQTVTRLM-ARLGAAHPD
A0A4Q1C9S2      ---PTADRRNLVNSELIQD----------TNIQSLLQAYLVAEQNVTRLM-GRLGSAHPD
A0A178IH18      ---PEADRANLVNSELITD----------TNIQNLLQAYLVADQNVTRLR-SRLGEAHPE
A0A2T6DT99      ---PPEERLNLVNSELIQD----------PNIQNLLQAYLVADQNVAKLK-TRLGEAHPE
A0A1G3ZT33      ---PAGERVTLANSELIQD----------TNIQNLLQAWLVADQTVARLK-SRLGEAHPD
A0A3E1E2T2      ---PFEERVSLVNSELIPD----------INIQNLLQAYLLADQNVTKLK-ARLGEAHPD
B1ZMW1          ---APADRLSLVNSELIQD----------TNIQNLLQAYLVADQNVTRLQ-SRLGEAHPD
A0A3M1I8A3      ---LKAGRPAETFPSVAND----------SRVIELQKRLTGYRTDLGAML-QRYGEKHPA
A0A4V0XS84      ---LGNLVRAGLSAEGAQMAMLQQYGGRLTGIQELKKSLTEKESQLANLT-QRYRDEHPT
A0A351WE84      ---EGTELMNASSYVVMDQ-----------SIASIRQQLIDTEVALKLML-ENMGVNHPD
D5ENH7          ---KLEGKNLWELSFISEQ----------PRVASLLQNISATKIEIASLS-KRYREKHPM
A0A0R2XQ77      ---RREGRNLWELSFIAEE----------SRVAGLLDRISGVKIGISSSS-KRYREKHPV
A0A2E9IN28      ---RRQGKELWELSFISEQ----------PRVSSLLQRISGTRISISSLS-KRYREKHPA
A0A6N4WTJ5      ---RREGKDLWELSFIAEQ----------PRVSNLLEQISGTKIQISSLS-KRYRDKHPV
A0A1V5QDZ6      ---SGEELMNASSYIVSDP-----------ALQAIRAQLIDSEVTLKLML-ENYGAKHPE
A0A4Y8P964      ---KLAAIPDSPFTVDLKK------------------NLLKEQAKYHELE-DIYKEEYPK
A0A3D4HF88      ---KAEGKPLQDLPFIAEM----------PLVQDLQSQLSELKVSQSSAA-KRYREGHPR
A0A6N6ZHN8      ---QESGGSLLDLNFIATS----------SNIPSLLQRLSEAKIGLAGLQ-ERFRDKHPK
A0A6G6K641      ---GQSNAEDLLKVPSIAQ---------NADVRLAQERWAQEEANLRAIS-ARYREKHPR
A0A5B5WI95      ---TVRNDGLISVDTGLAD----------NGISRQIEGYNEAFLEYQKIA-GSAGSQNPI
A0A2N8I9W1      ---TERKQGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
A0A4Q5IH27      ---TERKQGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
A0A2N8IBZ6      ---TERKQGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
A0A2N8IJW9      ---TERKQGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
A0A7G6DX28      ---TERKQGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
R6J100          ---TERKQGLISVETGLPD----------SGIARQIEHYNEAYLEYQKIA-GSAGSQNPI
A0A1V6J089      ---EGDKLMDAAAYIVQDP-------TLLSIRQQYIDSQVSLQLMLKN---GVVGENHPD
A0A3C1BZR1      ---EGDRLMDAAAYIVQDP-------TLMGIRQQLIDSQVSLQLMLKN---GVMGENHPD
A0A7C4KLL2      ---QASNVSDLLLLPQIAA---------VPEVQALRSALSKSEQDFKILS-LRYKDKHPK
A0A1H6KPB7      ---KDSELMDYVRQTDLLAETTPGSLSVRELYTR---SQTEESTLSKMHM-DGYGEKHPA
A0A2E9ISN4      EGAPAVDPGAETPPEAAKNYGAYDHLNTGIQWQETQVRLDELQNEYKQLA-AVFKDTHPR
B9XAX1          ---TNQPEAILTLPSILQD----------PAVMETRRRVVEQEAQVATLL-LRYKPNYPK
A0A5R8KKM9      ---DGDALIRQAGELRVEN-------ETIRTIGPAYQGLLMRQESVAG---SGLGPKHPT
A0A139TS01      ---PDDKLMDYVTNSDLLNAEILAADSLRKTYQE-YMEKDKERENLKA---QNLGPKHPK
A0A3E1EJT7      ---TKAGRSLSELPFITSQ----------AKVGQLLVQVTTQKLSVTQLR-DRYKDKHPR
A0A7C3I5X9      ---IQEQKPLETFPLIASD----------SQVRSLQSQLATLENELAGLL-KRYKDKYPA
A0A2D5WGA5      ---SDEELRASILTAHPDA-----------QLDALIRELHTGQQTLANQS-IDLGEQHPR
A0A2E7SSH2      ---SPDELRESIMTAHPDA-----------QLDALIREFQTGQTTLANKS-IDLGEGHPT
A0A349GXM8      SRDEEEAPVPGGETKSAKEDAAQQTDETIQGFQNLRVRLMRLEADQAELL-KVLKDDHPR
A0A4P5YP61      ------------LGTNIGALLGIASVANDPTVRDIKSNLSKFESEFATIK-QRYLPKHPK
A0A6B2LYM4      ---RDSGDPLWELGFIANN----------AEVSDLLNKLTVNKIQIATLS-KKFRAMHPT
A0A6D1VXB3      ---KLAAIPDSPFTVDLKK------------------ILLKEQAKYRELE-DIYKEEYPK
I0JYY7          ---KLAAIPDSPFTVDLKK------------------ILLKEQAKYRELE-DIYKEEYPK
A0A4R7S1J2      ---KSRPDEAVNLQIVANH----------PTLNGISTALAARRSEFAALQ-SRYKSKHPK
A0A2A2XV69      ---SDDQIMRSISTLDVQD------PTITQMLPQ-FQEVASEEARLLN---SGLGVNHPT
A0A651H7X9      ---REEGRPLTEISFIANN----------PIVNDLRARLAAKEIEMAQLR-DRYRDLHPT
A0A4Y8P842      ---KSVTIPDNQYTMDLKK------------------NLLKEQAKYRELE-EIYKEDYPK
B3DZK9          ---KSLTIPDNQYTMDIKK------------------NLLKEQAKYRELE-EIYKEDYPK
A0A5E6MPC4      ---PENPYTVELKKLLLKE-----------------------EAKYREME-EIYKPEYPR
A0A6N6PKP9      ---QGEPPERLLTLPSIAG---------AAVVVEVQRKIGEKEAELATLS-RRYKPEYPK
A0A6N6Z250      ---APEDRLAVVNDELVTD----------QNIQQLAQAYLVQQQEVERLR-SQLGEKHPE
A0A4V1SB02      ---PTENVEELLKLNSLSA--------LPDVLRA-RTAVMEKEAAFATVL-ERYKSKHPK
A0A6N6QEJ2      ---KGDELRHFLSSARPTQ-----------ELTALIASLNLAKQKQRQLS-PDLGPEHPE
A0A3C1VB86      ------------MSTNTEDLLAYPQIAIEPDMVQISTDLARLENDFAVIR-QRYREAHPK
A0A146G2Q9      ---TDEQIMRSLTTLEIED------PTITQLYPQ-FQEAASEEARMLN---AGLGANHPN
A0A2T6D3Y2      ---TDEQIMRSLTTLEIED------PTITQLYPQ-FQEAASEEARMLN---AGLGVNHPN
A0A6N6P5E3      ---TDDQIMRSLKTFEMDD------ATISQILPQ-YEACVSEEARMLN---SGLGPNHPS
A0A2D5VY59      ---TLDQLKNTILTAMPGN----------LRLTHLLNEYDTTRQALARLS-AIHGPEHPE
A0A2D8UZZ4      ---TLDQLKNTILTAMPGN----------LRLTHLLNEYDTTRQALARLS-AIHGPEHPE
A0A353DV86      ---TLDQLKNTILTAMPGN----------LRLTHLLNEYDTTRQALARLS-AIHGPEHPE
A0A2E5EPT8      ---SPKVLGNALMTVLPNE----------INLPRLYEQLATAQQELVAKG-KELGPKNPE
A0A6J4HTK1      ---KGEDLMRMMPTLNIQD------PTIQKILPN-YQDAVAQEALMLN---SGLAENHPK
A0A6N6PHJ5      ---DIVALRDVLPGFQ-PD----------SELSSLIGELNAADQKYVSQI-NDLGPSHPQ
A0A6M1RXR2      ---PRDQLPQVLSAAMRDD----------PQLTELLQSLNLAEQALIQLR-RDYADEHPT
A0A7C3DXS4      ---PREELPQVLSAAMRDD----------PQLTELAQSLNLAEQTLIQLR-RDYADEHPT
A0A2V2SDV4      ---SPKDVVNVLPTVI-PD----------ATLTSWLEQRNMLQQRFIALT-NILGERHAD
A0A2V5PK75      ---KYQELTQVLPTTV-AD----------SLLSSLLEQKNMTEQALVIRQ-KEYGDKHVE
A0A1V6DME1      ---APEDLKSVLPTAV-AD----------PQLAELLQQLNLVEQERIRLA-RDLTDDHPA
A0A3D3DIJ3      ---GPEGLAQAITTDA-PD----------TLLTSLLDQLTMAEQRLIALE-ADYGPENTE
A0A6I1K583      ---PADQLRNALNYVAPDELLTKRLDELSLAEKE-FISKS-----------KDLGPLNPE
A0A350EWA4      ---HGMEALTSIDQLKVALPTSFPDSALIVNFAGMFQSEADAERQLAGLL-GQFGRDHPT
A0A5B5WZ91      ---PDDKLMDYVTNSDLLNAEILAADSLRKTYQE-YMEKDKERETLKS---QNLGPKHPK
A0A2N8HD92      ---PDDKLLDYVISSDLLNAESVGAKALRETYAE-FSEKLKEKENLKA---QNIGPKHPK
A0A2N8HIT2      ---PDDKLLDYVISSDLLNAESVGAKALRETYAE-FSDKLKEKENLKA---QNIGARHPK
A0A354EBD3      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGPKHPK
A0A355VEB2      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGPKHPK
A0A2N8IMT3      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
R6K1U5          ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
A0A2N8IWC2      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
A0A2N8I441      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
A0A2N8I3A6      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
A0A410SCC4      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
A0A3R5VEW0      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
A0A411SSG2      ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
B2UKW3          ---PDDKLLDYVISSDLLNAETVGADALRKTYAE-FSDKLKEKENLKS---QNIGARHPK
A0A7C3HWX0      ---STNDLRKAILTTFQAE------EVLPKLLHD--LTTSEQMLARLL---QDYSPEHPE
A0A1M6RLZ4      ---DNEALISAMAGLNLPE------IKVVQNLNEMYLDASRERGSLIA---AGLGANHPR
A0A7C4KPD7      ---NRVELKRAL--VTVQP------DTILMGLLE-DLNKTEQQLALTA---QDYGEAHPE
A0A354T7G8      ---SIEELIARASGLKLDN------PSLASNTTE-YNKLIVQREGLMN---AGMGRRHPN
A0A512MBZ2      ---SPDELVARASGLRLDN------PNLTSMTAE-YQKLQITREGLSQ---QGLGRKHPL
A0A2E8MEZ0      ---PNEDLIRTAAGLELPE------NQVTSYYTG-YRAADEQVSAMIA---SGLGPNHPE
A0A6B3LBV6      ---EGTDLIRKAAMLGIED------QTIQRYYPM-FNDLLLEEQQALE---SGLGANHPT
A0A2E3EC33      ---EGEELIKSAVDLGIKN------ETLSSGWSS-YQALELSRAALVE---SGVGNKHPK
A0A2E4GN01      ---KGEELIKSAVDLGIKN------DILSNGWSS-YQTLELSRAALVE---SGVGKKHPK
A0A1Z8XU55      ---EGEELIKSAVDLGVKN------ETLTSGWTE-YQSLELNRAALVD---SGVGIKHPK
A0A2E1RQR9      ---EGEELIKSAVDLGVKN------ETLTSGWTE-YQSLELXRAALVD---SGVGXKHPK
A0A2E3ISQ4      ---EGAELIKSAVDLGVKN------ETLNSGWSE-YQTLELSRAALID---SGVGVKHPK
A0A2D6W6F4      ---EGAELIKSAVDLGVKN------ETLNSGWSE-YQTLELSRAALID---SGVGVKHPK
A0A2D8Z5A8      ---EGAXLIKSAVDLGVKN------ETLNSGWSE-YQTLELSRAAXID---SGVGVKHPK
A0A4Q2YKS3      ---RTEQLMVYASGLDLPE------NIVKTLYPQ-YLEMQNNLDAAKT---QGFGDRHPT
A0A6N6P3T8      ---SSDQLMVYASGLALPD------NVVQTLYPK-YLEQKTQFQGLKR---QGLGLQHPT
                                                                            

A0A2A2XVF1      FIAALAKAESLKKSL----RESAGKAGDILNRQ------------YEAACQTE----SKL
A0A2V5UHJ2      LDNVKTRLEETRRHL----NSEIDKEVKGIEAG------------FAAARNKE----SEL
A0A2V5PST3      MIELNQQIKEATQSL----NTEINNVVRGIREN------------YVAARAKE----QAL
A0A2V5PXM3      YIQTASQLVEWKNTL----TNAVLNVPQVVRSL------------YESARTAE----AAL
A0A1V5QB01      VQQTMRELKEVQDAL----NIELQFALRQYYAQ------------LEALSIRE----QAS
A0A1J4XH17      MIEATRAKEQTEIEL----KSALDSSINKVYAN------------YDHARDFL----IQS
A0A7C5LI63      VQAVQKELNEVKDNI----QYQVRLARDIQRSE------------VAFLEQQL----AET
A0A7C5P291      LADTERQLQELGEKI----DAEIQFIREKVNAD------------YQLAKQRY----EQI
A0A139SU05      MIEVTNAIIITQEHL----DLAVQGAIADLKTS------------LIEVKKTI----AQL
A0A139SPN4      MIETTNAIITTQEHL----DFAVQGAIADLHAS------------LTEVNKTI----SQL
A0A1V6E7N1      MIELANKLRVAQEQL----RTQVSLAIADLKSR------------LAKTADSE----RTF
A0A2D9MYT1      IIEKRSSIEALQESL----KNAENRIFDSIMNK------------AKLAKATD----VQL
A0A290QGD9      MIDATRMLSQIDAEL----AKATAEAASIVEGD------------YQSALRNA----DEA
A0A1D8AS58      MIEAHNSLTQTEKEL----GRAIDSMAATVEAD------------FQTARRND----EDA
I6AQC1          MIEASNALTQAQLEL----QKAVKIAAELVKSE------------YEAALNSN----KEA
W0ITH7          MIEANNALTQAQLEL----QKALKIAAELTKSE------------YQTAFNAD----KEA
A0A258ANJ7      YEAVQVVIHNQEQQL----TTILDDAFHLLQSS------------WEHARELE----HRL
A0A139TLN4      VRELEANLASLKDAL----KRSVNNYYTSLLVK------------KKNVEEQH----EGT
A0A1G3ZFT0      MINLKRRIAMLHEEK------------------------------------------KEL
A0A1Z8ZMT6      IISGTDQINLKTKIL-------LSAMKDVLSSD------------LETDYWRG----FQD
A0A2E8MCT7      IISATDHIDLKTKIL-------LSAMMDVLSND------------LETDYWRG----FQD
A0A290Q2Z2      LIGATDNRAKIKEQL----DAQLRGYESALEIA------------YKEADARV----AEL
A0A2A2RGK2      YVAIKTQIDLTKADL----KRVLKDAVTLLANS------------RNRLEVQS----TEM
A0A2A2XXF7      YISVKTQIDLTKADL----RRVLNDAVNLLESA------------RNRLEVQA----NET
A0A2A2R5D6      IKSREAELAKIDEQI----NANAAGKRRALEID------------VQVTKARV----TQL
A0A3C1VJ32      VTRVQTLIDTLDGQI----IDRVAGIMVTLQSQ------------VNSKKASL----DSL
A0A2N9NTX7      TKKARESVSDLKQKI----KDRVDGIMLGLQAK------------VASVRESL----DQM
B9XK55          VLRTQKLVNELNAKI----DDRVKGIMVGMDAR------------VASLLAVV----KNS
A0A4P5YMI6      VIRVNSLLEKITAQV----ADRVDGILRGKEAD------------LAAARARD----EEL
A0A2E6T482      IKGLKKVVATLEGQI----DDRIKGVLAGLELR------------VKSSKAQV----EEL
A0A3C0DQZ7      IKGLKKVVATLEGQI----DDRIKGVLAGLELR------------VKSSKAQV----EEL
A0A1Z9CBK5      IKSLKAALESLDQQI----DNRIKGILAGLELR------------VQSSLAQV----XEL
A0A2D6ZI96      IKSLKAALESLDQQI----DNRIKGILAGLELR------------VQSSLAQV----XEL
A0A358KGZ3      IKSLKAAMESLNQQI----DNRIKGILAGLELR------------VNSSLAQV----REL
A0A2E9ZQX4      IKSLKAAMESLNQQI----DNRIKGILAGLELR------------VNSSLAQV----REL
A0A3D5JZU0      IKSLKAAMESLNQQI----DNRIKGILAGLELR------------VNSSLAQV----REL
A0A2E6HCR0      IKSLRAALQSFDSQI----QNRIQGILAGLELR------------VSSSLAQV----NEL
A0A1Z8WN04      IKSLRAVLSTFEGQI----QNRIKGILAGLELR------------VKSSLAQV----NEL
A0A2D7L1N4      IKSLRAVLSTFEGQI----QNRIKGILAGLELR------------VKSSLAQV----NEL
A0A2E2R937      IKSLRAVLSTFEGQI----QNRIKGILAGLELR------------VKSSLAQV----NEL
A0A520QQY4      IKSLRAVLSTFEGQI----QNRIKGILAGLELR------------VKSSLAQV----NEL
A0A2D5MR66      IKSLRAALQSFEAQI----ENRIQGILAGLDLR------------VKSSLAQV----KEL
A0A2E0PDQ1      IKSLRAALQSFEAQI----ENRIQGILAGLELR------------VKSSLAQV----NEL
A0A2E2ZZP9      IKSLRAALQSFEAQI----ENRIQGILAGLELR------------VKSSLAQV----NEL
A0A7C4LRK7      MLRVNKLIETLERQV----NDRLDGIIKGLETR------------VISYKARA----QEL
A0A2A2RGF2      YVRMQALIVKLNQQV----EDRVSGIMLNLETD------------LKAQAAAL----ALT
A0A2G4I5Y6      YVRMQAVIVKLSQQV----DDRVNGIMLSLETD------------LKAQAAAL----ELT
A0A6N6PS97      IQKLTAVAAKLNQQI----EERIEGVLRGVQVT------------MNRSKSVL----DEL
A0A3M1I883      VQRYMALKDTLQKQI----TNRLNGILEGMRAQ------------VASFKARY----DEI
A0A1V6JZ45      MKRKLALVEQIDQQV----EARLTGILTGLENQ------------VISLKARR----DEL
A0A7C7Z746      VQNANALLDKVNQQI----RDHVRKMIQGYASM------------AAIALDHS----EAL
A0A520RRW5      MQASNSLLLTLNDQI----KKEITGVLRGLQTQ------------VNAARNQL----TEL
A0A356NPK0      MQASNSLLLTLNDQI----KKEITGVLRGLQTQ------------VNAARNQL----TEL
A0A2D7B5P5      MQASNSLLLTLNDQI----KKEITGVLRGLQTQ------------VNAARNQL----TEL
A0A3D3XGB5      MQASNSLLLTLNDQI----KKEITGVLRGLQTQ------------VNAARNQL----TEL
A0A2V6F8A1      FKGVAAMQAHLDEEI----NRRINGILGGLKVR------------VDAFKANL----DTL
A0A2V5TNH4      FKAMAAVQANLDTNI----NQRIEGMLAGLKLK------------VDAFRLHL----DSL
A0A2V5X5Q6      FIAMAAMQANLDTNI----NQRINGILGGLKLK------------VDAFKLNL----DTL
A0A4P5QM05      MKSLRAQREVYAKIL----SDQLDSIKRSLNTR------------LGIEEATL----KTF
A0A4Q3C001      IASLRQMSAVYRQNL----DNALEAIRRAQATN------------LKVSEDTL----AAL
B4DB23          IKALDAQMATYQKIL----GDQLNTIKITQANR------------LRLEKDKL----SGL
A0A6B3L938      RIEAEAVYEDLYNRF----RREIDTASRTTEERDFWGLKRDEMRELDIEVRTA----QTP
A0A2V5URB2      LAQVKAQLQETRSKL----AQQIRSVVEGINSA------------YLAAAGKE----RAL
A0A2V2DJ66      MIEARKALDQVDKEL----AAALDSAYEKVRST------------YLTMKNNY----EMS
R7L5A9          MIEARKTLDQIEKEL----ALAVDAAYAKVQAS------------YETARQNY----EQS
A0A5R8KA81      FIQMQDRLKDLQRSQ----LENIALAAEGMENA------------YNSALATE----QKV
A0A5B5WU87      VRELEANLSSLKDAL----KRSVNNYYTSLLVK------------KKNIQDQH----EKT
R7DZW0          IRELEANLNSLKDAL----KRSVNNYYTSLLVK------------KKNVQDQH----EQT
A0A2N8HID1      IRELEANLNSLKDAL----KRSVNNYYTSLLVK------------KKNVQDQH----EQT
A0A2N8HS06      IRELEANLNSLKDAL----KRSVNNYYTSLLVK------------KKNVQDQH----EQT
A0A6N2TNT9      IRELEANLNSLKDAL----KRSVNNYYTSLLVK------------KRNVQDQH----EQT
A0A3R5R2M8      AAGLRDRMESTRAAA----NKALANYRNNLDIK------------LKELNAKR----DSL
A0A411SUQ6      AVSLRDRMNSTRAAA----NKALSNYRSNLDLK------------LNQLINKR----NSL
A0A2N8HZF2      AVSLRERMNSTRAAA----NKALSNYRSNLNLK------------LNQLISKR----NSL
A0A354E720      TVSLKDRMNSTRAAA----NKALSNYRSNLDLK------------LNQLIDKR----NSL
B2UPB6          AVSLRDRMNSTRAAA----NKALSNYRSNLDLK------------LNQLINKR----NSL
A0A2V6JLK8      VKSVRAARQVYTRQL----EQQVGIIRQGLERN------------LKTAQGTR----DEL
A0A2W5Z1A5      VKALRAQKQVFARQL----QEQVGIVRSALEKN------------LKTAEKTR----DEL
A0A2V6EA09      VKALRATKAVYAKQL----EEQMASIRSALEKN------------LKTAQTTR----ERM
A0A2V6GQI7      VKALRATKAVYAKQL----EEQMASIRSALEKN------------LKTAQTTR----ERM
A0A3C1HEJ2      YIKAQTQLAAAQSQL----TNAVLKVVGAYATK------------LSAAKAEE----QEL
A0A522ULD9      VKRLRAGLEELRQRL----ADGLAGMKKGLEAD------------YQVAKAKY----NVL
A0A1V6JU76      VIQARSKIEETHRSV----QGAAQQVAEILRSE------------ARLAKASE----QIL
A0A2A2XXW5      VIQPATQLQADTQKL----RDESERALQGIFQM------------AELEKSRE----VEA
A0A6N6Q6V0      YTTLASTLANARESL----DAQVQRVLKSLEAT------------ATIEKNTE----AQA
A0A1Q6UHJ9      MIEARKALDQINKEL----ASAIESAEQKVQAA------------YEAARQNY----EQS
A0A2V2BXR0      MIEARKALDQINKEL----ASAIESAEQKVQAA------------YEAARQNY----EQS
A0A2D8V0G3      VIVAKEQIRKLTDEI----QQQAGQELKILREQ------------ARFANERA----DRA
A0A348S017      VIEAKERIVKLTEEI----QKVAQDEIDLLREQ------------ARYQQARA----VRA
A0A3C1UUV7      VIEAKERIVKLTEEI----QKVAQDEIDLLREQ------------ARYQQARA----VRA
A0A350I3V2      VIEAKERIVKLTEEI----QKVAQDEIDLLREQ------------ARYQQARA----VRA
A0A520RGV5      VIEAKERIVKLTEEI----QKVAQDEIDLLREQ------------ARYQQARA----VRA
A0A3D3XF90      VIEAKERIVKLTEEI----QKVAQDEIDLLREQ------------ARYQQARA----VRA
A0A2D7B522      VIEAKERIVKLTEEI----QKVAQDEIDLLREQ------------ARYQQARA----VRA
A0A356NIC2      VIEAKERIVKLTEEI----QKVAQDEIDLLREQ------------ARYQQARA----VRA
A0A2N8HDG3      VVTLTKKMDATRSAA----ARSLDNLRNNQKLQ------------LQELTKKR----ENI
A0A146GCJ0      YIAASMRIANLRQSL----ATEATQASETLSRL------------YEAAKDSE----VKL
A0A2T6D6H8      YIAGVTRIANLKQAL----DSEVKQAGETLSRL------------YEASRESE----MKL
A0A3D1TI55      MVKFQTTIDELRRAK----EQKLVAIKEGLASR------------YDVAQRRV----ENL
A0A3E1ET42      IRGLRESINTTRKTL----ETAVSGFKDSLKVQ------------ISQAEQTL----AKG
A0A2A2YDW8      VLAQESTVDSLFKQL----QASVVSFKDSLKIK------------RETKNVEL----VEL
A0A352XLN9      VLAQESTVDSLFKQL----QASVVSFKDSLKIK------------RETKNVEL----VEL
A0A3D0YP62      IVMRTTRIEELKKGL----EKRAVNVRQSLTHK------------LGIIEGRV----NKM
A0A3D3DV47      IVMRTTRIEELKKGL----EKRAVNVRQSLTHQ------------LGIIEGRV----NKM
A0A2E5XJ49      IRMALIAQDKLEEDL----RSAVVTLKDLLRTQ------------LELVDGQL----EKL
A0A2E6SBY8      IRMALIAQDKLEEDL----RAAVVTLKDLLRTQ------------LELVDGQL----ENL
A0A2E5QMS4      MEMSLIAQNKMQEDL----GGAVVVLRELLKTQ------------LRLVNGQL----AKI
A0A2E7YXQ3      MEMSLIAQNKMQEDL----GGAVVVLRELLKTQ------------LRLVNGQL----AKI
A0A2E3H787      VEMGLIAQAKIEEDL----KAAVVVLRELLKTQ------------LSLVXGXL----EKI
A0A2E7AGN1      VEMALIAQEKLQEDL----KASVVVLRELLKTQ------------LDLVNGQL----VKI
A0A2E7AKY7      VEMALIAQEKLQEDL----KASVVVLRELLKTQ------------LDLVNGQL----VKI
A0A3D4CU34      VEMALIAQEKLQEDL----KASVVVLRELLKTQ------------LDLVNGQL----VKI
A0A2E8M146      VEMAYIAQSKLQEDL----KSSVVVLRELLKTQ------------LSLVNGQL----VKI
A0A355S8S2      VEMAYIAQSKLQEDL----KSSVVVLRELLKTQ------------LSLVNGQL----VKI
A0A2D6DVN8      VEMAYIAQEKLSEDL----KSSVVVLRELLKTQ------------LNLVNGQL----DKI
A0A3C1W2R2      VEMAYIAQEKLSEDL----KSSVVVLRELLKTQ------------LNLVNGQL----DKI
A0A2E3NAY6      VEMAYIAQEKLKEDL----KSSVVVLREXLXTQ------------LNLVDGQL----EKI
A0A2E3II01      VEMAYISQKKLSEDL----KSSVVVLRELLKTQ------------LNLVNGQL----EKI
A0A368B8C5      VEMAYISQEKLSEDL----KSSVVVLRELLKTQ------------LNLVDGQL----EKI
A0A3R7RBB5      VEMAYISQEKLSEDL----KSSVVVLRELLKTQ------------LNLVDGQL----EKI
A0A2A2QX62      MVSLATNLVAMEKQL----DEAVANLRETLKVK------------LELSKEQL----ARL
A0A4Q3BWH6      MVSQATTLEGMERDL----TEAVANLRETLKAK------------LSLSQEQL----ARL
A0A3N5WCF1      ILVAVDQIENMKRQL----DEGVVNLRATLQAQ------------LDLAVNRL----KSV
A0A4Q3C1K5      ILAAKDQIAGMKKQL----DEGVVNLRATLQAQ------------LDMATDRL----KNV
A0A3R8IT45      MIEANNALAQAELEL----KRAVDSAAASVISE------------YETAKNAD----TEA
A0A2A2PYE8      MIEALNSFQQTEREL----KRAVENVSAQVESD------------FQAASRTF----KNL
A0A2T6CN73      MIEAQNSYDQIKREL----DRAIASACAQVESD------------YQSALNTY----RQN
A0A2G4G428      LIQARAQLKQTEAEL----QNAIVTSVNRIQVA------------IQNAHANY----AAI
A0A6N6PCD8      YIQTQSELRGLRETL----DRAARKGASIALNA------------YQGAKEAE----AKL
A0A139TV24      VVSLTKKMDATRAAA----FRSLSNLRDNLNLR------------LQELTRKR----EDI
A0A2N8HT11      VVTLTKRMDATRSAA----SRSLDNLRNNLELK------------LQELTRKR----QDI
R7DS70          VVTLTKRMDATRSAA----SRSLDNLRNNLELK------------LQELTRKR----QDI
A0A2N8HNL6      VVTLTKRMDATRSAA----SRSLDNLRNNLELK------------LQELTRKR----QDI
A0A6N6PAZ1      MITASAELTQLKEQF----IREFEDARQAASDK------------PYWDLAG-----KDL
A0A6I1K459      MIQAHTELNSLRQQF----EDEVLKAPVRLSQQ------------LKAAQERE----RGL
A0A139TUL1      VSSLAENMKEMRESI----VRSISNYCDVLRVR------------MGELERER----DEL
A0A2N8HCB0      VSSLAENMKEMRESI----GRSIANYCNALEVR------------MSELEKER----DEL
A0A2N8HP04      VSSLAENMKEMRESI----GRSIANYCNALEVR------------MGELEKER----NEL
A0A2N8HRJ0      VSSLAENMKEMRESI----GRSIANYCNALEVR------------MGELEKER----NEL
A0A6N2U9Y7      VSSLAENMKEMRESI----GRSIANYCNALEVR------------MGELEKER----NEL
A0A366HAG0      MRGIAGSLEQTRALL----LEAAQDYRKNLGVR------------ITTVERQL----EEA
A0A2U8DZK4      MIVARENLSKIKTQL----EAQLTGYEFTLKSK------------AEEAEARV----TEL
A0A2T6DFL8      LIAAVDNRAKIKEQL----DAQLRGYENSLEIA------------YKEAEARV----AEL
A0A1D8AWD4      LIAAIDNSAKIQQQL----DSQLRGYESSLEMA------------FKEAEARV----TEL
A0A4Q1C9S2      LIAAVENGAKIQQQL----DSQLRGYESSLEMA------------YKEAEARV----TEL
A0A178IH18      LITATDNRAKIREQL----DAQLRGYENGLEIS------------CKEAEARV----AEL
A0A2T6DT99      LIAAMENRAKIREQL----DGQLRGYENALEIA------------YKEADARV----AEL
A0A1G3ZT33      LIAAVDNRAKISEQL----DALLTGYEKSLEIS------------CKEAEARV----TEL
A0A3E1E2T2      LISAIDNRAKIKEQL----DAQLRGYENALEIA------------YKEAEARV----TEL
B1ZMW1          LIAAVDNRAKIREQL----DGQLRGYESALEIA------------YQEADSRV----AEL
A0A3M1I8A3      VVTLRSQIAETEKEL----QQTVKDVIETLRKS------------AELRQIEL----ANL
A0A4V0XS84      IVRLRDEVRSLRSAF----ERESQALGDGVRAD------------ARIAQSIE----AAF
A0A351WE84      VKRLQAGVDELKKKL----NESLVGLKIGLNAD------------YEVAKAKF----DAL
D5ENH7          MIQQLQTLQESEVEL----GEAVQNSVDKVYAS------------YIEAKSNF----ELA
A0A0R2XQ77      MIEQLQILQESEVEL----VTAVKDSINKLSSA------------FAESKNNF----ELA
A0A2E9IN28      MIQLLQTLQESEQEL----AIAVKNSVDKIYAS------------YSEAKSNF----ELA
A0A6N4WTJ5      MIQQLQTLQESEAEL----VFAVQNSVNKIGAA------------YAESKSNF----ELA
A0A1V5QDZ6      VLRVQAGVDELRKKL----ENALNGMKTGLRAN------------YEVALQRY----EVL
A0A4Y8P964      MSRIKAEIEGLNKEI----NEEKEATIEKLEAD------------YEAAKKHY----ESL
A0A3D4HF88      MISINQSIDETQSEL----TAAVNSAVQKVHAA------------YVISDTNY----NHA
A0A6N6ZHN8      MIAARQTLQETQQEL----QKAATEAAGRLKKD------------YENAKDNL----ESA
A0A6G6K641      HIDQVARVEAAKREL----PAAAMRAAATMKEQ------------YETAKETE----SRI
A0A5B5WI95      AVGLRERMDSTLSAA----NKALANYRSNQNLK------------LEELKKKR----ETL
A0A2N8I9W1      TVSLRDRMNSTRAAA----NKALSNYRSNLNLK------------LNQLISKR----DSL
A0A4Q5IH27      TVSLRDRMNSTRAAA----NKALSNYRSNLNLK------------LNQLISKR----DSL
A0A2N8IBZ6      TVSLRDRMNSTRAAA----NKALSNYRSNLNLK------------LNQLISKR----DSL
A0A2N8IJW9      TVSLRDRMNSTRAAA----NKALSHYRSNLNLK------------LNQLISKR----DSL
A0A7G6DX28      TVSLRDRMNSTRAAA----NKALSNYRSNLNLK------------LNQLISKR----DSL
R6J100          TVSLRDRMNSTRAAA----NKALSNYRSNLNLK------------LNQLISKR----DSL
A0A1V6J089      VLRLRGAQDELRRQL----DSALAGLKAGVKAD------------YEVARQKY----EAL
A0A3C1BZR1      VLRLKGAVEELRRQL----ASALEGLKAGIKAD------------YEVARQKY----EAL
A0A7C4KLL2      YIDAAVQIEAMKRDLHLAATNALARLLEAIKVD------------IEDAKINQ----EGL
A0A1H6KPB7      LLSMVQEHENTKQKL----TEGLVGLKDALEQT------------LSLKEEGR----KSI
A0A2E9ISN4      MIDLKGEITKAQSSL----AHQNELALKRFEAH------------YEALKLQE----AGI
B9XAX1          MLQAQRQLDDLKDAL----RSLASKAPKLVQSA------------YDGALARE----NNL
A0A5R8KKM9      MISLGKEIETARTLL----LDAANDYRNNLAFR------------ITTGERQL----AEA
A0A139TS01      MVALQETANILKEKL----NKELVGLRSSLRSK------------LEMVTASR----VKW
A0A3E1EJT7      LIEAVNALNQTEQEL----QASLATAAESIKAE------------YENAVQTD----EGA
A0A7C3I5X9      VIQARSRIDDTRQAI----ERAAKAVAEVIRAD------------ARLAKASE----ASA
A0A2D5WGA5      IKGLKKVVSTLEGQI----DDRIQGVLAGLELR------------VKSSKAQV----EQL
A0A2E7SSH2      IKSLKAALDSLNQQI----DNRISGILAGLELR------------VNSSLAQV----QEL
A0A349GXM8      LKAVRDEIKSIQDQL----ASMAEVQMRNLRDR------------HRALSIQL----NAI
A0A4P5YP61      YMGTLSALTEWRNAL----TNAVMKIPQTIEIS------------YRGAKSSE----ETF
A0A6B2LYM4      MIAAQEQLDQTQSEL----DKAVNTAASRFEKD------------FERTEANL----RNS
A0A6D1VXB3      MSRLRTEIEGLNKEI----SEEKEATIEKLEAD------------YEAAKRHY----ESL
I0JYY7          MSRLRTEIEGLNKEI----SEEKEATIEKLEAD------------YEAAKRHY----ESL
A0A4R7S1J2      YTAAQSDIANLEARF----REALPQVSVSLEAS------------LLASLESAKVNEKKL
A0A2A2XV69      VKSMRAKKEVMATQL----VTQIASLRASMEAN------------IRIGEDSI----TQL
A0A651H7X9      MIEARNSIQQTRTEL----NQAVEQAAARVHSE------------FQTAERSV----AEA
A0A4Y8P842      MVRLKAGIEGLNQQL----TDEKQAVVEKLEAE------------YEAAKKNF----ESL
B3DZK9          MVRLKAGIDGLNQQL----AEEKQAVVEKLEAE------------YEAAKKNF----ESL
A0A5E6MPC4      MVQVHAEIQGLQDEL----NQEKEASVADLDAE------------YEAAKRNY----AGI
A0A6N6PKP9      YLEATGSLAELKVSL----GEAILKAASLLGTA------------FESTKANE----EKL
A0A6N6Z250      LASRVAKLRVLREQL----DDLLAGYEKALKIG------------YLEAQARV----TAL
A0A4V1SB02      YGEAQAQLSEAKSKL----RTAVANAGDALRQQ------------YRSLTETE----EKL
A0A6N6QEJ2      VKRVIGLISEINDQL----DKEVQGMVDALSAQ------------LEIARGNV----REL
A0A3C1VB86      YILAASSLAGLKGQL----AANALKARARIQES------------LRIAYQNVLTAKQGL
A0A146G2Q9      VKALRAKKEVMQRQL----AEQTAILRKTLETN------------LAIAEQGL----KSL
A0A2T6D3Y2      VKSLRAKKEVMQRQL----AEQTAILRKTLETN------------LTIAEQGL----TSL
A0A6N6P5E3      IKSLDAKKRVYAQQL----KNQIAVLRQSLTAN------------LEIAQKSL----QAM
A0A2D5VY59      RKSLYTLLEEIETQV----TSEITGVLRGLQSQ------------VNAAQNEL----NEL
A0A2D8UZZ4      RKSLYTLLEEIETQV----TSEITGVLRGLQSQ------------VNAAQNEL----NEL
A0A353DV86      RKSLYTLLEEIETQV----TSEITGVLRGLQSQ------------VNAAQNEL----NEL
A0A2E5EPT8      IERMTKVILEIQLQI----EGRVKGIMSGLEAE------------AKALQSGY----DNR
A0A6J4HTK1      VRALRATKEVFTRQL----EEQVKIIRSALEKN------------LATAGTTV----TEL
A0A6N6PHJ5      IQAVNDLRELLNKKI----DARVGGILKGLETQ------------VSTAKSEL----DSI
A0A6M1RXR2      VVTVRKQIEDLKRKI----TNRVDGLLLGLEVR------------VASLKERL----DSI
A0A7C3DXS4      VVTVKRQIEDLKRKI----NNRVDGLIRGLEVR------------VASLKERL----DSI
A0A2V2SDV4      VVTVQSQLDDLNAKI----AAKATGILQGVQTR------------VAAVKDSL----AKL
A0A2V5PK75      VIKLQRQLDDLQDKI----AKRVEGIITSLEAR------------VAAVQTNL----ALL
A0A1V6DME1      VVTVTRQIKDIETKI----AQRADGIIRGLEKR------------VASMKAYL----DSL
A0A3D3DIJ3      VLKCKGLAEDLHKKI----KSRVEGIMLGLDTR------------VISLSNSL----VNL
A0A6I1K583      YARMKDVIAKIETQI----EARVVGLMKGLETD------------LLADKATL----AER
A0A350EWA4      VMSAQAELDKARETI----KSRVEAMLIGQKND------------ALALSNNL----VEL
A0A5B5WZ91      MVALQETANILKEKL----SKELVGLRSSLKSK------------LEMVAASR----MKW
A0A2N8HD92      MLALVETERILSDKL----NKELIGLRSSLKSK------------LEMVSASR----KHW
A0A2N8HIT2      MLALLETERILGEKL----NKELIGLRSSLKSK------------LEMVSASR----KHW
A0A354EBD3      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A355VEB2      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A2N8IMT3      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
R6K1U5          MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A2N8IWC2      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A2N8I441      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A2N8I3A6      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A410SCC4      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A3R5VEW0      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A411SSG2      MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
B2UKW3          MLALLETERILGDKL----NKELIGLRSSLKSK------------LEMVAASR----KHW
A0A7C3HWX0      VKSARAVRDQIEQQV----TERIEGMMLGLESR------------VKSLQERY----EAL
A0A1M6RLZ4      VKMSRTRVEALRKQL----DEKVTEVRDVLKDK------------LDLENQRV----QRL
A0A7C4KPD7      YKRLVELLTTQERLV----DERLTGILEGLRAL------------VEKSQAGV----VEL
A0A354T7G8      VESLSSQIDKLKTFI----EAEARAHVQGLQNR------------LDGAKRKR----DSF
A0A512MBZ2      VQTADKQLAKSKELI----LAETQSYIEGLKNR------------FDAAKMRR----ETL
A0A2E8MEZ0      VKAMRLRADGALENA----GKEVMSLKEVLETR------------LNLVDKQV----EKM
A0A6B3LBV6      VRAIRTQLDSLRGLL----MEAVSDVRGALEIQ------------ITQLEKRL----AEA
A0A2E3EC33      IINIDSQLALRMKQL----LDAVDVHKKALETQ------------LSMAEQQF----QNS
A0A2E4GN01      ILNIDKQLKLRMMQL----LDAVEVHKKALQTQ------------LSMAEQQF----QNS
A0A1Z8XU55      ILNIDSQLNLRMKQL----LGAVETHKKALSTQ------------LTMAEQQF----ENS
A0A2E1RQR9      ILNXXSQLNLRMKQL----LGAVETHKKALSTQ------------LTMAEQQF----ENS
A0A2E3ISQ4      IVNIDSQLKLRMNQL----LDAVETHKKALTTQ------------LSMAEQQY----ENS
A0A2D6W6F4      IVNIDSQLNLRMNQL----LDAVETHKKALTTQ------------LAMAEQQY----ENS
A0A2D8Z5A8      IVNIDSQLNLRMNQL----LDAVETHKKALTTQ------------LAMAEQQY----ENS
A0A4Q2YKS3      VLELSGRVANMKKQL----DEGVVNLRDVLRAR------------LEMATAQL----AQV
A0A6N6P3T8      MLANAQMIESMKKQL----DEGVVSLRDTLQAK------------LELAEARF----KRA
                                                                            

A0A2A2XVF1      TVALKEQEVAALDLN-KMAIPFNVLQREVESDRVLYESVIKRMKETAVTG-AVDQAP-YT
A0A2V5UHJ2      RVAMEDQKKATLNLK-DSAVQYAILAREVDTNKQLYDGVLQRLKEIGVAA-EVRTSN-IY
A0A2V5PST3      EVETGKQQQAALNLK-EVGVQYAVLQEEVNVNKNLYDSILKRLNETTISN-DIAVSN-MQ
A0A2V5PXM3      ETALREQESAALELS-SQALHYSSLSREVDSDRALYEAVLNRIKETALTK-EIKPGK-VR
A0A1V5QB01      KRVEQEWEEEALEVS-RKQQEYQNIQRNFGRLQSLYDLAFNRLKEIDISV-GIEPES-VQ
A0A1J4XH17      EKRLAQKEKGIINLS-KIKVEYSTLSRDFEVNQGLYQSMVLRLNTEMAQI-DLKKPS-AR
A0A7C5LI63      EKNLRLADNEVQQKT-RELMGGTILSEDLERLRSQHRALLNQITTLDVRQ-GFRYRN-IS
A0A7C5P291      KSTADQVEAEALGDS-QRMLEIKSMRANVDRVQTLYNTLLGKLMQIDVTQ-SFNTRS-IS
A0A139SU05      ENEYAENEKEALSLR-NMRVDFESLQNEAAVARANYMQILDRLNQTTTTK-YLEKVP-IR
A0A139SPN4      ETEYTAAEQEALNLR-NMRVDFESLQNEALVARSNYMQILDRLNQTTTTK-YLEKVP-IR
A0A1V6E7N1      EQEKQLQETEFFKLR-DLRGEYNSLKNQADVAQKNYIDILDRLNQTTTTK-SLEKLP-LQ
A0A2D9MYT1      AGVLTIRKSEQQSMN-QKSIEYNNLSRTATQSETMYNLALQRXKETELQE-KDIVQN-MH
A0A290QGD9      RSGLVEQETQSLGID-RAGVEYESLDRELKIEEQVLQHLMGRMRETTMSS-TLDTQN-AR
A0A1D8AS58      RANLARQEKESLDLD-RDAVEYSNLERDLAINEHLLNTLLSRMRETSMSS-TIETQS-AR
I6AQC1          RAILAQIEKESFEID-KAAVDYQMIERDFLVNSSILDNTIKRIRELDITS-TIEGQN-IQ
W0ITH7          RGALAQIERDSLNMD-KIGVDYQMLEQDFLINREILDRTIGRIREIDLTS-TIEGQN-VQ
A0A258ANJ7      QEQLKKQESEALDLE-QLAVQYNVLKREMESDQAVYESVLTRIKQVDVSK-GMETPP-IW
A0A139TLN4      RAHIRAVSGKERAVN--------QIAREQRVRESLYIFLLNKREENSLAL-AATEDN-AR
A0A1G3ZFT0      LNEVKKLPLMDQMML--------NLLRDVKMKNALNTILLSKIQEMKIIQ-AGLLSD-VR
A0A1Z8ZMT6      QIDDIENEENFKDLRNAMKLRASLLTNSVETKNELYNTLLSRVGVLKTDAEGVEAEV-IK
A0A2E8MCT7      QIDDIKNEENFRELRNAMKLRASLLTNSVETKNELYNTLLSRVGVLKTDAEGVEAEV-IK
A0A290Q2Z2      KNQLAQAKVDQILSARDRMRPFEEAARKLEDETRLLSTLKVTLRQREIDF-QVPKRS-IE
A0A2A2RGK2      KTAREAAEKRLLEVT-HKSIEYNDIKREQETDQALYNSVISRLKEVDVSK-QLTESP-VR
A0A2A2XXF7      KIAREKAEGRLIEVT-AKSIEYNDIKREQETDQALYNSVLSRLKEVDITK-QLTESP-VR
A0A2A2R5D6      EKEVGVLTDQVRMQKTTELAKFREAKKEQDRQQLLYDQFVIRKKQSVVDK-QITNDP-AT
A0A3C1VJ32      VQQVEEAKQKDHDNA-TKNQPYYDEKRKLDQLLDSHKLLYTKIVIDTIDA-QIPKTTMVE
A0A2N9NTX7      KKEVDEATKTDISKA-SESAPYWKAKRELEEQEHFRAILDLKIISEKVDL-SLPKTTMVE
B9XK55          EDKVNEAKSNDLVLA-ESSRPYFIEKSQLDHLKKFREILEFRAAQEQVDR-ALPKTTMVQ
A0A4P5YMI6      TRAVEEAKVKNREAA-EKMRDYLTAVRDVEQLERMRDSLKFKIQQEDIDM-DMPKTSMVE
A0A2E6T482      QRDVDEAKQRESDMR-EKGREYFDAKRELANTTRIRDTILLRIMQEEVDL-ELPTESTVE
A0A3C0DQZ7      QRDVDEAKQRESDMR-EKGREYFDAKRELANTTRIRDTILLRIMQEEVDL-ELPTESTVE
A0A1Z9CBK5      QKAVDDAKAKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A2D6ZI96      QKAVDDAKAKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A358KGZ3      QKSVDDAKAKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKTSSVE
A0A2E9ZQX4      QKSVDDAKAKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKTSSVE
A0A3D5JZU0      QKSVDDAKAKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKTSSVE
A0A2E6HCR0      QMAVDDAKSKEAKVQ-EEGREYFDAKRRLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A1Z8WN04      QKAVDSAKSKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A2D7L1N4      QKAVDSAKSKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A2E2R937      QKAVDSAKSKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A520QQY4      QKAVDSAKSKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A2D5MR66      QKAVDNAKSKEAKIQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A2E0PDQ1      QKAVDNAKTKEAKIQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A2E2ZZP9      QKAVDNAKTKEAKIQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKESSVE
A0A7C4LRK7      TAKVEDAKKKERLAA-EKMQPYLAAKDKFELDRQLMSTLKLRVSSATLDNLKIGYSSTVK
A0A2A2RGF2      ETKLEEAKVRNRTAA-EKNRTYQMALTDLEDLKRLRATMNAKIIVEESDV-AMSRSNSVR
A0A2G4I5Y6      ETKLEEAKVRNRTAA-EKNRTYQMARDDLDDLKRLRATMNAKIIVEESDI-DMSRSNAVR
A0A6N6PS97      EKAVADAKKQDGIKM-ENYRPYFAAKRDLETENKIRETIFLRILQETVDD-KIPKNGMVD
A0A3M1I883      SNQVAQAERAVAEEA-ARFSQYFDLKRQWENEQRIRDTLLLRTLQETIDS-ALPTESVVE
A0A1V6JZ45      QKAVDDGKKLVVEEA-KRSREYWSSKRELENKQKIRDAILMRMLQEEVDA-ELPKESMVR
A0A7C7Z746      QIRLDEVKKEERKAT-TKYRPYSRAKEKLDELKKIKASLHIRLLAEQVDV-NIPTAAIVD
A0A520RRW5      TSAVESAKASDAEKT-AEYRPYFTAKRDLENLSKISDMIMIRILQETVDA-ALPTDSIVE
A0A356NPK0      TSAVESAKASDAEKT-AEYRPYFTAKRDLENLSKISDMIMIRILQETVDA-ALPTDSIVE
A0A2D7B5P5      TSAVESAKASDAEKT-AEYRPYFTAKRDLENLSKISDMIMIRILQETVDA-ALPTDSIVE
A0A3D3XGB5      TSAVESAKASDAEKT-AEYRPYFTAKRDLENLSKISDMIMIRILQETVDA-ALPTDSIVE
A0A2V6F8A1      AKSVDDARKKDADMT-EKYRPYFEAKRRLDNLQKLRDAVHLRVLQETVDA-ALPKTSIVE
A0A2V5TNH4      AGAVDHARTNDAFMT-EQYRPYFKAKRRLDDLTKLRDAVHLRILQETVDA-ALPKTSIVE
A0A2V5X5Q6      ASAVDHARTNDAFMT-EQYRPYFKAKRKLDDLQKLRDAVHLRILQETVDA-ALPKTSIVE
A0A4P5QM05      ETNVDKTHKVQIDEK-TRMSRYVEKKSAYLMTKTLLFEIRRQYDKAKMNN-ILTQIP-VK
A0A4Q3C001      EQKLEQTRSAQIIDK-NSSSRYTEAKTKYLNAKKILEAAELRYSTARMER-GVDIDP-AR
B4DB23          QEMSKASRTDDIKEK-ASLVEYVDAKNKYIQARKLYESVELSYVTQKMNN-SVKGDS-AK
A0A6B3L938      SARAAAKDRWLSLVQSSLSARASILESRILNQRRLYETVTNRLTEIDVAD-ETSNAE-VT
A0A2V5URB2      KLQMDKQKSDALALK-DASVEYAILARETNTNSQLYDGVLERFKEINVAG-EIPASN-IS
A0A2V2DJ66      QQRLNKKREEILQLG-RKAIVYKALERERKVAEGMHAEFIAAMNVRLAQV-SLITDT-AK
R7L5A9          QKRLAEKKEEILSLG-KKAIIYKSLERERMVAEGMHASLISAMNVRTAQV-SLINEG-AS
A0A5R8KA81      AQGLAEQERLALDLG-KIAIEYNALARDVESNQALYASVQKRLKETDITR-TIEFAP-WR
A0A5B5WU87      REHIRNVSSRERDVN--------YIDREQRVRESLYVFLLNKREENSLAL-AATEDN-AR
R7DZW0          REHIRNVSSRERAVN--------HIEREQRVRESLYVLLLNKREENSLAL-AATEDN-AR
A0A2N8HID1      REHIRNVSSRERAVN--------HIEREQRVRESLYVLLLNKREENSLAL-AATEDN-AR
A0A2N8HS06      REHIRNVSSRERAVN--------HIEREQRVRESLYVLLLNKREENSLAL-AATEDN-AR
A0A6N2TNT9      REHIRNVSSRERAVN--------HIEREQRVRESLYVLLLNKREENSLAL-AATEDN-AR
A0A3R5R2M8      AERMARTATREQELT--------PLVREHKVKEELYLILLSKEQENAMAL-AATEAS-AR
A0A411SUQ6      TERLTETAIKEQEII--------PLIREHKVKEELYLMLLSKEQENALAM-AVTESN-AR
A0A2N8HZF2      TERLTETAIREQEII--------PLVREHKVKEELYLMLLSKEQENALAM-AVTESS-AR
A0A354E720      TERLTETAIKEQEII--------PLIREHKVKEELYLMLLSKEQENALAM-AVTESN-AR
B2UPB6          TERLTETAIKEQEII--------PLIREHKVKEELYLMLLSKEQENALAM-AVTESN-AR
A0A2V6JLK8      RKRLEQINAKQLQTK-NLSANYARAKNAYIKEKTLFDGVRTRAQTQTMEM-AMPRFA-VS
A0A2W5Z1A5      RARLNEINEKQLSTK-NLSANYTRAKNNYIKEKLLLDSVRQRAQTQTMEM-AMPRVA-VS
A0A2V6EA09      DKRLAEINTRQLATK-TLSANYVRAKNAYIKERLLLDGIRMRAQTQTMEL-AMPRIA-VS
A0A2V6GQI7      DKRLSEINTRQLATK-TLSANYVRAKNAYIKERLLLDGIRMRAQTQTMEL-AMPRIA-VS
A0A3C1HEJ2      KAGLSGLESRRRDLD-AAAGEYGIIQNKLKFNRELYERIVKERQVTKVVQ-TLNKDP-VA
A0A522ULD9      EQELTTVKKTDIDAEREKYLPYNKAERKLDTERAVLNALKARLAQQGIEL-QIPRTP-VE
A0A1V6JU76      AANVKEWEDQQMEWN-KAKMQYDVLMRKAQSSKALFDTVLAKMKEIELVQ-RDKGNN-IR
A0A2A2XXW5      LRKYTESVERVFALD-EAKISYDIMEQQLKRVEGFYQTILTKAKDFDIGA-KDLLQN-MK
A0A6N6Q6V0      KGKFAEAEKEVTRLS-ELKVKYDVLSRQKERSEAMFQLILNKTKEYDLSS-KDIVQN-MT
A0A1Q6UHJ9      QKRLLEKKEQILDLG-RKAIVYKSIEREKQVAEGMHAAFIASMNVRLAQV-NLINEG-AN
A0A2V2BXR0      QKRLLEKKEQILDLG-RKAIVYKSIEREKQVAEGMHAAFIASMNVRLAQV-NLINEG-AN
A0A2D8V0G3      RVTYDEAQVAMNRLN-ELKVEYDNLVMEKEQSEQLYTAMLAKTKEMDLNT-KDMMQN-LE
A0A348S017      LDSLNARQADMNRLN-QLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLST-KDMMQN-LV
A0A3C1UUV7      LDSLNARQADMNRLN-QLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLST-KDMMQN-LV
A0A350I3V2      LDSLNARQADMNRLN-QLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLST-KDMMQN-LV
A0A520RGV5      LDSLNARQADMNRLN-QLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLST-KDMMQN-LV
A0A3D3XF90      LDSLNARQADMNRLN-QLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLST-KDMMQN-LV
A0A2D7B522      LDSLNARQADMNRLN-QLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLST-KDMMQN-LV
A0A356NIC2      LDSLNARQADMNRLN-QLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLST-KDMMQN-LV
A0A2N8HDG3      GKRLTATSGKARELT--------PLDREHRVKEELYLTLLSKELENDLTL-ALTESS-AR
A0A146GCJ0      EAALQEQEAKALELN-KVAIPYNVLQRDVESDRALYESVTKRLKETAITQ-GIEQAP-YR
A0A2T6D6H8      ETALQEQEERALELD-KVAIPYNVLQRDVESDRALYESVTKRLKETAITQ-GVEQPP-FR
A0A3D1TI55      EQEMDLLRNQDLERHREAFLPFERALRDRDAAKQVLTALEHRVAQEVIEL-EIPSTP-VE
A0A3E1ET42      QELTDTKKLSTVEDR-AKQSEYATEKTKFEMQRQLLQQVKEHSMKTAVDK-EVPRKP-IE
A0A2A2YDW8      NNRLVEVKDMSKENI-IAMTQIQNVHDEFTTQQKLLDEMKQKLTTDRINL-RQPQNI-IQ
A0A352XLN9      NNRLVEVKDMSKENI-IAMTQIQNVHDEFTTQQKLLDEMKQKLTTDRINL-RQPQNI-IQ
A0A3D0YP62      REVRDKKQDEGTDRA-RAFQEFNIARKDYETAQGIKDQMQIKYDIEKTKL-AIPPTN-II
A0A3D3DV47      REVRDKKQDEGTDRA-RAFQEFNIARKDYETAQGIKDQMQIKYDIEKTKL-AIPPTN-II
A0A2E5XJ49      RQVVEESRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKITNSARRIAL-KIPKNP-IT
A0A2E6SBY8      RKVVEESRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKITNSARRIAL-KIPKNP-IT
A0A2E5QMS4      KERVEERRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKNP-IT
A0A2E7YXQ3      KERVEERRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKNP-IT
A0A2E3H787      KDRVEDRRFDAVXKA-XQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKNP-IT
A0A2E7AGN1      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A2E7AKY7      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A3D4CU34      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A2E8M146      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A355S8S2      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A2D6DVN8      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A3C1W2R2      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A2E3NAY6      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A2E3II01      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A368B8C5      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A3R7RBB5      KDRVEDRRFDAVDKA-LQSQDYVEAKQDYETAKAMLSQMKLTNSARRIAL-KIPKTP-IT
A0A2A2QX62      KSRKESTNEDAIGKG-IANQTFIDAKNEFESALRLLETLQAKEIVERMQD-KVTDDP-II
A0A4Q3BWH6      KTRMDTKEDDAVKQG-IANQTFVDAKNDFETAQRLLEQLKVKLISEEMQT-KITEDP-II
A0A3N5WCF1      EVMKDESRDEAIKRG-LDAQDYVDAKREFETDQQLLETMKLKQMGETISR-KIPGES-VE
A0A4Q3C1K5      ENLKDDTREDAIKRG-LDNQDYVDAKRDFETDQELLQQMRLKQIDRNIRE-KMTNDS-IV
A0A3R8IT45      RAILEQIKTESLSTD-KEGVAYQMLERDFMMNEQLFLKTVERIKETELTN-TIEAQN-VQ
A0A2A2PYE8      EEDLAKRTEDSLQLD-RAALEYNDREREYRTNEKILDAIVARSRETSMTS-GITTQN-AR
A0A2T6CN73      QEELKRRTQDSLAVD-HAALDYENMQRELKIQEDILTTITARRTETSMSS-NIATQN-AR
A0A2G4G428      ISNLDKKDDEIARLT-VANNELERVDKEIKSQEDFLSRQKQSFEEAKIRS-STTGTT-TS
A0A6N6PCD8      KTALQEQQKGGVELS-RIAIQYDELRRQVDSDKLLYESVLTRAKETKVGE-AIENSN-IR
A0A139TV24      TRRLAATSGKARKLT--------PLNREHGVKEEYYLTLLTKEQENELAL-ETTPSS-AR
A0A2N8HT11      AKRLTATSGKARELT--------PLDREHRVKEELYLTLLSKELENDLTL-ALTESS-AR
R7DS70          AKRLTATSGKARELT--------PLDREHRVKEELYLTLLSKELENDLTL-ALTESS-AR
A0A2N8HNL6      AKRLTATSGKARELT--------PLDREHRVKEELYLTLLSKELENDLTL-ALTESS-AR
A0A6N6PAZ1      PDRQAHPEDYLHAARQLLLARIGVLESETQSATTVFNTMLTRIKESSVNQ-ESEESS-AE
A0A6I1K459      EQVLKEQEKKLNQMQ-SQRFELDRLQGDLSSQRKLYDAVIQRLREIDLTG-GMKKND-VR
A0A139TUL1      NRGLSDMASKDEGLV--------PLLREQKVMEELYLMLLKKREENALAL-ATTEPS-AR
A0A2N8HCB0      NRLLSDMASKDEGLV--------PLLREQKVMEELYLMLLKKREENALAL-ATTEPS-AR
A0A2N8HP04      NRLLSDMASKDEGLV--------PLLREQKVMEELYLMLLKKREENALAL-ATTEPS-AR
A0A2N8HRJ0      NRLLSDMASKDEGLV--------PLLREQKVMEELYLMLLKKREENALAL-ATTEPS-AR
A0A6N2U9Y7      NRLLSDMASKDEGLV--------PLLREQKVMEELYLMLLKKREENALAL-ATTEPS-AR
A0A366HAG0      EKHNKDTRAKSLDSQ-AGHHEYLAAKREWETLQQDTAKLKDTKAQKEIER-DGSKTP-IT
A0A2U8DZK4      KKQLEEAKASQIENASKRMRPFEEAMQKLDEATRLYTTFKLTLRQREIDY-NQPKRP-VE
A0A2T6DFL8      KSQLAQAKVDQILSARDRMRPFEEAAQKLEDETRLLTTLKLTLRQREIDF-QVPKKT-IE
A0A1D8AWD4      ERQLAQAKVDQILSARERMRPFEEATGKLDDEQRLLTTLKLTLRQREIDF-QVPKKT-IE
A0A4Q1C9S2      ERQLAQAKVDQILSARERMRPFEEATTKLEDEQRLLTTLKLTLRQREIDF-QVPKKT-IE
A0A178IH18      EKQLEEARARQITSSTDRMRPFEEAVRKLDDETRLLSTVKLVLRQREIDY-QVPKRT-IE
A0A2T6DT99      KNQLGQAKVDQILSARERMRPFEEALQKLEDDTRLLSTTKLTLRQREIDF-QVPKRT-IE
A0A1G3ZT33      ESQLAQARVDQILSARERMRPFEEAATRLDDEARLLTTLKLTLRQREIDF-QVPKRT-IE
A0A3E1E2T2      KRQLSQAKVDQILSARDRMRPFEEAAQKLEDETKLLTTLKLTLRQREIDF-QVPKRT-IE
B1ZMW1          KNQLAQAKVAQILSARERMRPFEEAAQKLEDETRLLTTLKLTLRQREIDF-QVPKRT-IE
A0A3M1I8A3      EENLRYWEQKQQEWN-KAKTTYDVLQRKADASRALFNMVLSRLSEAEVMQ-RDTANN-IN
A0A4V0XS84      RKALAEQEQKLLTMN-KLKIQHDSLNRELQQSKLLYEKITSRLKEIEVTG-NIKDKN-FT
A0A351WE84      EAELQAAKHSDIEDEKKKFLPFDRAERNVIIQRDILNALRARITQQGIEV-EVPRTP-VE
D5ENH7          SQRLAEKESELIGLS-KVRVEYNSLLRELEVQQSFFQALNSRMTQEQAQV-SLKEAS-AR
A0A0R2XQ77      SQRLAEKEAELIELS-KTRVEYSSLEREMDVQQGFLQALVGRMTQERAAV-NLKNPN-SR
A0A2E9IN28      SQRLAEKEQELIDLS-KTRIEYNSLLRDLSVQQNFFQALNSRMTTEKAQV-NLKNPN-AR
A0A6N4WTJ5      SQRLAEKEAELIELS-KTRVEYSSLLRELDVQQGFLQALVARMTQEKAQV-NLKNPN-SR
A0A1V5QDZ6      EKELEATRASDIDSERDRFLPFDKAEREVLVQRQILDALRARIAQEGIAV-EVPRTP-VE
A0A4Y8P964      EEEWKEAMVKVKKEG-RLLSQYALLKREADTDREMYTSLLKRLKETDITS-ALNSGN-IE
A0A3D4HF88      KAEISRKEKDLIGLA-KTKVEFNAIKTDLEANRDLHRAMVLRLNTEIAQV-NLKNPT-AR
A0A6N6ZHN8      KQRLATMEQEIIELD-RLRPEYNALVNDLQISKQMYDVYQSRLQQATVAN-RVETPN-AR
A0A6G6K641      EKEFQDQEKDTYTLG-KTQVEYDGLKRDVEQDIAVFNGVLSSLKQSDVSK-GFETDS-VE
A0A5B5WI95      SERLTKTATKEQEFT--------PLIREHKVKEELYLNLLSKEQENAMAL-AAAESS-AR
A0A2N8I9W1      TERLTETASREQEII--------PLIREHKVKEELYLMLLSKEQENALAM-AVTESS-AR
A0A4Q5IH27      TERLTETASREQEII--------PLIREHKVKEELYLMLLSKEQENALAM-AVTESS-AR
A0A2N8IBZ6      TERLTETASREQEII--------PLVREHKVKEELYLMLLSKEQENALAM-AVTESS-AR
A0A2N8IJW9      TERLTETASREQEII--------PLVREHKVKEELYLMLLSKEQENALAM-AVTESS-AR
A0A7G6DX28      TERLTETASREQEII--------PLVREHKVKEELYLMLLSKEQENALAM-AVTESS-AR
R6J100          TERLTETASREQEII--------PLVREHKVKEELYLMLLSKEQENALAM-AVTESS-AR
A0A1V6J089      DSELASIKATDIESESENYLPFDRAERNVAVNRDILTALRARITQTGIEV-EVPRTT-VD
A0A3C1BZR1      DEELSLIKTSDIESEGENYLPFDRAERNVSVNRDILTALRARITQTGIEV-EVPRTA-VE
A0A7C4KLL2      EKELKQLEADALRVS-QHAIQYSLLSRELEADRALFDSVLNRLKETSLAA-EQQPEK-LR
A0A1H6KPB7      KRAFDEVTEIVRNKT-QSDILVMSAIRDYRTEKSRYEDLENEYINQTMNR-RASRPI-IQ
A0A2E9ISN4      ESVLNNWRSEQFLSV-ANQSEYKQLSSKVAHFERKYNLVYGRL----LEN-TGTTEP-FF
B9XAX1          EAALKEVQMESLDLD-RKGIEYNVLMREVQSDLALYDSVLKRLKETDLSK-GLEKAS-IA
A0A5R8KKM9      QKTYQEQRSKSLEAD-TNNQEYLHAKEEWEGLNRDLWKLRDTLAQQQIER-DIPATP-FT
A0A139TS01      AKIVAQKEEDLRKHV-MKMPVYEQTSREYDTALDQLKTLDARYKDEIARL-RVPRES-VE
A0A3E1EJT7      RKALADQETKSLEID-KYAVEYDNLNRDFRVNEQLLESMMSRMRETSVTS-SIETES-AR
A0A7C3I5X9      AATVAEWENRQMEWN-RAKMEYDVLARKAETKKALYNAVLARMSEMDLTQ-KDRVNN-IR
A0A2D5WGA5      QRDVEEAKRRESDVR-EKGREYFDAKRELANTTRIRDTILFRIMQEEVDL-ALPKSS-TV
A0A2E7SSH2      QKSVDDAKAKEAKVQ-EEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDL-DLPKTS-SV
A0A349GXM8      ETAEYKWQAKNLTAS-QRQAEYSRLRSEVGRLAAHYNTLYTRLHDMRVSE-ELKSEH-FV
A0A4P5YP61      EAALKEQEALELVLN-KQKLEFDTLSREVESDRGLYENVMKKMKESQISK-ELQSDK-LR
A0A6B2LYM4      EDRLALNQQKLIELD-RIRPEYNALARDLAISQELYNHYYNRLQQAAVKV-TTEGQT-AR
A0A6D1VXB3      EEEWKEAMVKVKKEG-RLLSQYALLKREADTDREMYTGLLKRLKETDITS-ALNSGN-IE
I0JYY7          EEEWKEAMVKVKKEG-RLLSQYALLKREADTDREMYTGLLKRLKETDITS-ALNSGN-IE
A0A4R7S1J2      QEALAEQEKKSFELD-ALSIEYNVRKREMESDKAVYESVISRLKEVDLTK-GMDQSK-LK
A0A2A2XV69      EQRLRESQAKQQTSK-TRASGYYEAKNNYIQAKKILEAAEMRLSTETMQR-TMPQDP-TV
A0A651H7X9      RAALSNQESEALNLG-RLAVSYDSLANEAQVNELIYQSIVARMRETTMTS-TLESGN-AR
A0A4Y8P842      EEEWKRTLSKLRDEN-TLLAKYAMLKREADANQQMYMGLLKRLKETDITS-ALNSGN-IE
B3DZK9          EEEWKKTLLKLKDEN-SLLAKYAMLKREADANQQMYMGLLKRLKETDITS-ALNSGN-IE
A0A5E6MPC4      EQEFQKAMEKVRGET-KALSRYTILKREADTDREMYVGVLKRMRETDITS-AINASN-VE
A0A6N6PKP9      EAALRGQEGIALELS-QMAIPYKSLERDVEADRTLYDALVARLKETDVAQ-GVSRFA-VR
A0A6N6Z250      EDELARARQEQIDTAGEKYRVFDDAVKDLREAETVLRSMRLQLRQREIEL-QVPKRT-IE
A0A4V1SB02      TEQLKKAEADALDFD-KIAYPYNALKRDAETNRSLHDSIMTRMKEIDITS-TLAKSP-YK
A0A6N6QEJ2      EKLYDSAIEKTAQEN-KSFAPYAKAKRDLEFSMQVRQSMRLQLNQELING-QISKKS-SV
A0A3C1VB86      ETQMHEVETNAMKLS-DSAVRFNVLTRELRSDQALFDSVIGRLGETSVAG-QITAER-IR
A0A146G2Q9      QDKLDKVRSDWQTSK-TSSIGYYEAKNNWLQARKVLEAAQTRLATEKMEQ-TIPQSP-TT
A0A2T6D3Y2      QEKLTKVRADWQTSK-TSSIGYYEAKNNWLQARKVLEAAQTRLATEKMEQ-TIPQSP-TT
A0A6N6P5E3      EQKLSEAKTGQQDAK-TNSLHYQQAKNSYLKAKRILESAETRYSTEAMQR-TMPQSP-AT
A0A2D5VY59      TAAVENAKANDALKT-AKYRPYFTAKRDLENLSKISDMIMIRILQETVDA-SLPTES-IV
A0A2D8UZZ4      TAAVENAKANDALKT-AKYRPYFTAKRDLENLSKISDMIMIRILQETVDA-SLPTES-IV
A0A353DV86      TAAVENAKANDALKT-AKYRPYFTAKRDLENLSKISDMIMIRILQETVDA-SLPTES-IV
A0A2E5EPT8      MTQLDKAREQNRTAA-ENGQRYMDVQKKLERLERIRDTIELKIESEEIDA-DIGRTA-AV
A0A6J4HTK1      RRRLDDVNQKQLSAK-NTSANYTRAKNNYIKERALLDGVRMRTQTQTMEL-AMPRMA-VS
A0A6N6PHJ5      GKAVEDARLIDQDKL-TKTRPYFDKKRELEELNDLRRLITRKKNIEEVDL-KLPKSE-QV
A0A6M1RXR2      VAEFEEARRKDIEKV-EKSRPYFEKKRELENLVAFQRVLENKLKAERIDV-DLPKTA-MV
A0A7C3DXS4      VAEFEDARRKDIEKV-EKSRPYFEKKRELENLIAFQRLLENKLKAEKIDV-DLPKTA-MV
A0A2V2SDV4      EHEVDQAMTNDLVKA-VQSQPYFEAKRKVEEAETKLKLLTMKIYTEKLDN-ELPKTA-MA
A0A2V5PK75      QAQVDKATANDIGNS-KRWRPYFDKKRELDEQQRFRQILTMKIASEKIDQ-KLPKTL-MV
A0A1V6DME1      TRNVEEAMRVDIEKA-EKSRPYFEAKQRLEEVMRFRSILNLKLAQERIDV-DLPRTA-MV
A0A3D3DIJ3      QQEVGRATTNDVTQA-NLTRPYFEAKRALEELQRFRQVLDAKIAFEKIDV-ELPKTL-MV
A0A6I1K583      TQKLEEVKKQSREIA-ESRRVYQLAGQELERQQRLRETVENKIKVEELDR-DIKRTT-AV
A0A350EWA4      ERTIAAKEAEFRQKS-SNIMPYISAKEEYLRRRNVRDSVAMKIAQEKINY-AL-NST-FI
A0A5B5WZ91      EKIVAQKEEDLRHHV-MKMPVYEQTSREYDTALDQLKTLDARYKDEIARL-RVPRES-IE
A0A2N8HD92      EETVALKEKALQDHV-LKVPMYEQASRDYDAALDQLKDLSSRYTDEIARL-RVPRDA-VE
A0A2N8HIT2      EATVAQKEEALQKHV-LQVPMYEQASRDYDAALDQLKDLDSRYKDEIARL-RVPREA-IE
A0A354EBD3      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
A0A355VEB2      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
A0A2N8IMT3      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
R6K1U5          EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
A0A2N8IWC2      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREV-IE
A0A2N8I441      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREV-IE
A0A2N8I3A6      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
A0A410SCC4      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
A0A3R5VEW0      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
A0A411SSG2      EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
B2UKW3          EATVAQKEEDLQKHV-LQVPMYEQASRDYDAALDQLKELDSRYKDEIARL-RVPREA-IE
A0A7C3HWX0      LKRVEEGKARVAEEA-TQQREYYALKSDLEKEERVYDALYLRTLQEKFDA-KIPAGQ-SI
A0A1M6RLZ4      SKSKDSAKGERLATA-YDYTLFNALVQEYEQARAVLSQIKINLTNELLKD-NLMVDP-IR
A0A7C4KPD7      AKHLDEAKKKDREAG-AKLMEYYSAKEELETARTVKNALAMRIQAAILDN-QKIQYS-V-
A0A354T7G8      QTYNDDAKKELQDMQ-SLYNEYKTAKDEVTYLEDLLVKMRSRFFEEKAGI-ELVKSP-AT
A0A512MBZ2      QTYSKEADKEQISKG-ATYNDYKIAMDDVTYIEALLLKFRESYSENNASL-QLVKSP-AT
A0A2E8MEZ0      KQMVREKKDGTVDLS-MRQHQYNSAKEEYEQSRMMYREMSVKQQQQRVLL-KMPRTP-IT
A0A6B3LBV6      EESEDEKVEEYIAGA-LDNAEYEHYREEYRTEKELLKALTMSTYTKKIEE-NKALRP-VS
A0A2E3EC33      KETKERTEKASLKER-KDNVRYIEAKKEYELCKEMLNGMQSQLAKEKIDA-AGQRTP-MV
A0A2E4GN01      KETKERTEKASLKER-KDNVRYIEAKKEYELSKEMLNGMQSQLAKEKIDA-AGQRTP-MV
A0A1Z8XU55      RESKERTEKMSLQER-KQNVRYIEAKKEYELSKEMLNGMQSQLAKETIDK-EGQRTP-LV
A0A2E1RQR9      RESKERTEKMSLQER-KQNVRYIEAKKEYELSKEMLNGMXSQLAKETIDK-EGQRTP-LV
A0A2E3ISQ4      KESKERTEKMSLQER-KQNVQYIEAKKEYELSKEMLNGMQSQLAKETIDS-AGQRTP-LV
A0A2D6W6F4      KESKERTEKMSLQER-KQNVRYIEAKKEYELSKEMLNGMQSQLAKETIDS-AGQRTP-LV
A0A2D8Z5A8      KESKERTEKMSLQER-KQNVRYIEAKKEYELSKEMLNGMQSQLAKETIDS-AGQRTP-LV
A0A4Q2YKS3      EILKGEKKGEAVRQG-IDTQDYVDAKREFETDLELLQTMKLKYITEKASG-KLNGES-IA
A0A6N6P3T8      QANKNDKRGEAIKHG-LDAQDYVDAKRTFESEQEMLQQMKLKLIGEEISG-KMPNDS-IV
                                                                            

A0A2A2XVF1      LIE--E--PLVASLPSKPNRTRTLAMALIMAFFFAIGAVIFFDSLNSSLRSVDEAESFLH
A0A2V5UHJ2      VMG--K--ALPPGSPSYPDKRRSMLLGVLLGLAAGIGLAFFLEQLDNTLKSPEEAERYLR
A0A2V5PST3      ITQ--S--AERPEFPNSPNIPIDLTMYAAMGLFIGAGLAFFLEYLNSRLETPEHVWRAVD
A0A2V5PXM3      VIQ--H--AEVPELPAKPEKLRVILLGLLAGLGSGLLLALFLNSLDRSLKTVDQTEEYLG
A0A1V5QB01      IME--R--ARPASSPVTPRKLQSIFIAALIGLGVGLGLVFGLEYIDDSLRYPEEVTDLLG
A0A1J4XH17      IID--F--AVAPGHPAKPKKVIILALGLMGGIASGLGAVFAIAFFDDRIKTAFDIESVVG
A0A7C5LI63      VLE--P--AIVEPQPVYPKKTKGLMVAAFLGIGLGLALAFFVEYIDDSIKLAEEVERDLQ
A0A7C5P291      VLE--P--ALIEQDPVFPKKTKGLLLAAVFGIGLGLALAFFIEYIDDSIKLAEEVERDLQ
A0A139SU05      LLD--R--AQVSGRPYTPNFPKIVRMCVMMFCVVFFGTAFGLDFIDDRIKSAWDIENFLG
A0A139SPN4      LLD--R--AQVASHPYTPNFPKIIRVCVMMFLVVFFGTAFGLDFIDDRIKSAWDIENFLN
A0A1V6E7N1      PLD--R--AVPAGAPFTPDLARIIRTSSLLFVALFLAVAIGLNFIDDRIKSTWDVEHYIG
A0A2D9MYT1      VID--L--ATAQMHAIKPKKLLTAFLGIIGGLGAGFGLAFFVNFLDDSIKSQEDIETYLK
A0A290QGD9      V--IDRAFPSQPEQYVKPVILLNLGLGLVGGLGLGLAVAIFVAFIDDRVKSSFDIEGQMG
A0A1D8AS58      V--VDRASPALKP--ASPNVLLNLALGFLGGLALGTAFAFFVAYVDDRVKSSFDIESVIG
I6AQC1          ISPISRAVPAREDQYVEPRIVLNLAGGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESVVG
W0ITH7          IRPISRAVPAREDEYVEPRIVLNLAGGFILGIGFGLAFAFVVAFIDDRVKSSFDIESVVG
A0A258ANJ7      VHQ--L--AMVPGDPVSPNAKKVVGSSTAGGFMLGLAIIGLIVIQDRSIRSVDDARQKLR
A0A139TLN4      IVD--A--VRGGDGPLAPNVPKILLVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESLTD
A0A1G3ZFT0      ILS--Y--AKIPDSAVPIERAKLYGGSIIIGLIASIILIFGRKFIFPRIEDPYWTETRFN
A0A1Z8ZMT6      HED-----APRAWAPFSPNRKKIMIKNTLLGLCGGLALAFMFQFVDNKIHGVADVEQTFG
A0A2E8MCT7      HED-----APRAWAPFSPNRKKIMVKTTMLGLCGGLALAFMFQFVDNKIHGVADIEQTFG
A0A290Q2Z2      ILN--Y--AEPARRAAKPSWPLNIAFAVLFGGVLGIGTAVLIEFFDTSFRNVAELEGRLG
A0A2A2RGK2      IHE-----TAVGAGPIRPSATKKWIQSLLGGAAIGVGLALLMFFMDTSMKTVDQVESVTG
A0A2A2XXF7      IHE-----PAVGAAPIRPSATKTWIQNLLGGLAIGIGIAIAIFMLDTSIKTVDQVEQFTG
A0A2A2R5D6      IIS--K--AEPNDMPFRPNLTINLIASGVAGLVLGIVLAFFIEYLDTSVKTMDDVEKLLD
A0A3C1VJ32      VID--R--AEPGKAPVKPNKTLNITLGLIFGLIMGVGLAFFIEYLDTSVKTIDDVERTFQ
A0A2N9NTX7      IVD--R--AVAPLFASSPNKTLNIALGVIVGLVVGIGLAFFIEYLDTSVKTIDDVERSLQ
B9XK55          IVD--T--AEEIDKPVRPNKALNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERTLQ
A0A4P5YMI6      ITD--A--AELPVKATRPNIPLNIALGVIVGMIMGVGLAFFIEYLDTSVKTIDDVEAALQ
A0A2E6T482      IID--D--ADXPDKAIKPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERSLG
A0A3C0DQZ7      IID--D--ADVPDKAIKPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERSLG
A0A1Z9CBK5      IID--K--ADTPLNPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A2D6ZI96      IID--K--ADTPLNPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A358KGZ3      IID--K--ADTPLRAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALD
A0A2E9ZQX4      IID--K--ADTPLRAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALD
A0A3D5JZU0      IID--K--ADTPLRAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A2E6HCR0      IID--K--ADNPIRPVRPNIPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A1Z8WN04      IID--K--ADNPIRPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A2D7L1N4      IID--K--ADNPIRPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A2E2R937      IID--K--ADNPIRPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A520QQY4      IID--K--ADNPIRPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A2D5MR66      IID--K--ADNPIRPVRPNITLNIVLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALN
A0A2E0PDQ1      IID--K--ADNPIRPVRPNITLNIALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERALN
A0A2E2ZZP9      IID--K--ADNPIRPVRPNITLNIALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERALN
A0A7C4LRK7      MVD--V--AEPGLRPERPKKILNITLGVIAGLILGVGLAFFIEYLDTSVKTIDDVERALQ
A0A2A2RGF2      VTD--F--AEAAIKAAYPKMVLNVALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERALS
A0A2G4I5Y6      VTD--F--AEAAIKAAYPKMPLNVALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERALQ
A0A6N6PS97      IVN--R--AKPDETAVRPNVPLNITLGVIFGLIVGFGLAFFIEYLDTSVKTIDDVERALH
A0A3M1I883      VTD--P--AVPALKPVRPDLFLNLVLGVVFGLVMGVGLAFFIEYLDTSVKTIDDVERSLE
A0A1V6JZ45      IVD--P--AEPALRPVRPNIPLNIALGIMVGLVMGVGLAFFIEYLDTSVKTIDDVERSLS
A0A7C7Z746      IID--P--AVKSLKPDRPNIPLNLALGIVFGLVVGVGLAFFIEYLDTSVKTIDDVEAALQ
A0A520RRW5      IYD--P--AEPNPDPVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALD
A0A356NPK0      IYD--P--AEPNPDPVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALD
A0A2D7B5P5      IYD--P--AEPNPDPVRPKIFLNIALGVVVGLVVGIGXAFFIEYLDTSVKTIDDVEQALD
A0A3D3XGB5      IYD--P--AEPNPDPVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALD
A0A2V6F8A1      ITD--H--AEPGRKPVSPDFKLNIILGILVGLIVGVGLAFFIEYLDTSVKTIDDVERALQ
A0A2V5TNH4      ITD--Q--AEPGRKPVSPSFKLNIALGIIVGLIVGISLAFFIEYLDTSVKTIDDVERALQ
A0A2V5X5Q6      ITD--N--AEPGRRPVSPNFKLNIALGIIVGLIVGIGLAFFIEYLDTSVKTIDDVERALQ
A0A4P5QM05      IWQ--R--AQPGLYHEKPSVILYTIIAAIFGIVAGIGLAFFVEYLDTSVKTVDDIERHLS
A0A4Q3C001      IKE--K--AEPPMGYAKPPVKLYLTLAALIGLVVGVGLAFFIEYLDTSVKTLDDVERFLQ
B4DB23          IWE--K--AEKAEYPSEPNVPAYMGMAAIIGLVLGVGLAFFIDYLDTSVKTLDDVERYLQ
A0A6B3L938      VFE-----EASIPPPSKYKHLITLAAGTVLGSGVGVGLVFLLSLLDYKIYNVRTAEEATG
A0A2V5URB2      ILD--R--AEIPRQPSQPQKRRNLMLGALLGLMGGLGLALLLEHLNNTLRTPDEVERYLR
A0A2V2DJ66      VID--K--AGISPLPSSPNYILNFVGGFILALFGGIAMAFAVAFLDDRAKSAYDVETVIG
R7L5A9          IID--R--AAPALRPSSPNYVLNIILGIIAGIIGGICMAFLVAFLDDRAKSAYDIEAVIG
A0A5R8KA81      VVE--T--PQVAEDPSKPRKMRTWLIGLGVGLVFGLALAFGIHAFDDTLRTVDQAEAATD
A0A5B5WU87      MVD--G--VRGGAGPLAPNVPKILLVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESLTD
R7DZW0          MVD--G--VRGGNGPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTS
A0A2N8HID1      MVD--G--VRGGNGPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTS
A0A2N8HS06      MVD--G--VRGGNGPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTS
A0A6N2TNT9      MVD--G--VRGGNGPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTS
A0A3R5R2M8      VLE--S--AHGPDIPIAPQTVQYLAAGILGGGALCFFALLGIAMLNNKVKNKYDLPAQVR
A0A411SUQ6      VLE--T--AHGSNLPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANR
A0A2N8HZF2      VLE--T--AHGPNIPISPKTIKYVAGGTAGGVLLSILAFMGAAMLNNKVNNKHDLPAANR
A0A354E720      VLE--A--AHGPNLPISPKTIKYVAGGTAGGALLSILAFMGVAMLNNKVNNKHDLPSVNR
B2UPB6          VLE--T--AHGSNLPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANR
A0A2V6JLK8      VKQ--V--AEAPSYPARPRVGLNLTLGMLVGLVIGIGLAFFIEYLDTSVKTMDDVESLLG
A0A2W5Z1A5      VKQ--V--AEPPTFPARPRVGLNLALGGLIGLGIGLGLAFFIEYLDTSVKTMEDVETLLG
A0A2V6EA09      VKQ--V--AEPPNFPARPRVVLNLALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENLLG
A0A2V6GQI7      VKQ--V--AEPPNFPARPRVVLNLALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENLLG
A0A3C1HEJ2      IEQ--R--ATVPERPIKPNRKQVMLMGALAGLVSGLAVAFGLAATDSSLKSVEQAENFLK
A0A522ULD9      VID--P--AEPSNVPVSPNLFFNVLVGIIAGIVTGISLAFFLEYLDTSIKTVDDVEKYLG
A0A1V6JU76      VID--Y--AYAATMPVKPRVLLTLFLGAFGGLGLAIGLAFFVNFLDDSIKSQDDVELYLH
A0A2A2XXW5      VQD--P--AFAPLKPVSPNKPLIFVGSVVGGLAVALGLALFFNFLDDSIKSQEDVENILH
A0A6N6Q6V0      IID--H--ADLPSRPVKPNKPLIILASTMVGMMFALGFAFFINFLDDSVKSQDDVENFLH
A0A1Q6UHJ9      IID--K--ASPGIRPVRPNIPMNITLGILGALAGGVMVAFIVAFMDDRAKSAYDIESVVG
A0A2V2BXR0      IID--K--ASPGIRPVRPNIPMNITLGILGALAGGVMVAFIVAFMDDRAKSAYDIESVVG
A0A2D8V0G3      VVD--L--AYEPFNPIKPRKALTLLLGLVGGLGMGFAFAFFANYLDDSVKSQDDIESYLK
A0A348S017      VVD--K--AFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLR
A0A3C1UUV7      VVD--K--AFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLR
A0A350I3V2      VVD--K--AFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLR
A0A520RGV5      VVD--K--AFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLR
A0A3D3XF90      VVD--K--AFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLR
A0A2D7B522      VVD--K--AFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLR
A0A356NIC2      VVD--K--AFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLR
A0A2N8HDG3      VLE--A--AHGSDSPIAPNTRKSVLTAAAGGAIVCILGFLGLALLNNKVKNKKDLNAITS
A0A146GCJ0      VIE--E--PMVPNVPSKPRIKLILLVSLVAGLGLGVALVVVIDLLDASLRTVDEAESYLG
A0A2T6D6H8      IIE--E--PMVPSAPAKPRVKVILAAGLLLGVMAGVGLVFVLDLLDHSLRTVDEAESFLD
A0A3D1TI55      VVE--T--AVEPRSPFSPSWTLNILASIFGGLFLGVALAYFIEYMDTSVKTIDDVERFLG
A0A3E1ET42      VLQ--V--ATPEPRPSKPNMMLLFSIGAGLGLVLGLLLAFFLEYLDTSVKSLDDVERYLG
A0A2A2YDW8      LHE--E--PVVARFPSSPKVNIALILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERYLQ
A0A352XLN9      LHE--E--PVVARFPSSPKVNIALILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERYLQ
A0A3D0YP62      IHQ--I--PEINDIAVSPNIPLNLALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERFLQ
A0A3D3DV47      IHQ--I--PEINDIAVSPNIPLNLALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERFLQ
A0A2E5XJ49      ILE--E--PKQAKDAVYPKVSLFLGLGAAVGLIFGVAIAFFLEYLDTSVKSLEDVERYLQ
A0A2E6SBY8      ILE--D--PKQAKDAVYPKVSLFLGLGAAVGLIFGIAIAFFLEXLDTSVKSLEDVERYLQ
A0A2E5QMS4      ILE--D--PKMSKNPVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERYLQ
A0A2E7YXQ3      ILE--D--PKMSKNPVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERYLQ
A0A2E3H787      ILE--D--PKLGKXPVYPKVTLFLSLGAAVGLIFGVAIAFFLEYLDTSVKTLEDVERYLQ
A0A2E7AGN1      LLE--N--PKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQ
A0A2E7AKY7      LLE--N--PKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQ
A0A3D4CU34      LLE--N--PKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQ
A0A2E8M146      ILE--H--PKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQ
A0A355S8S2      ILE--H--PKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQ
A0A2D6DVN8      ILE--E--AKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQ
A0A3C1W2R2      ILE--E--AKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQ
A0A2E3NAY6      ILE--D--PKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQ
A0A2E3II01      ILE--E--AKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQ
A0A368B8C5      ILE--E--AKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQ
A0A3R7RBB5      ILE--E--AKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQ
A0A2A2QX62      IHE--E--PVVSQVPVSPNVTLNLALGTVVGLIFGIAVAFFLEYLDTSVKTLEDVERYLQ
A0A4Q3BWH6      MHE--E--PMISQVPVSPNVTLNLTLGAIVGMIFGIGVAFFLEYLDTSVKSLEDVERYLQ
A0A3N5WCF1      VHD--P--PVISNSPVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKTLEDVERYLQ
A0A4Q3C1K5      MHE--E--PQIAQGPVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKSLEDVERYLQ
A0A3R8IT45      VMPLARAVQPREDEYVEPRIVLNLAAGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESVVG
A0A2A2PYE8      IVDKAA--PSPESKPISPNVPLNLGLGIAGGLGLGLAFAFFVAFIDDRVKSSYDIEGVVG
A0A2T6CN73      IIDLAQ--ESPEGRPISPNVPLNLGLGVIGGLGLGLAFAFFVAFIDDRVKSSFDIEGVVG
A0A2G4G428      IKVLDS--PSVADRPTNKNFYLNAIIGLAMGAIFGLGLIILLGTFDDRIKSPKEVEIALG
A0A6N6PCD8      IVQ--D--PLVPKDPSKPKIPLILAVSVALGLMGGLALIILQQAFDTSLRSLDQAEVALD
A0A139TV24      VLE--T--AHGSNAPIAPNTRKFVLGGAAGGAALCLFAFMGVAILNNKVKNRHDLDAITT
A0A2N8HT11      VLE--S--AHGTDYPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTH
R7DS70          VLE--S--AHGTDYPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTH
A0A2N8HNL6      VLE--S--AHGTDYPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTH
A0A6N6PAZ1      VSN--L--ARVSGLPTAPIPSKILAGGTVGGFSGGILLVFLLLRLDNRFHTVSQIASDTN
A0A6I1K459      IIE--P--ANLPSSPIRPNKRMILIYSLAMGFGLSFGLVWLIAQLDTSIKSVDQAESLLG
A0A139TUL1      ILE--P--AFGSNSPVAPKLPLMTLGGMAGGAFLCLLSLMVSNALNTNVKDKNDLVGLVS
A0A2N8HCB0      ILE--P--AFGSNAPVAPKLFLMTVGGMTGGALVSLLALLAGNALNTKVRDKKDLAGLTD
A0A2N8HP04      ILE--P--AFGSNAPVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTD
A0A2N8HRJ0      ILE--P--AFGSNAPVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTD
A0A6N2U9Y7      ILE--P--AFGSNAPVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTD
A0A366HAG0      VYQ--P--AEPDTTPSKPNVKLNLLLGGIIGLMFGFGMAFFLEYLDTSVRTMDDLERTLS
A0A2U8DZK4      ILS--K--AEPKLEPERPSWPINITFAILFGVVLGIGTALLIDMFDASFRSVADVERRLQ
A0A2T6DFL8      ILN--T--AEAPRFPIRPSWPLNLTFAFVFGAVLAVGVAVVLEYFDTSFRNVADVEARLG
A0A1D8AWD4      ILN--T--AEPARFASRPNWPLNILFACVFGTILGVGAAVLLEYFDTSFRNVADVEGKLS
A0A4Q1C9S2      ILN--T--AEPASYASKPNWPLNILFAFVFGSILGVGAAVLLEYFDTSFRNVADVEGKLG
A0A178IH18      ILN--T--AEPARRAARPSWPLNLTFAFLFGAVLGVGAAVLIEFFDASFRGVADVERRLQ
A0A2T6DT99      ILN--V--AEPARRASRPNWSLNLVFAVLFGTILGVGTAVLVEYFDTSFRNVAEVEARLQ
A0A1G3ZT33      ILN--Q--AEPARRPSRPNWPLNIFFALLFGSLLGVGAAVLVEYFDTSFRNVADVEDHLK
A0A3E1E2T2      ILN--T--AEPARRPSRPSWPLNSAFAVLFGSILGVGAAVLLEYFDTSFRNVADVETRLK
B1ZMW1          ILN--T--AEPPRYPSRPNWTLSIALALVFGSLLGVGAALLLEYFDTSFRTVGDVETRLK
A0A3M1I8A3      IVD--P--ATIPTEFVKPNIPVVLTAGVLGGILLGIGLALFVNYLDDSIKSQDDVELHLQ
A0A4V0XS84      VVD--L--ADAPLKPIKPSVGLTLLLGILGGLAVAIGLAFFVDYVNDTIKTQEDIEAHLQ
A0A351WE84      VVE--P--AEPANKPSSPLVMLNILLSIFLGFGAGIGLAYFIEYLDTSVRTVDDVEQFLG
D5ENH7          IVDKAF--APLRH--SSPNILMNLAAGIFGGLVVGAGLVFLVAFLDDRVKSAFDIEGTIG
A0A0R2XQ77      VIDQAF--PPLRH--SSPNIAMNLAAGFFGGLAVGAGLIFAVAFLDDRVKSVFDIEGTIG
A0A2E9IN28      IVDEAF--PPSEDNPSSPNVTMNLAAGFFGGIAVGVGLIFVVAFLDDRVKSAFDIEGTIG
A0A6N4WTJ5      VIDEAL--PPLRH--SSPNIVMNLAAGLFGGVAAGVGLIFLVAFLDDRVKSAFDIEGTIG
A0A1V5QDZ6      IVD--P--AVPPSRPVSPNLFLNILLSVLLGLGAGVGLAYFIEYLDTSVKTVDDIERYLG
A0A4Y8P964      VVE--T--SAIPKIPIKPQKTRNILFALVFGSLASCGLALGLAKLDTRIRSKEEIEKEFG
A0A3D4HF88      IVD--K--ATPPIYPSHPKILLNLFLGFSGGIMLSLIFVGLLAFFDDRVKTAYDVEGILN
A0A6N6ZHN8      ILE--R--AGLPRRPVSPNVPFNMLLGLVLGGVLGVGLVVLLAVMDDKVKTAYDIESSLG
A0A6G6K641      IVE--P--AVASYAPVRPDKRKILLQWSIGGIVLGLGLTLGLHFLDNSIKAVAEAETMTG
A0A5B5WI95      VLE--T--AHGSDLPIAPKTEQYIAAGTLGGAALCFFAFLGLGMMNNKVKNKHDLTGQTR
A0A2N8I9W1      VLE--T--AHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNR
A0A4Q5IH27      VLE--T--AHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNR
A0A2N8IBZ6      VLE--T--AHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNR
A0A2N8IJW9      VLE--T--AHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNR
A0A7G6DX28      VLE--T--AHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNR
R6J100          VLE--T--AHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNR
A0A1V6J089      IVE--E--ADPPDRPSSPLVVLNIFLSVVLGLMAGTGLAFFVEYLDVSIKTVDEVEKYLG
A0A3C1BZR1      IIE--E--AEAPQRPSSPLVVLNIFLSVVLGLLAGTGLAFFVEYLDVSIKTVDEVEKYLG
A0A7C4KLL2      FIQ--P--AIPPAKPFLPNARRTYGFALLIGLAAGLALAFGSNALDTSFKSVEQAEAYLQ
A0A1H6KPB7      IHT--Q--AREAKVPSSPNVKMNLILGAVVGVVFGIGVAFLLNYMDTSVKTLEDVERNLN
A0A2E9ISN4      LRKIQA--PQASEKPIKPQVIKIIAASLFLGAAFGAGAILGLEYLKPNPINVTHLEREYH
B9XAX1          VVE--P--AMLPGATVKWSLLLVIGGAVVTGLLMSLCMIYLMSLFDSSIRTVDQAEFVLG
A0A5R8KKM9      IHK-SA--DEPETAPAKPNVKVNLALGAVVGLMFGFGLAFFLEYLDTTVKSIDEVERLLG
A0A139TS01      MYD--N--PLLPTAPYKPDVTLNLAVGAVAGLLLGMGLALLLEFMDTSVKTMEDVERALQ
A0A3E1EJT7      IID--R--AYEPGNPVSPKVFFNLTLGVLAGLVAGFSVAFLIATLDDRIKTISAVETLVD
A0A7C3I5X9      QVD--P--AVAPARPVKPNVPVTLAAGVVGGLAVALGLALFVNFLDDTIKSQDDVETYLR
A0A2D5WGA5      QII-DD--ADLPEKPVKPNIPLNIALGMVVGLILGVGLAFFLEYLDTSVKTIDDVEHALG
A0A2E7SSH2      EII-DK--ADIPLRPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALD
A0A349GXM8      PED-----ITTREDPVWPDPLKILMAALAGGLGLGFGLAFLAQVVDNKVQTIKDVENILG
A0A4P5YP61      VIQ--P--AIAPERPSKPQKVKIMAAAVLVGLMGGLMLALLLNQIDSSIKSVDQAEEFLQ
A0A6B2LYM4      IID--R--AVEPVRPFKPNITMNLAIGLVMGTGVGLGLVFLLAFLDDKVKSAFDIESTLG
A0A6D1VXB3      VIE--T--SPIPKVPVKPQKIRNILFALVFGSLTSCGLALGLAKLDTRIRSKEEIEKQLG
I0JYY7          VIE--T--SPIPKVPVKPQKIRNILFALVFGSLTSCGLALGLAKLDTRIRSKEEIEKQLG
A0A4R7S1J2      LHQ--L--PSAPGYQIWPQPSRIISSGVGGGFALAAGVIFLLFFMDRTIKSVDQAEKILR
A0A2A2XV69      IWE--R--AEPAEYPSRPRVLLNMILGVVVGIGFGVGLAFFIEYLDTSVKTLQDLESILK
A0A651H7X9      VVD--S--AMVPLRPASPNVRLNLGLGLLGGLGLGLGVAFFIAILDDRVKSAFDIESVVG
A0A4Y8P842      VVE--T--SPIPKKPVKPKKMLNLLLALFGGSIGGIGLALGLAMLDNRFRGKEEIEKFLK
B3DZK9          VVE--T--ASIPKKPVKPKKMLNLLLGLFGGSVGGIGLALGLALLDNRFRGKDDIEKFLK
A0A5E6MPC4      VLE--H--ASVPQSPSRPKKGRNLLLGFLGGGLGGLGLAVGLARFDTRLRGKEEVERTLG
A0A6N6PKP9      VAT--P--AMLPERPVKPKKSLTLIFGALGSLALAASGVLAAHTLDSSCKTVDQAERLLG
A0A6N6Z250      LLN--L--AAPPAKAGRPNWALNLSLAGFLGLLLGSAGALLLEKADGSFRQVEELEGRLE
A0A4V1SB02      VIE--E--PLINAAPVRPNPKKIMSIAGLLALLLGSGLVLLMDRLDSSIRTVDEAENILE
A0A6N6QEJ2      QVI-DR--ALQGLTPVRPNKPLFVAAGAIFGLLLGIGLAFFIEYIDTSVKTIDDVEQSLG
A0A3C1VB86      VIQ--P--ALVPELPASPKIKLIFALALFGGLAVGLGISFVLNSMDTSFRTVDEVEHYLA
A0A146G2Q9      IWE--S--AEISLVPAKPNVVLNMVLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESFLK
A0A2T6D3Y2      IWE--T--AEISLVPAKPNVVLNMVLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESFLK
A0A6N6P5E3      IWE--K--AEVSDFPAKPKVAQNMIVAVAVGLALGVGMAFLIEYLDTSVKTMHDIETALG
A0A2D5VY59      EIY-DP--AEPNDEPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALG
A0A2D8UZZ4      EIY-DP--AEPNDEPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALG
A0A353DV86      EIY-DP--AEPNDEPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALG
A0A2E5EPT8      EVI-DP--AEPAIRPAKPKVALNIALGVVLGAVMGIGMAFFIEYLDTSVKTIDDVEHTLQ
A0A6J4HTK1      VRQ--I--AEPPSFAARPRVTLNLALGALVGLVVGLGLAFFIEYLDTSVKTMEDVESLLG
A0A6N6PHJ5      VII-EK--ALASTKAVKPNKTLNIILGVVIGLIVGVGLAFFIEYLDTSVKTIDDVERTLQ
A0A6M1RXR2      TIV-EQ--AQPGLRPVQPKKGLNIALGVIFGLVVGVGLAFFIEYLDTSVKTIDDVERALG
A0A7C3DXS4      TIV-ER--AEPGLRPVQPNKTLNIMLGVIIGLVVGVGLAFFIEYLDTSVKTIDDVERALG
A0A2V2SDV4      FIT-TH--AVPDAHAVRPNKPFNIALGIIVGLVVGVGLAFFIEYLDTSVKTIDDVERSLN
A0A2V5PK75      EIM-DK--AEPGTKPVKPNKALNIALGIIIGLVVGIGLAFFIEYLDTSVKTIDDVERSLQ
A0A1V6DME1      EIV-DT--AKPGLRPVRPNKPLNIALGVIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQ
A0A3D3DIJ3      EVV-DR--AMPGLRPVRPNKPLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQ
A0A6I1K583      RVT-DF--AEPAVKPASPKVVLNIALGAFVGLLLGVGLAFFIEYLDTSVKTIDDVERALS
A0A350EWA4      VGVINP--AEEGLRPVRPNKTLNIALGVIVGLVVGVGLAFFIEYLDTSVKTIDDVERALQ
A0A5B5WZ91      MYD--N--PLLPSAPYKPDVTLNLAVGAVAGLLLGVGLALLLEFMDTSVKTMEDVERALQ
A0A2N8HD92      MYD--L--PEYPAVAYKPSITINLAVGASVGLLLGIGLALFLEFMDTSVKTMEDVERALQ
A0A2N8HIT2      MYQ--L--PTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A354EBD3      MYQ--L--PTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A355VEB2      MYQ--L--PTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A2N8IMT3      MYQ--L--PTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
R6K1U5          MYQ--L--PTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A2N8IWC2      MYQ--L--PTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A2N8I441      MYQ--L--PTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A2N8I3A6      MYQ--L--PTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A410SCC4      MYQ--L--PTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A3R5VEW0      MYQ--L--PTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A411SSG2      MYQ--L--PTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
B2UKW3          MYQ--L--PTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQ
A0A7C3HWX0      VAMVDK--AEPGLRPVRPNLMLNLALGSVFGLVMGIGLAFFIEYLDTSVKTIDDVERALQ
A0A1M6RLZ4      FSKVPS--EPAADEYVSPNWTLNMALGAVAGLVFGVGIAFALELMDTSVKTLEDVERFLQ
A0A7C4KPD7      VKMVDQ--AEPVLRPVRPKKILNISLGVVAGLVLGIGLAFFVEYLDTSVKTIDDVERALQ
A0A354T7G8      IYA--E--AEPEGKPAKPNVPLHLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERHLG
A0A512MBZ2      IYA--K--AEAEGRPSKPNISLNLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERFLG
A0A2E8MEZ0      LHE--R--AKKAKAPAYPNVTLNLLLGAGVGLIFGIGIAFLLEHLDTSVKSLEDVERYLQ
A0A6B3LBV6      VLD--K--AVAGDFPVTPNKPLNLILGSVLGLAFGLGIAFALEFMDTSVKTIDDVERYLN
A0A2E3EC33      IHEIAE--AADPGNPARPNIKLHLVLGATVGLVFGIGMAFFLEYLDTSVKSMDEVEHFLE
A0A2E4GN01      IHEKAE--ASDPDNPARPNIKLHLVLGAAVGLVFGIGMAFFLEYLDTSVKSLDEVEHFLE
A0A1Z8XU55      IHEQAE--PSDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLD
A0A2E1RQR9      IHEQAE--PSDVDKPARPNIKXHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLD
A0A2E3ISQ4      IHEEAE--PQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLD
A0A2D6W6F4      IHELAE--PQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLD
A0A2D8Z5A8      IHELAE--PQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLD
A0A4Q2YKS3      VHE--E--PVIAASPVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKSLEDVERYLQ
A0A6N6P3T8      VHD--E--PVSAQSPVSPNVTLNLILGAVIGLICGLGIAFFLEYLDTSVKTLEDVERYLQ
                                                                            

A0A2A2XVF1      LPALVGIPNRTLKGFSQLKQTLERECAALPGRLRQARNIGKPHKKKESSVLGDIQELIRP
A0A2V5UHJ2      LPSLAMVPDFVSVNGTNG------------------------------------------
A0A2V5PST3      LSTFGVVPDLASLNR---------------------------------------------
A0A2V5PXM3      IPVLSAIPKFASVAGDQRKL----------------------------------------
A0A1V5QB01      LPFFGLVPAASWDPEDLRTH----------------------------------------
A0A1J4XH17      LPLLGVIPRMANLNTQEKAK----------------------------------------
A0A7C5LI63      LPFLGMIPAAQWSPDDLTAH----------------------------------------
A0A7C5P291      LPFLGMVPAAQWNPDDLTAH----------------------------------------
A0A139SU05      TSLLGIVPDLASVKDEDKYT----------------------------------------
A0A139SPN4      TSLLGIVPDLNNVKDEDKYT----------------------------------------
A0A1V6E7N1      TTLLGIVPDLADTPDDDRYR----------------------------------------
A0A2D9MYT1      LPFLGYVPNIKTTSIIERDL----------------------------------------
A0A290QGD9      LHLLGIIPQVRKMPAPEKAQ----------------------------------------
A0A1D8AS58      LPLVGIIPEIKRMDQPDKAQ----------------------------------------
I6AQC1          LPLLGVIPQIKKMDQADKAQ----------------------------------------
W0ITH7          LPLLGVIPQIKKMDQADKAQ----------------------------------------
A0A258ANJ7      VPVLGMIANQRQIATA--------------------------------------------
A0A139TLN4      IPVYGVLPRKPRKLKNQEIV----------------------------------------
A0A1G3ZFT0      IPNLAIIPYSKEQFKDFQDL--------------------------------KRNVKKPI
A0A1Z8ZMT6      ISILSAIQKLPPEEELLEKM----------------------------------------
A0A2E8MCT7      ISILSAIQKLPPEEELLKEM----------------------------------------
A0A290Q2Z2      KPVLGVIPHSSEAVPPAKSG----------------------------------------
A0A2A2RGK2      VGVIAAIPKLSLNARA-SVL----------------------------------------
A0A2A2XXF7      VNVIAAIPKLSLSTRA-SVL----------------------------------------
A0A2A2R5D6      LPVLAVIPD--------GVG----------------------------------------
A0A3C1VJ32      APVLGVIPQ--------NIG----------------------------------------
A0A2N9NTX7      SPVLGVIPQ--------NVG----------------------------------------
B9XK55          APVLGVIPQ--------NVG----------------------------------------
A0A4P5YMI6      TSVLGVIPQ--------NVG----------------------------------------
A0A2E6T482      AAVLGVIPQ--------NVG----------------------------------------
A0A3C0DQZ7      AAVLGVIPQ--------NVG----------------------------------------
A0A1Z9CBK5      AAVLGVIPQ--------NVG----------------------------------------
A0A2D6ZI96      AAVLGVIPQ--------NVG----------------------------------------
A0A358KGZ3      AAVLGVIPQ--------NVG----------------------------------------
A0A2E9ZQX4      AAVLGVIPQ--------NVG----------------------------------------
A0A3D5JZU0      AAVLGVIPQ--------NVG----------------------------------------
A0A2E6HCR0      AAVLGVIPQ--------NVG----------------------------------------
A0A1Z8WN04      TAVLGVIPQ--------NVG----------------------------------------
A0A2D7L1N4      TAVLGVIPQ--------NVG----------------------------------------
A0A2E2R937      TAVLGVIPQ--------NVG----------------------------------------
A0A520QQY4      TAVLGVIPQ--------NVG----------------------------------------
A0A2D5MR66      TAVLGVIPQ--------NVG----------------------------------------
A0A2E0PDQ1      TAVLGVIPQ--------NVG----------------------------------------
A0A2E2ZZP9      TAVLGVIPQ--------NVG----------------------------------------
A0A7C4LRK7      APVLGVIPQ--------HVS----------------------------------------
A0A2A2RGF2      APVLAVIPQ--------NVG----------------------------------------
A0A2G4I5Y6      APVLAVIPQ--------NVG----------------------------------------
A0A6N6PS97      SAVLGVIPQ--------NVG----------------------------------------
A0A3M1I883      ATVVGVIPQ--------NIG----------------------------------------
A0A1V6JZ45      APVLGVIPQ--------NVG----------------------------------------
A0A7C7Z746      APVLGVIPQ--------NVG----------------------------------------
A0A520RRW5      APVLGVIPQ--------NVH----------------------------------------
A0A356NPK0      APVLGVIPQ--------NVH----------------------------------------
A0A2D7B5P5      APVLGVIPQ--------NVH----------------------------------------
A0A3D3XGB5      APVLGVIPQ--------NVH----------------------------------------
A0A2V6F8A1      APVLGVIPQ--------NVG----------------------------------------
A0A2V5TNH4      APVLGVIPQ--------NVS----------------------------------------
A0A2V5X5Q6      APVLGVIPQ--------NVS----------------------------------------
A0A4P5QM05      LPVLAVIPT--------EIV----------------------------------------
A0A4Q3C001      IPVLAVVPK--------GVS----------------------------------------
B4DB23          IPVLAVIPN--------NVS----------------------------------------
A0A6B3L938      MACLAAIPLGSDFRRSGQKFES--------------------------------------
A0A2V5URB2      LPNLAIVPDFYRLPNHRNGQ-----------------KSLIHYDKYNKVKFDNKLCLPSK
A0A2V2DJ66      LPLLGVIPRIKRLSSAEKAQ----------------------------------------
R7L5A9          LPLLGVIPRIKRLNSAEKAQ----------------------------------------
A0A5R8KA81      VPVIAALPQSSKFKSPAHSL----------------------------------------
A0A5B5WU87      IPVYGVLPRKPRKLKNQEIV----------------------------------------
R7DZW0          IPVYGELPRKPRKLKNQEIV----------------------------------------
A0A2N8HID1      IPVYGELPRKPRKLKNQEIV----------------------------------------
A0A2N8HS06      IPVYGELPRKPRKLKNQEIV----------------------------------------
A0A6N2TNT9      IPVYGELPRKPRKLKNQEIV----------------------------------------
A0A3R5R2M8      QPVIAELPKMSKKERK-NNT----------------------------------------
A0A411SUQ6      QPVIAELPQMSKKESK-NTK----------------------------------------
A0A2N8HZF2      QPVIAELPQMNKKESR-NTG----------------------------------------
A0A354E720      QPVIAELPQMSKKESR-NTK----------------------------------------
B2UPB6          QPVIAELPQMSKKESK-NTK----------------------------------------
A0A2V6JLK8      VPVLAIIP-------K-NIN----------------------------------------
A0A2W5Z1A5      VPVLAIIP-------K-NVT----------------------------------------
A0A2V6EA09      LPVLAIIP-------K-NIK----------------------------------------
A0A2V6GQI7      LPVLAIIP-------K-NIK----------------------------------------
A0A3C1HEJ2      VPLLGAIPQMKELQSSDSSQ----------------------------------------
A0A522ULD9      LPVLGAIP-------Q-RVK----------------------------------------
A0A1V6JU76      LPFLGYIPNIKTNSVVESGL----------------------------------------
A0A2A2XXW5      LPFLGYIPNIKSISIVERDL----------------------------------------
A0A6N6Q6V0      LQFLGYIPNIKSASVVERDL----------------------------------------
A0A1Q6UHJ9      LPLLGVIPRIRRLNSSQKAQ----------------------------------------
A0A2V2BXR0      LPLLGVIPRIRRLNSSQKAQ----------------------------------------
A0A2D8V0G3      LNFLGYIPNIKSQSLVERDL----------------------------------------
A0A348S017      LNFLGYIPNIKTNSLVERDM----------------------------------------
A0A3C1UUV7      LNFLGYIPNIKTNSLVERDM----------------------------------------
A0A350I3V2      LNFLGYIPNIKTNSLVERDM----------------------------------------
A0A520RGV5      LNFLGYIPNIKTNSLVERDM----------------------------------------
A0A3D3XF90      LNFLGYIPNIKTNSLVERDM----------------------------------------
A0A2D7B522      LNFLGYXPNIKTNSLVERDM----------------------------------------
A0A356NIC2      LNFLGYIPNIKTNSLVERDM----------------------------------------
A0A2N8HDG3      LPVVAELPAMTKKEQR-QVA----------------------------------------
A0A146GCJ0      LPALTAVPEQRSKSVGEQVAEAWNDKTLGSLPKDLAQKQVLEPLRRSLNRKEREAQLKKH
A0A2T6D6H8      LPALAAIPEKRIETVLNQVGEAIREKKLSKIPQEIAGKGVVEPVRKFLNAREATAQAKRH
A0A3D1TI55      LPVLGIIP-------Q-RVR----------------------------------------
A0A3E1ET42      VPVLAVIP-------K-DVG----------------------------------------
A0A2A2YDW8      VPVLAVIP-------K-DIG----------------------------------------
A0A352XLN9      VPVLAVIP-------K-DIG----------------------------------------
A0A3D0YP62      VPVLAVIP-------K-DVG----------------------------------------
A0A3D3DV47      VPVLAVIP-------K-DVG----------------------------------------
A0A2E5XJ49      VPVLAVIP-------K-DVG----------------------------------------
A0A2E6SBY8      VPVLAVIP-------K-DVG----------------------------------------
A0A2E5QMS4      VPVLAVIP-------K-DVG----------------------------------------
A0A2E7YXQ3      VPVLAVIP-------K-DVG----------------------------------------
A0A2E3H787      IPVLAVVP-------T-DVN----------------------------------------
A0A2E7AGN1      VPVLAVIP-------T-DVG----------------------------------------
A0A2E7AKY7      VPVLAVIP-------T-DVG----------------------------------------
A0A3D4CU34      VPVLAVIP-------T-DVG----------------------------------------
A0A2E8M146      VPVLAVIP-------T-DVG----------------------------------------
A0A355S8S2      VPVLAVIP-------T-DVG----------------------------------------
A0A2D6DVN8      VPVLAVIP-------T-DVG----------------------------------------
A0A3C1W2R2      VPVLAVIP-------T-DVG----------------------------------------
A0A2E3NAY6      VPVLAVVP-------T-DVG----------------------------------------
A0A2E3II01      VPVLAVIP-------T-DVG----------------------------------------
A0A368B8C5      VPVLAVIP-------T-DVG----------------------------------------
A0A3R7RBB5      VPVLAVIP-------T-DVG----------------------------------------
A0A2A2QX62      VPVLAVIP-------K-DVG----------------------------------------
A0A4Q3BWH6      VPVLAVIP-------K-DVG----------------------------------------
A0A3N5WCF1      VPVLAVIP-------K-DVG----------------------------------------
A0A4Q3C1K5      VPVLAVIP-------K-DVG----------------------------------------
A0A3R8IT45      LPLLGVIPQIKKMDQADKAQ----------------------------------------
A0A2A2PYE8      LPLIGIIPQIKRMDQPDKAQ----------------------------------------
A0A2T6CN73      LPLIGIIPEIKKLEQVEKAQ----------------------------------------
A0A2G4G428      IPILGTIPQITKSVGPERAL----------------------------------------
A0A6N6PCD8      LASLAAVP-------EIDSK----------------------------------------
A0A139TV24      LPVIAELPAMSKKEQK-QVS----------------------------------------
A0A2N8HT11      LPVVAELPAMTKKEQR-QVA----------------------------------------
R7DS70          LPVVAELPAMTKKEQR-QVA----------------------------------------
A0A2N8HNL6      LPVVAELPAMTKKEQR-QVA----------------------------------------
A0A6N6PAZ1      VTVLGAIADIKLHHLEVAEQ----------------------------------------
A0A6I1K459      LPVLGAVPKNKLVKDG-KSR----------------------------------------
A0A139TUL1      LPLAGELPLLSGKERK-KLP----------------------------------------
A0A2N8HCB0      LPLAGALPLLSGKERA-KLP----------------------------------------
A0A2N8HP04      LPLAGELPLLSGKERK-KLP----------------------------------------
A0A2N8HRJ0      LPLAGELPLLSGKERK-KLS----------------------------------------
A0A6N2U9Y7      LPLAGELPLLSGKERK-KLP----------------------------------------
A0A366HAG0      VPVLAVVP-------K-GVG----------------------------------------
A0A2U8DZK4      RPVLGVIPSSLTARKP--------------------------------------------
A0A2T6DFL8      LPVLGVIPFAQDPLAR--------------------------------------------
A0A1D8AWD4      LPVLGVIPHMAEAGEL--------------------------------------------
A0A4Q1C9S2      LPVLGVIPHLPEPPAL--------------------------------------------
A0A178IH18      RPVLGVIPASATARRP--------------------------------------------
A0A2T6DT99      RPVLGVIPNAPDPLKK--------------------------------------------
A0A1G3ZT33      LPVLSVIPLSRTPARL--------------------------------------------
A0A3E1E2T2      LPVLGVIPFHRDPLDE--------------------------------------------
B1ZMW1          LPVLGVIPRQTDPLGG--------------------------------------------
A0A3M1I8A3      MPFLGYVPSIKSAKEV-ERY----------------------------------------
A0A4V0XS84      VPFLGYVPSIKRESVV-ERD----------------------------------------
A0A351WE84      LPVLGVIP-------Q-KIR----------------------------------------
D5ENH7          LPLLGVVPRIKKLDSN-SKA----------------------------------------
A0A0R2XQ77      LSMLGVVPRIKKLDSS-SKA----------------------------------------
A0A2E9IN28      LPMLGVVPRIKKLDSN-TKA----------------------------------------
A0A6N4WTJ5      LPMLGVVPRIKKLDSN-SKA----------------------------------------
A0A1V5QDZ6      LSVLGIIP-------Q-KVR----------------------------------------
A0A4Y8P964      LPVLGSVPDVEFLQGE-GID----------------------------------------
A0A3D4HF88      LPLIGVVAKLQELSAK-EKA----------------------------------------
A0A6N6ZHN8      LPLIGLIPRISRIDAL-EKA----------------------------------------
A0A6G6K641      LPVLTAII-------A-KKT----------------------------------------
A0A5B5WI95      QPIIAELPRMSKKERK-NTS----------------------------------------
A0A2N8I9W1      QPVIAELPQMNKKESR-NTG----------------------------------------
A0A4Q5IH27      QPVIAELPQMNKKESR-NTG----------------------------------------
A0A2N8IBZ6      QPVIAELPQMNKKESR-NTG----------------------------------------
A0A2N8IJW9      QPVIAELPQMNKKESR-NTG----------------------------------------
A0A7G6DX28      QPVIAELPQMNKKESR-NTG----------------------------------------
R6J100          QPVIAELPQMNKKESR-NTG----------------------------------------
A0A1V6J089      LPVLAVIP-------Q-QSR----------------------------------------
A0A3C1BZR1      LPVLAVIP-------Q-QSR----------------------------------------
A0A7C4KLL2      LPVFTAIPKLKEVRLG-ETR----------------------------------------
A0A1H6KPB7      LPVLGVIP-------Q-DIG----------------------------------------
A0A2E9ISN4      IDLLGQIR-------RWDLY----------------------------------------
B9XAX1          LPVLAAIPVAKKGRNG-TPA----------------------------------------
A0A5R8KKM9      VPVLAVIP-------K-NVG----------------------------------------
A0A139TS01      VPVLGIIP-------K-NVP----------------------------------------
A0A3E1EJT7      LPLLGVIPEVKRMDQP-DKA----------------------------------------
A0A7C3I5X9      LPFLGYVP-------NIKSN----------------------------------------
A0A2D5WGA5      AAVLGVIP-------Q-NVG----------------------------------------
A0A2E7SSH2      AAVLGVIP-------Q-NVG----------------------------------------
A0A349GXM8      VRFLGGIPYWAHSQLESSIR----------------------------------------
A0A4P5YP61      LPVLSAIPQITAFG-N-NRG----------------------------------------
A0A6B2LYM4      VPLVGIVPHIFSIDSQ-EKA----------------------------------------
A0A6D1VXB3      IPVLGSIPDIELIKGE-GID----------------------------------------
I0JYY7          IPVLGSIPDIELIKGE-GID----------------------------------------
A0A4R7S1J2      LPVLATINKAKYS--D-EAG----------------------------------------
A0A2A2XV69      IPVLAVIP-------K-EIS----------------------------------------
A0A651H7X9      LPLIGLIPRLRKMEVH-EKA----------------------------------------
A0A4Y8P842      IPVLGVIPDIEKLKKS-HPE----------------------------------------
B3DZK9          IPVLGVIPDIEKLKKH-QPE----------------------------------------
A0A5E6MPC4      LPVLGQVPDTEKLKAK-GID----------------------------------------
A0A6N6PKP9      LSSLAAIPRQARS--V-VAG----------------------------------------
A0A6N6Z250      VPVLGVVA-------R-EAR----------------------------------------
A0A4V1SB02      LGVLAAVPDGDSSKIP-KGG----------------------------------------
A0A6N6QEJ2      APVLGVIP-------Q-NVG----------------------------------------
A0A3C1VB86      LPVLGAIPKLPKTEGK-GND----------------------------------------
A0A146G2Q9      VPVLAVIP-------K-GIS----------------------------------------
A0A2T6D3Y2      VPVLAVIP-------K-GIS----------------------------------------
A0A6N6P5E3      YQVLAIIP-------K-DVA----------------------------------------
A0A2D5VY59      APVLGVIP-------Q-NVQ----------------------------------------
A0A2D8UZZ4      APVLGVIP-------Q-NVQ----------------------------------------
A0A353DV86      APVLGVIP-------Q-NVQ----------------------------------------
A0A2E5EPT8      APVLAVIP-------Q-NVG----------------------------------------
A0A6J4HTK1      VPVLAIIP-------K-NIK----------------------------------------
A0A6N6PHJ5      SPVLGVIP-------Q-NVG----------------------------------------
A0A6M1RXR2      APVLGVIP-------Q-NVG----------------------------------------
A0A7C3DXS4      APVLGVIP-------Q-NVG----------------------------------------
A0A2V2SDV4      SPVLGVIP-------Q-NVG----------------------------------------
A0A2V5PK75      SPVLGVIP-------Q-NVG----------------------------------------
A0A1V6DME1      SPVLGVIP-------Q-NVG----------------------------------------
A0A3D3DIJ3      CPVLGVIP-------Q-NVG----------------------------------------
A0A6I1K583      APVLAVIP-------Q-NVG----------------------------------------
A0A350EWA4      AHVLGVIP-------Q-NVG----------------------------------------
A0A5B5WZ91      VPVLGIIP-------K-NVP----------------------------------------
A0A2N8HD92      VPVLGIIP-------K-NVP----------------------------------------
A0A2N8HIT2      VPVLGIIP-------K-NVP----------------------------------------
A0A354EBD3      VPVLGIIP-------K-NVP----------------------------------------
A0A355VEB2      VPVLGIIP-------K-NVP----------------------------------------
A0A2N8IMT3      VPVLGIIP-------K-NVP----------------------------------------
R6K1U5          VPVLGIIP-------K-NVP----------------------------------------
A0A2N8IWC2      VPVLGIIP-------K-NVP----------------------------------------
A0A2N8I441      VPVLGIIP-------K-NVP----------------------------------------
A0A2N8I3A6      VPVLGIIP-------K-NVP----------------------------------------
A0A410SCC4      VPVLGIIP-------K-NVP----------------------------------------
A0A3R5VEW0      VPVLGIIP-------K-NVP----------------------------------------
A0A411SSG2      VPVLGIIP-------K-NVP----------------------------------------
B2UKW3          VPVLGIIP-------K-NVP----------------------------------------
A0A7C3HWX0      APVLGVIP-------Q-NVG----------------------------------------
A0A1M6RLZ4      VPVLAVIP-------R-DVG----------------------------------------
A0A7C4KPD7      APVLGVIP-------Q-NVG----------------------------------------
A0A354T7G8      VPVLAVVP-------K-GVG----------------------------------------
A0A512MBZ2      VPVLAVVP-------K-NVG----------------------------------------
A0A2E8MEZ0      VPVLAVIP-------K-DVG----------------------------------------
A0A6B3LBV6      VPVLAVIP-------K-DVG----------------------------------------
A0A2E3EC33      LPVLAVIP-------Q-AVG----------------------------------------
A0A2E4GN01      LPVLAVIP-------Q-DVG----------------------------------------
A0A1Z8XU55      LPVLAVIP-------K-DVG----------------------------------------
A0A2E1RQR9      LPVLAVIP-------K-DVG----------------------------------------
A0A2E3ISQ4      LPVLAVIP-------K-DIN----------------------------------------
A0A2D6W6F4      LPVLAVIP-------K-DIN----------------------------------------
A0A2D8Z5A8      LPVLAVIP-------K-DIN----------------------------------------
A0A4Q2YKS3      VPVLAVIP-------K-DVG----------------------------------------
A0A6N6P3T8      VPVLAVIP-------K-DIG----------------------------------------
                                                                            

A0A2A2XVF1      APIARTDSEKYPIATIEE--------------------PESGLAEAYRTLRVSIS--ML-
A0A2V5UHJ2      --SYVSRLLKSAQAELPVSARKAAKAKHADSSVLLDHHSLSVVAEAYRSFRSALL--LS-
A0A2V5PST3      --PLISYQPVSSGKPKRIAQLQAQQKTSNGKDLIVSYHPLSIFSESYRTIRTALL--LS-
A0A2V5PXM3      --INAED-------------------------------AESGEAEAFRTLRTAIS--ML-
A0A1V5QB01      --ILSNID------------------------------QKSGMVEAYRNVRSALL--FS-
A0A1J4XH17      --TVVKG-------------------------------TEKTVLESFRAIDSLLR--LN-
A0A7C5LI63      --RLDRVK------------------------------QQGGVAEAYRVVRSAII--FS-
A0A7C5P291      --RLDRLK------------------------------QQGGVAEAYRVVRSAII--FS-
A0A139SU05      --LLLKD-------------------------------THPTAVEAFMGIYGAAK--TH-
A0A139SPN4      --LLLKD-------------------------------TNPTAVEAFTGIYSAAK--TH-
A0A1V6E7N1      --MVLDH-------------------------------RQSPGLEAFLSIYSSVK--IH-
A0A2D9MYT1      --QAHLH-------------------------------PQSNSAEAFRTVRAAIS--LS-
A0A290QGD9      --VVANH-------------------------------ADRQVSEAFLTLHSSLR--LK-
A0A1D8AS58      --IVINN-------------------------------QDKQVVESFLTLHSSLR--LK-
I6AQC1          --VALNN-------------------------------ADRQVAEAFLTLHSSLR--LR-
W0ITH7          --VALNN-------------------------------ADRQVAEAFLTLHSSLR--LR-
A0A258ANJ7      --SEQQKGHDFTQGLTPALI------------------AHKAVAESFREFRAIIAR----
A0A139TLN4      --VNLEE-------------------------------PSEL-SESFPLLAERLVSLAD-
A0A1G3ZFT0      MLLSQKD-------------------------------PRNLSIESLRSLRTSLQ--VN-
A0A1Z8ZMT6      --ESLRDLPVSMKHISPTLAVPGWK-------------TDFVHSEMFRVLRASIS--LL-
A0A2E8MCT7      --ESIRDLPVSMKHICPTLAVPGWK-------------TDFVHSEMFRVLRASIS--LL-
A0A290Q2Z2      --IVEDP-------------------------------AE---LEPFRVLHTNLN--LAL
A0A2A2RGK2      --VTNEE-------------------------------RSGIVAESFRSLRASLT--LH-
A0A2A2XXF7      --VTNEE-------------------------------RSGIVAESFRSLRASLT--LH-
A0A2A2R5D6      --PLIRE---------GADS------------------PH---AEGYRILRAKID--LN-
A0A3C1VJ32      --YLLEE---------GAES------------------KH---AEAYRVLRTNLL--FS-
A0A2N9NTX7      --LLVDE---------GVES------------------PH---AEAYRVLRTNLL--FS-
B9XK55          --LLLDE---------GAES------------------PH---AEAYRVLRTNLM--FS-
A0A4P5YMI6      --SLLDE---------GVDS------------------PH---AEAYRVLRTNLM--FA-
A0A2E6T482      --SLLEE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A3C0DQZ7      --SLLEE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A1Z9CBK5      --SLVDE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A2D6ZI96      --SLVDE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A358KGZ3      --SLMDE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A2E9ZQX4      --SLMDE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A3D5JZU0      --SLMDE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A2E6HCR0      --SLVDE---------GEES------------------PH---AEAYRVLRTNIL--FAA
A0A1Z8WN04      --SLVDE---------GEES------------------PH---AEAYRVLRTNIL--FAG
A0A2D7L1N4      --SLVDE---------GEES------------------PH---AEAYRVLRTNIL--FAG
A0A2E2R937      --SLVDE---------GEES------------------PH---AEAYRVLRTNIL--FAG
A0A520QQY4      --SLVDE---------GEES------------------PH---AEAYRVLRTNIL--FAG
A0A2D5MR66      --SLVDE---------GEES------------------PH---AEAYRVLRTNIL--FAG
A0A2E0PDQ1      --SLVDE---------GEES------------------PH---AEAYRVLRTNIL--FAG
A0A2E2ZZP9      --SLVDE---------GEES------------------PH---AEAYRVLRTNIL--FAG
A0A7C4LRK7      --NLLDE---------GPES------------------PH---AEAYRVLRTNLL--FS-
A0A2A2RGF2      --ALLDE---------GMDS------------------PH---AEAYRVLRTNVL--FT-
A0A2G4I5Y6      --ALLDE---------GMDS------------------PH---AEAYRVLRTNVL--FT-
A0A6N6PS97      --SLLEE---------GADS------------------PH---AEAYRVLRTNML--FG-
A0A3M1I883      --LLIKE---------GPDS------------------PH---AEAYRVLRTNVL--FS-
A0A1V6JZ45      --ILVNE---------GPDS------------------PH---GEAYRVLRTNIL--FS-
A0A7C7Z746      --SLLDE---------GPDS------------------PH---AEAYRVLRTNMT--FS-
A0A520RRW5      --SLLME---------GPDS------------------PH---AEAYRVLRTNIL--FS-
A0A356NPK0      --SLLME---------GPDS------------------PH---AEAYRVLRTNIL--FS-
A0A2D7B5P5      --SLLME---------GPDS------------------PH---AEAYRVLRTNIL--FS-
A0A3D3XGB5      --SLLME---------GPDS------------------PH---AEAYRVLRTNIL--FS-
A0A2V6F8A1      --SLIQE---------GPES------------------PH---AEAYRVLRTNVL--FS-
A0A2V5TNH4      --SLILE---------GSES------------------PH---AEAYRVLRTNVL--FS-
A0A2V5X5Q6      --SLILE---------GPES------------------PH---AEAYRVLRTNVL--FS-
A0A4P5QM05      --ILLQQ---------KRDT------------------AD---AEAYRILKGNIE--LN-
A0A4Q3C001      --ALMKE---------SNDS------------------QH---AEAYRILRANVE--FN-
B4DB23          --ILMKN---------AGDT------------------SD---AEAYRILRAAVE--FN-
A0A6B3L938      --VIAIE-------------------------------PKTVHAESIRNLRASIR--LL-
A0A2V5URB2      KSSLSDR-------------------------------RISVVTESYRKLRAAIF--LS-
A0A2V2DJ66      --VAASN-------------------------------ADRASTEAFRTLYSTLK--IN-
R7L5A9          --VAASN-------------------------------ADRATTEAFRSLHSTLK--VN-
A0A5R8KA81      --VMVKD-------------------------------PNSPIAESFRILRSSLE--LM-
A0A5B5WU87      --VNLEE-------------------------------PSEL-SESFPLLAERLVSLAE-
R7DZW0          --VNLEE-------------------------------PSEL-SECFPLLAERMVALSD-
A0A2N8HID1      --VNLEE-------------------------------PSEL-SECFPLLAERMVALSD-
A0A2N8HS06      --VNLEE-------------------------------PSEL-SECFPLLAERMVALSD-
A0A6N2TNT9      --VNLEE-------------------------------PSEL-SECFPLLAERMVALSD-
A0A3R5R2M8      --PLIRN-------------------------------DHSVIAECFHILRNNVDSLLP-
A0A411SUQ6      --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
A0A2N8HZF2      --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
A0A354E720      --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
B2UPB6          --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
A0A2V6JLK8      --LLHKA---------EGDT------------------PD---AEAYRILRTNIE--FN-
A0A2W5Z1A5      --LLHHE---------IGDS------------------PD---AEAYRILRTNIE--FN-
A0A2V6EA09      --LLHRE---------AGDT------------------PD---AEAYRILRTNIE--FN-
A0A2V6GQI7      --LLHRE---------AGDT------------------PD---AEAYRILRTNIE--FN-
A0A3C1HEJ2      --VIMAD---------PRLV------------------AG---AEAFRSLRTTLS--ML-
A0A522ULD9      --PLHEE---------GPDS------------------PH---AEAYRVLRANIQ--F--
A0A1V6JU76      --QAHLH-------------------------------PQSNAAESFRTVRAAIA--LG-
A0A2A2XXW5      --QSHLH-------------------------------PTSSPAEGFRTLRAAIS--LA-
A0A6N6Q6V0      --QAHLH-------------------------------PTSSAAEGFRTLRAAIS--LA-
A0A1Q6UHJ9      --VAVSN-------------------------------ADRATTEAFRSVHSMLK--VN-
A0A2V2BXR0      --VAVSN-------------------------------ADRATTEAFRSVHSMLK--VN-
A0A2D8V0G3      --QAHLH-------------------------------PQSNAAEGFRTVRAAVS--LV-
A0A348S017      --QAHLH-------------------------------PQSNAAEGFRTVRAAIS--LV-
A0A3C1UUV7      --QAHLH-------------------------------PQSNAAEGFRTVRAAIS--LV-
A0A350I3V2      --QAHLH-------------------------------PQSNAAEGFRTVRAAIS--LV-
A0A520RGV5      --QAHLH-------------------------------PQSNAAEGFRTVRAAIS--LV-
A0A3D3XF90      --QAHLH-------------------------------PQSNAAEGFRTVRAAIS--LV-
A0A2D7B522      --QAHLH-------------------------------PQSNAAEGFRTVRAAIS--LV-
A0A356NIC2      --QAHLH-------------------------------PQSNAAEGFRTVRAAIS--LV-
A0A2N8HDG3      --RMFTD-------------------------------EHSVISEYFQILCHNADSMLP-
A0A146GCJ0      PLIFVED-------------------------------PSSMQAEAIRTLRTSIS--LL-
A0A2T6D6H8      PLVFIDD-------------------------------PASLQAEAIRTLRTSLS--LL-
A0A3D1TI55      --PLVEE---------GPDS------------------PH---AEAYRVLRTNLQ--FA-
A0A3E1ET42      --ILHKQ---------SGLS------------------PD---AEAYRILRTNIE--FN-
A0A2A2YDW8      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A352XLN9      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A3D0YP62      --VLHRQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A3D3DV47      --VLHRQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E5XJ49      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E6SBY8      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E5QMS4      --TLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E7YXQ3      --ILHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E3H787      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E7AGN1      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E7AKY7      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A3D4CU34      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E8M146      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A355S8S2      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2D6DVN8      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A3C1W2R2      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E3NAY6      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E3II01      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A368B8C5      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A3R7RBB5      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A2A2QX62      --VLYKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A4Q3BWH6      --VLYKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A3N5WCF1      --ILHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A4Q3C1K5      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A3R8IT45      --VVSNN-------------------------------ADRQVSEAFLTLHSSLR--LR-
A0A2A2PYE8      --IVINN-------------------------------ADRQVSEAFLTLHSSLR--LK-
A0A2T6CN73      --IVATN-------------------------------TDRLASEAFLTLHSSLR--LK-
A0A2G4G428      --LAMHE-------------------------------KDVVAVEAVRTIYSSMR--VN-
A0A6N6PCD8      --KLLKAEESPLVLIDDPSS------------------RQ---AEAFRCLRTSLS--L--
A0A139TV24      --LMLPD-------------------------------EHSVMAEYFHIMCHNVDSMLP-
A0A2N8HT11      --RMFTD-------------------------------EHSVISEYFQILCHNADSMLP-
R7DS70          --RMFTD-------------------------------EHSVISEYFQILCHNADSMLP-
A0A2N8HNL6      --RMFTD-------------------------------EHSVISEYFQILCHNADSMLP-
A0A6N6PAZ1      --VFRKR---------NPDSQLAVPEHWDKRLVFRPGTSATSYAEMYRVTRASIT--LL-
A0A6I1K459      --LFMSD---------DPQS------------------LC---AEAFRSMRASLA--LL-
A0A139TUL1      --LVVIN-------------------------------SRSFMEECFHILRNNTELLLLP
A0A2N8HCB0      --LVVMN-------------------------------GRSLMEECFHILRNNAELMLLP
A0A2N8HP04      --MVVTN-------------------------------GRSFMEECFHILRNNAELMLLP
A0A2N8HRJ0      --LVVTN-------------------------------GRSFMEECFHILRNNAELMLLP
A0A6N2U9Y7      --LVVTN-------------------------------GRSFMEECFHILRNNAELMLLP
A0A366HAG0      --TLMHA---------TGIT------------------PD---AEAYRILRTNLE--FN-
A0A2U8DZK4      ----------------AEEP------------------LDPAEDEPFRVLQTNITLALRN
A0A2T6DFL8      ----------------G--G------------------DDPAELEPYRVLYTNLNLAL--
A0A1D8AWD4      ----------------H--D------------------PSSPEGEPYRVLQTNLNLAL--
A0A4Q1C9S2      ----------------H--D------------------ATAPEGEPYRVLQTNLNLAL--
A0A178IH18      ----------------NEDS------------------GDPADAEPFRVLQTNISLAR--
A0A2T6DT99      ----------------DAAG------------------EDPAELEPFRVLHTNLNLAL--
A0A1G3ZT33      ----------------D--P------------------DNPAESEPFRVLQTNLNLAL--
A0A3E1E2T2      ----------------E--G------------------D-PAETEPFRVLHTNLNLAL--
B1ZMW1          ----------------D--E------------------D-PAEAEPYRVLQTNLNLAL--
A0A3M1I8A3      --LQCHL---------HPQS------------------NA---SESIRSIRAAVA--LG-
A0A4V0XS84      --LEAHS---------NPTS------------------IS---SEGFRTLRAAIS--LT-
A0A351WE84      --PLIHE---------GPES------------------PH---GEPYRVLRTNMQ--FS-
D5ENH7          --QAVAS---------NVDR------------------HV---TETFRSIHSAMK--LN-
A0A0R2XQ77      --QAVAS---------NIDR------------------HV---TESFRSIHSALR--LS-
A0A2E9IN28      --QAVAS---------NVDR------------------HV---TETFRTIHSALK--LN-
A0A6N4WTJ5      --QAVAS---------NVDR------------------HV---TETFRSIHSALK--LN-
A0A1V5QDZ6      --PLTEE---------GPDS------------------PH---AEAYRVLKTNLQ--FA-
A0A4Y8P964      --EIPKDIPFALTTHAAPES------------------LI---SNAYRQIRTLLH--YA-
A0A3D4HF88      --IAVAS---------NADR------------------RV---TEAFRSVHSALN--LN-
A0A6N6ZHN8      --RIVAD---------NLDR------------------PT---VEAFRSIHSTLK--LH-
A0A6G6K641      --SARKNPLPDLEIVHQKNS------------------PV---SESFRTLRSAIM--LL-
A0A5B5WI95      --LFIKE-------------------------------EQSVMAECFHILRNNVDSLLP-
A0A2N8I9W1      --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
A0A4Q5IH27      --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
A0A2N8IBZ6      --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
A0A2N8IJW9      --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
A0A7G6DX28      --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
R6J100          --LFIQD-------------------------------EHSVIAECFHILRNNVDSMLP-
A0A1V6J089      --PLTEA---------GQSS------------------GQ---GEAYRSLRTSMA--LL-
A0A3C1BZR1      --PLTEA---------GQSS------------------GQ---GEAYRALRTSLA--LL-
A0A7C4KLL2      --FVASE---------GSDS------------------RG---AEAFRTLRTSVL--ML-
A0A1H6KPB7      --LLHLM---------NGSS------------------PD---AEAYRILRTNIE--LK-
A0A2E9ISN4      --LPIDKFNPESDIFVAAKG------------------TNQIATETYRRIRLNLL--KQ-
B9XAX1          --HIVAD---------DPGS------------------IC---SEAFRTLRTTTG--IL-
A0A5R8KKM9      --ALHRT---------TGLN------------------PD---AEAYRILRTNIE--FN-
A0A139TS01      --ILHSA---------GSLG------------------PD---AEAYRILRTNIE--FN-
A0A3E1EJT7      --QIVSN---------GSDP------------------AI---VEAFLSLYSNLR--IN-
A0A7C3I5X9      --SLVER---FQTSHLHAQS------------------NA---AESFRTIRAAIT--LG-
A0A2D5WGA5      --SLLDE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A2E7SSH2      --SLMDE---------GDES------------------PH---AEAYRVLRTNIL--FAG
A0A349GXM8      --PIVTE---------EHST------------------GA---IEAYRALRTSVL--AE-
A0A4P5YP61      --LVVVD---------DAKS------------------IG---AEAIRTLRTSLS--ML-
A0A6B2LYM4      --RIAAD---------EHDK------------------HA---VEAFRSIHSTLK--LN-
A0A6D1VXB3      --EIPKDIPFALTTYSSPES------------------FV---SNAFRQIRTLLH--YA-
I0JYY7          --EIPKDIPFALTTYSSPES------------------FV---SNAFRQIRTLLH--YA-
A0A4R7S1J2      --AILKH---------AEHS------------------PV---AESFRSLRVMAN--LL-
A0A2A2XV69      --LLING---------NDDN------------------PD---AEAYRIMRTNIE--FN-
A0A651H7X9      --QIVLN---------NEDR------------------QA---VEAFRTLHSSLK--LH-
A0A4Y8P842      --TYEGEIPYALMTYALPES------------------EI---SNGFRSIRTLLH--YT-
B3DZK9          --TYEGDIPYALMTYALPES------------------EV---SNGFRSIRTLLH--YT-
A0A5E6MPC4      --EIPADLPMAFAAHVAPDS------------------AV---SNSFRQIRTLLH--YS-
A0A6N6PKP9      --SVLVK---------KPQS------------------AL---AESFRTLRTSLG--IT-
A0A6N6Z250      --LIGPK---------DFDS------------------PG---AEVFRVIQTNLQ--IA-
A0A4V1SB02      --TVMTD---------DANS------------------SQ---AEAYRTLRASLS--LL-
A0A6N6QEJ2      --ALINE---------GADS------------------PH---AEAYRVLRTNIL--FS-
A0A3C1VB86      --LAAAQ---------DSNS------------------PN---AEVFRTLRATLS--ML-
A0A146G2Q9      --LLVNE---------AKDN------------------AD---AEAYRILRTNIE--FN-
A0A2T6D3Y2      --LLVNE---------TKEN------------------AD---AEAYRILRTNIE--FN-
A0A6N6P5E3      --VLKDA---------PSDC------------------PD---AEGYRILRTNIE--FN-
A0A2D5VY59      --SLLLE---------GPDS------------------PH---AEAYRVLRTNIL--FS-
A0A2D8UZZ4      --SLLLE---------GPDS------------------PH---AEAYRVLRTNIL--FS-
A0A353DV86      --SLLLE---------GPDS------------------PH---AEAYRVLRTNIL--FS-
A0A2E5EPT8      --VLMNE---------DPDT------------------PH---AEPYRVLRTNIL--FT-
A0A6J4HTK1      --LLHKE---------PGDT------------------PD---AEAYRILRTNIE--FN-
A0A6N6PHJ5      --LLIEE---------GAES------------------PH---AEAYRVLRTNLL--FA-
A0A6M1RXR2      --LLLEE---------GAES------------------PH---AEAYRVLRTNIL--FS-
A0A7C3DXS4      --LLLEE---------GAES------------------PH---AEAYRVLRTNLL--FS-
A0A2V2SDV4      --AILDE---------GAES------------------PH---AEAYRVLRTNLL--FS-
A0A2V5PK75      --LILDE---------GVDS------------------PH---AEAYRVLRTNLL--FS-
A0A1V6DME1      --SLLQE---------GAES------------------PH---AEAYRVLRTNLL--FS-
A0A3D3DIJ3      --LLVDE---------GTES------------------PH---AEAYRVLRTNLL--FS-
A0A6I1K583      --ALLDE---------GMDS------------------PH---AEAYRVLRTNVL--FT-
A0A350EWA4      --SLLDE---------GPDS------------------PH---AEAYRVLRTNIL--FS-
A0A5B5WZ91      --ILHSA---------GSLG------------------PD---AEAYRILRTNIE--FN-
A0A2N8HD92      --ILHSS---------DVLG------------------PD---AEAYRILRTNIE--FN-
A0A2N8HIT2      --ILHSS---------DVMG------------------PD---AEAYRILRTNIE--FN-
A0A354EBD3      --ILHSS---------GVMG------------------PD---AEAYRILRTNIE--FN-
A0A355VEB2      --ILHSS---------GVMG------------------PD---AEAYRILRTNIE--FN-
A0A2N8IMT3      --ILHSS---------DAMG------------------PD---AEAYRILRTNIE--FN-
R6K1U5          --ILHSS---------DAMG------------------PD---AEAYRILRTNIE--FN-
A0A2N8IWC2      --ILHSS---------DAMG------------------PD---AEAYRILRTNIE--FN-
A0A2N8I441      --ILHSS---------DAMG------------------PD---AEAYRILRTNIE--FN-
A0A2N8I3A6      --ILHSS---------DAMG------------------PD---AEAYRILRTNIE--FN-
A0A410SCC4      --ILHSS---------DAMG------------------PD---AEAYRILRTNIE--FN-
A0A3R5VEW0      --ILHSS---------DVMG------------------PD---AEAYRILRTNIE--FN-
A0A411SSG2      --ILHSS---------DVMG------------------PD---AEAYRILRTNIE--FN-
B2UKW3          --ILHSS---------DVMG------------------PD---AEAYRILRTNIE--FN-
A0A7C3HWX0      --LLLEQ---------GPDS------------------PH---AESYRVLRTNVL--FS-
A0A1M6RLZ4      --VLHKQ---------SGAS------------------PD---AEAYRILRTNIE--FN-
A0A7C4KPD7      --NLLEE---------GPES------------------PH---AEAYRVLRTNLL--FS-
A0A354T7G8      --VLHRS---------SGFN------------------PD---AEAYRILRTNIE--FN-
A0A512MBZ2      --VLHRT---------SGFN------------------PD---AEAYRILRTNIE--FN-
A0A2E8MEZ0      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A6B3LBV6      --VLHRE---------GGMS------------------PD---AEAYRILRTNIE--FN-
A0A2E3EC33      --VLXRQ---------SGLS------------------PD---AEAYRILRTNIE--FN-
A0A2E4GN01      --ILHRQ---------SGLS------------------PD---AEAYRILRTNIE--FN-
A0A1Z8XU55      --VIHKQ---------SGLS------------------PD---AEAYRILRTNIE--FN-
A0A2E1RQR9      --VIHKQ---------SGLS------------------PD---AEAYRILRTNIE--FN-
A0A2E3ISQ4      --VLHKE---------SGLS------------------PD---AEAYRILRTNIE--FN-
A0A2D6W6F4      --VLHKE---------SGLS------------------PD---AEAYRILRTNIE--FN-
A0A2D8Z5A8      --VLHKE---------SGLS------------------PD---AEAYRILRTNIE--FN-
A0A4Q2YKS3      --VLHKQ---------SGMS------------------PD---AEAYRILRTNIE--FN-
A0A6N6P3T8      --ILHKQ---------SGMS------------------PD---SEAYRILRTNIE--FN-
                                                            :               

A0A2A2XVF1      GPEEERRVLLFVSAIPEEGKTYTSLNTAVVFAQQGLKTLLIDADLRRPSLHKALLTVDTL
A0A2V5UHJ2      QAGGPPHTILVTSAARGEGKTTTLVNSAIVFAQLGIRVLIIDADLRRPRCHALL--RMEN
A0A2V5PST3      EPEATRKVILLTSPSPGEGKTATTLNLGIALAQDSFKVLIIDADLRRGSCHSRL--GIGN
A0A2V5PXM3      GRKEERRVFLFTSAVPSEGKTFCSLNFAISLAQQGLRTLIIDCDLRRPMVENTLQNNNQR
A0A1V5QB01      VAGSQSKFIAMTSAVPKEGKTTTCLNLAVSLAQAGARILMVDSDMRRGELHKFF--GLEG
A0A1J4XH17      KASKPARVITVTSTLPSEGKSFFTTNLGLTFAANDEKVLIIDADLRMPSIGSSL--QLDK
A0A7C5LI63      IPREKLRSLLLTSAVPREGKTTTCVNLAIGFAQIEERTLLLDADLRRGEIHKYF--GLER
A0A7C5P291      TPRDKLRSILVTSAVPREGKTTTTVNLAIGFSQVEDRVLLIDGDLRRGEIHKFF--NAEK
A0A139SU05      SLVDYPKSMLVTSTIPGEGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRF--DLAN
A0A139SPN4      SLVDYPKAMLVTSTIPGEGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRF--DLAN
A0A1V6E7N1      SKLDFPKSILVTSTIPGEGKTLVSANLAASFARHGRRTLLIDCDLRRPMMHRHF--KQSN
A0A2D9MYT1      VRAGDLQILSVTSTVPSEGKSLVASNHAIVTAQTGAKTLLVDCDLRRPSVHKAF--QIQS
A0A290QGD9      DDARAAKCILVTSTIPGEGKSFTTTNLALTFAAHGEKVVVIDCDLRRPNIHKSF--RIAN
A0A1D8AS58      DESKAAQAILVTSTIPGEGKSFTTTNLALTFAAHGEKVVVIDCDLRKPNIHKSF--RLEN
I6AQC1          NDSKNAQTFLTTSTVPGEGKSFTTTNLALTFAAHGDRVVVLDCDLRKPNIHKSF--RREN
W0ITH7          NDSKNAQTFLTTSTVPGEGKSFTTTNLALTFAAHGDRVVVVDCDLRKPNIHKSF--RREN
A0A258ANJ7      MARCPHTCHMVVSAVPDEGKTFVSTHLAVSLASQGFRTLLIDMDLRHSQLAQVF--GIPN
A0A139TLN4      ENGPGGFSILLTSSCPGEGKTYLAVNLALSLAVAGKKVLLMDMDLRKGTLSSLL--GGEG
A0A1G3ZFT0      LSCANNNIISILGASPGVGKTFVSTNLAYLLATADKRILLVDADLRKGTVHKYF--NLDP
A0A1Z8ZMT6      GDANQRKITMITSSIPGEGKTFCAANLALAYAKQGTRTLLIDFDLRKPAVHKIFNEERAA
A0A2E8MCT7      GDTNQRKITMITSSVPGEGKTFCAANLALAYAKQGTRTLLVDFDLRKPAVHKIFNEERAA
A0A290Q2Z2      KGVTPGRSLVMLSAGPGEGKSTTVLRLARSMGAAGERVLLVDSDLRRPTQHQLA--ALPK
A0A2A2RGK2      RINEDARTFLFTSSMPSEGKTFCSSNFAVTLAQQGFNTLFIDADLRKPGGSIVFF-GENR
A0A2A2XXF7      RLNESARTFLFTSSMPSEGKTFCSSNFAVTLAQQGFNTLFIDADLRKPGGSIVFY-GENR
A0A2A2R5D6      PKSGAGNTLTVVSGGPGEGKSTTLFNLAYVCAQSGQSVLLVDADLRRPTVHTIL--GIEN
A0A3C1VJ32      RKDEKLNTIVIVSAGAGEGKSTTTINLSTVFAQAGNRVLIVDSDLRRPTLHKLF--KVAN
A0A2N9NTX7      RKDEKLNTVAVVSAGAGEGKSTTVFNLACVFAQGSQRVLIVDSDLRRPTLHRML--RVSN
B9XK55          RKDDKLNTMAVVSAGAGEGKSTTVYNMATVFAQSGHRVVMVDSDLRRPTLHKLV--NVSN
A0A4P5YMI6      RKDPKANSLIVVSSGAGEGKTTTVLNLAVIFAHNGHKVLLVDTDIRRPSLHKRL--NVSN
A0A2E6T482      RKSEDQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRCLIVDSDLRRPSMHRYL--QVSN
A0A3C0DQZ7      RKSEDQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRCLIVDSDLRRPSMHRYL--QVSN
A0A1Z9CBK5      RTSEXXTTFSVVSGGAGEGKTTTMFNLAVIFAQMGDRILVVDSDLRRPSMHRYF--KVSN
A0A2D6ZI96      RTSEXXTTFSVVSGGAGEGKTTTMFNLAVIFAQMGDRILVVDSDLRRPSMHRYF--KVSN
A0A358KGZ3      RKSEDQTTFTVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSN
A0A2E9ZQX4      RKSEDQTTFTVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSN
A0A3D5JZU0      RKSEDQTTFSVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVSN
A0A2E6HCR0      RKSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVVDSDLRRPSMHRYF--KVTN
A0A1Z8WN04      RQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSN
A0A2D7L1N4      RQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSN
A0A2E2R937      RQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSN
A0A520QQY4      RQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSN
A0A2D5MR66      RQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSN
A0A2E0PDQ1      RQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSN
A0A2E2ZZP9      RQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYF--KVSN
A0A7C4LRK7      RKDDKWNTLTIVSAGAGEGKSTTLFNLAVVFAQNAARVLIVDSDLRRPSLHRIL--KVSN
A0A2A2RGF2      RKDDQANAITVVSGGAGEGKSTTVLNLATIFAQNGDKVLLVDSDLRRPSLHKRL--GLSN
A0A2G4I5Y6      RKDDAANAITVVSGGAGEGKSTTVLNLATIFAQNGDKVLLVDSDLRRPSLHKRL--GLSN
A0A6N6PS97      RTDPKANTITVVSGGAGEGKSTTIFNLAVVFAQNGSRVLLVDSDLRRPSLHKIL--NLSN
A0A3M1I883      RKNPNDNTITVVSGGAGEGKSTTIMNLATVFAQNGERVLLVDSDLRRPSLHKFI--GVSN
A0A1V6JZ45      RKEPGANTLTVVSGGAGEGKSTTILNLATVFAQNGQRVLVVDSDLRRPSLHKFL--AVSN
A0A7C7Z746      RKDPTKNSLTVVSGGAGEGKSTTLFNLAVVFAQEGQKVLIVDSDLRRPSIHKMM--HVTN
A0A520RRW5      RKNEKANTLTVVSGGAGEGKSTTIFNLATVFAQNGSRILIVDSDLRRPSLHKHV--GVSN
A0A356NPK0      RKSEKATTLTVVSGGAGEGKSTTIFNLATVFAQNDSRILIVDSDLRRPSLHKHV--GVSN
A0A2D7B5P5      RKXEKAXTLTVVSGGAGEGKSTTIFNLATVFAQNXSRILIVDSDLRRPSLHKHV--GVSN
A0A3D3XGB5      RKNEKANTLTVVSGGAGEGKSTTIFNLATVFAQNGSRILIVDSDLRRPSLHKHV--GVSN
A0A2V6F8A1      RKREDANSITVVSGGAGEGKSTTIFNLGVVFAQNGQRVLLVDSDLRRPSLHKLL--NVSN
A0A2V5TNH4      RKREDANSLTVVSGGAGEGKSTTIFNLAVVFAQNGQRALLVDSDLRRPSLHKLL--NVSN
A0A2V5X5Q6      RKREDANSLTVVSGGAGEGKSTTIFNLAVVFAQNGQRALLVDSDLRRPSLHKLL--NVSN
A0A4P5QM05      LPDHGANTYTLVSGGPGEGKSTTLSNLAYIYAKGGANVLVVDADLRRPSQHRFF--NVDN
A0A4Q3C001      KPGRDANTFTLISGGPGEGKSTTLNNLAYTCAKGGYNVLVVDADLRRPTQHRIF--EVDN
B4DB23          KPYRDANTFTLISGGPGEGKSTTLNNLAYTCAKGGYNVLVVDADLRRASQHHFF--DVDN
A0A6B3L938      GRKERNQVICLTSALPGEGKTTTATELAAGFALAGERVLLVDFDLRKPRVHAEFP-DLKG
A0A2V5URB2      RPEAPPKTILFTSGTASEGKTITVANTAIMFARLGNRVLLMDADLRRPTCHKAL--KVQG
A0A2V2DJ66      NVSKDAKVILATSTTPSEGKSFVISNLAFTCALNGEKCIIIDADLRLPALAKVL--GISA
R7L5A9          NFSKNAKVILFTSTTPSEGKSFIVTNLAFTYALHGEKTIIIDADLRLPAMAKVL--GITA
A0A5R8KA81      EDHDKDEVVLFTSSIPSEGKSFCSANYAISSANLGKRTLLIDADLRRPMVNELFF-KGRV
A0A5B5WU87      ENGPGCFSILLTSSCPGEGKTYLAVNLALSLAVAGKKVLLMDMDLRKGTLSSLL--GGQG
R7DZW0          GNEGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAG
A0A2N8HID1      GNEGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAG
A0A2N8HS06      GNGGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAG
A0A6N2TNT9      GNGGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSALL--GGAG
A0A3R5R2M8      RPDAGGYVILLTSTCPAEGKTFASANLAAAFAKAGRKVLLIDGDLRKRSLSRQL--GGYG
A0A411SUQ6      RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
A0A2N8HZF2      RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
A0A354E720      RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDLRKSSLTRRL--GGSG
B2UPB6          RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
A0A2V6JLK8      RANPEANTISLVSGGPGEGKSTTIANLAFICAQGGYSTLIVDADLRRPVQHLLF--DLSN
A0A2W5Z1A5      RRNPEANTISIASGGPGEGKSTTVTNLGYICAQGGYSTLIVDADLRRPVQHMHF--DLDN
A0A2V6EA09      RKNPEANTISLVSGGPGEGKSTTIANLAFVCAQGGYSTLIVDADLRRPIQHEFF--GVSN
A0A2V6GQI7      RKNPEANTISLVSGGPGEGKSTTIANLAFVCAQGGYSTLIVDADLRRPIQHEFF--GVSN
A0A3C1HEJ2      GPVNERRTFLFTSAVPDEGKTFCTINFAYSLAQQGMRTLLIDCDLRCPTVEEYLLGRNTE
A0A522ULD9      ANKGNGGAFSFISGGAGEGKSTTLFNLAYICAQQGDKVLIVDSDLRRPTQHTIL--GLSN
A0A1V6JU76      AKAEKMRVFTVTSTIPSEGKSLVASNLAVVVAQTGLRTVLVDADLRRPSLHKAF--QLHS
A0A2A2XXW5      KNADKLRVMAFTSTIPSEGKSLVASNFAIVTSQTGLKTLLVDADLRRPSVHKAF--QLQS
A0A6N6Q6V0      RNSEKLRNVAVSSTIPSEGKSLVASNFAIVTAQTGLRTLLVDADLRRPSVHKAF--QLQS
A0A1Q6UHJ9      NIAKDSKVLLFTSTTPSEGKSFVVTNLALMCAMHGEKTIIIDADLRLPAMAKVL--GIES
A0A2V2BXR0      NIAKDSKVLLFTSTTPSEGKSFVVTNLALMCAMHGEKTIIIDADLRLPAMAKVL--GIES
A0A2D8V0G3      HKSDKFKVLSMTSTIPSEGKSLVASNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQS
A0A348S017      HKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQS
A0A3C1UUV7      HKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQS
A0A350I3V2      HKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQS
A0A520RGV5      HKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQS
A0A3D3XF90      HKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQS
A0A2D7B522      HKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQS
A0A356NIC2      HKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAF--QMQS
A0A2N8HDG3      VTRNQGHVILLTSTMQGEGKTFISANLALAFANIGKRVLVIDGDLRKASLSKQL--DGKG
A0A146GCJ0      GKQDDRKTFLFASAIPQEGKSFTSLNFAHALAQKGLRTVVIDADLRRPRLKDDLLPDAGD
A0A2T6D6H8      GKQETRRTFLFASSIPEEGKTFTSLNFAHSLAQQGLRTVIIDADLRKPRLKADLLPEEGD
A0A3D1TI55      AKDPGANAITIVSGGVGEGKSTTLFNLAYVCAQLGDKVLLVDSDLRRPALHKIL--GMSN
A0A3E1ET42      RRSADANAITIVSGGAGEGKSTTLVNLAYICAQGGYNTLMIDGDLRRPKLHTFF--DINN
A0A2A2YDW8      RKNPEDNSITVVSGAAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A352XLN9      RKNPEDNSITVVSGAAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A3D0YP62      RKNPEDNSITVVSGGAGEGKSTTLCNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A3D3DV47      RKNPEDNSITVVSGGAGEGKSTTLCNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A2E5XJ49      RKNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A2E6SBY8      RKNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A2E5QMS4      RNNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDSDLRRPTLHTFF--DINN
A0A2E7YXQ3      RNNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDSDLRRPTLHTFF--DINN
A0A2E3H787      RNNPEDNSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPQLHTFF--DINN
A0A2E7AGN1      RSNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINN
A0A2E7AKY7      RSNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINN
A0A3D4CU34      RSNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFF--DINN
A0A2E8M146      RNNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINN
A0A355S8S2      RNNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINN
A0A2D6DVN8      RNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINN
A0A3C1W2R2      RNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINN
A0A2E3NAY6      RNNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINN
A0A2E3II01      RNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINN
A0A368B8C5      RNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINN
A0A3R7RBB5      RNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFF--DINN
A0A2A2QX62      RKNPEDNSITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--EINN
A0A4Q3BWH6      RKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A3N5WCF1      RKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A4Q3C1K5      RKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFF--DINN
A0A3R8IT45      NDSKNAQTFLTTSTVPGEGKSFTTTNLALTFAAHGDKVVIVDCDLRKPNIHKSF--RREN
A0A2A2PYE8      DESKNAKCILVTSTIPGEGKSFTTTNLALTFAAHGERVVVIDCDLRKPNIHKSF--RLEN
A0A2T6CN73      DESKNAKCILTTSTIPGEGKSLTTTNLALTFAAHGEKVIVVDCDLRKPNIHKSF--RIEN
A0A2G4G428      PASMSSHVFLITSTRPSEGKTFVATNLALGFSQHGERVLVIDADLRLPNVGPSL--GLTG
A0A6N6PCD8      LPEGSPKVILFTSSIPGEGKSFCSANYATSLAQQNLRILIIDADLRKPGLGKSF--PTKH
A0A139TV24      FSEHQGHVILLASTTPGEGKTFISANLAQAFSKIGKRVLLIDGDLRKTSLSSQL--GGKG
A0A2N8HT11      VTRNQGHVILLTSTMQGEGKTFISANLAMSFANIGKRVLVIDGDLRKASLSKQL--DGKG
R7DS70          VTRNQGHVILLTSTMQGEGKTFISANLAMSFANIGKRVLVIDGDLRKASLSKQL--DGKG
A0A2N8HNL6      VTRNQGHVILLTSTMQGEGKTFISANLAISFANIGKRVLVIDGDLRKASLSKQL--DGKG
A0A6N6PAZ1      GDEMQRKITLFTSSLPGEGKTLTSANFAIAAAGQGRKTLLIDMDLRKPSIHKLF--GIPR
A0A6I1K459      GREEDRKVVFFTSAVPSEGKSFCCVNYAVAYAQQGRRTLVIDFDLRKPTLAESF--GLKE
A0A139TUL1      NPEKASRVVFLTSTRTGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFC--VGKN
A0A2N8HCB0      NPEEASRVLFMTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKN
A0A2N8HP04      NPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKN
A0A2N8HRJ0      NPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKN
A0A6N2U9Y7      NPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFY--GGKN
A0A366HAG0      RRDPNANCISVASGSPGEGKSTTMVNLATICAQGGYNTLIIDADMRRPRQHTFF--NVPH
A0A2U8DZK4      KPSHGAQTLVMLSAGPGEGKSTTLLRLARAMGAAGERVLLIDADLRRPTQHRLF--NVAK
A0A2T6DFL8      KPGQAH-ALVFSSAGPGEGKSTTLHRLTRLMGEMGDRVLLIDADLRRPTQHRIA--ERPR
A0A1D8AWD4      TAGKTS-VLVVLSSGPGEGKSTTLRQLALCMAAAGEKVLLIDSDVRRPTQHKLA--GLSR
A0A4Q1C9S2      PARQSS-VLVVLSSGPGEGKSTTLRQLALCMAAAGEKVLLIDSDVRRPTQHKLA--TLPR
A0A178IH18      KDAAPGRTLVMLSAGPGEGKSTTLLRLARAMGEAGARVLLIDSDLRRPTQHQLT--GAAK
A0A2T6DT99      KSDARGRTLILLSAGPGEGKSTTLLRLARAMAKAGERVLLIDSDLRRPTQHQLA--GLRK
A0A1G3ZT33      PPGQPG-SLVVVSAGPGEGKSTTVHHLVRVMAAAGERVLLVDSDVRRPAQHRLM--DQTR
A0A3E1E2T2      KPGEAA-SLVLFSAGPGEGKSTTLHRLVRVMAAGGERVILIDSDVRRPTQHHLA--DRPR
B1ZMW1          KPGQPA-SLVIFSAGPGEGKSTTLFRLARLAAAAGERVVLIDSDFRRPAQHRLA--ERPR
A0A3M1I8A3      DHGEKLRVLTVTSTIPSEGKSIIAANLAIAMAQTGYRTLLVDADMRRPRLHKAF--QLHN
A0A4V0XS84      QQPENLRTIVVTSTIPSEGKSLVASNYAIVSAQSGLRTLLVDADLRRPSVHKAF--GIEN
A0A351WE84      NKGIHGGAFAVISGGVGEGKSTTLFNLAYTCAQLGYKTIVVDSDLRRPVQHSIL--SMSN
D5ENH7          DESKNAKIIVTTSTVPSEGKSFVSSNLALTFANHGEKTLLLDADLRLPNVAASM--QLEN
A0A0R2XQ77      DESRHAKVLVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSL--QLQN
A0A2E9IN28      DESKNAKIILTTSTVPSEGKSFVSSNLSLTFANHGEKTLLIDCDLRLPNVARSL--QLEN
A0A6N4WTJ5      DDSKNAKVIVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSL--QLEN
A0A1V5QDZ6      NKGTLGGAFALVSGGVGEGKSTTLFNLAYVCAQLGDKVLIVDSDLRRPVQHRIL--GVSN
A0A4Y8P964      IPNRKPQLIALTSTYPSEGKSSTVVNLATVLGQQG-TVLIIDGDLRRPMLHKVL--GLRP
A0A3D4HF88      EISKNAQIILMTSTVPSEGKSFVSTNLAYTYASHGERVVLIDCDLRMPNVAKSM--NLSN
A0A6N6ZHN8      EESKNAKVIVTTSTVSSEGKSFASTNLAITFAIHGERTLVVDCDLRMPNVAKSL--DLSE
A0A6G6K641      GRFDERRVFMFTSALPAEGKTFCASNFAVSLAQQGLKTVLVDCDLRKPAISEVFL-GKAA
A0A5B5WI95      RPDEGGHVIMLTSTTPGEGKTFTSANLAATFAKAGRKVLLIDGDLRKFSLTRQM--GGHG
A0A2N8I9W1      RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
A0A4Q5IH27      RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
A0A2N8IBZ6      RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
A0A2N8IJW9      RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
A0A7G6DX28      RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
R6J100          RPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRL--GGSG
A0A1V6J089      GREDNKKIFAVISGGVGEGKSTTLFNLAYVCAEQGSKVLVIDSDLRRPVQHKMV--GLAN
A0A3C1BZR1      AREGKQKIFTVISGGVGEGKSTTLFNLAYVCAEQGSKVLIIDSDLRRPVQHKMV--GLAN
A0A7C4KLL2      GRQEERRVFLFTSAFPSEGKTFNSVNFAISLAQQGLKVLLIDADLRKPSVENFITGQTGK
A0A1H6KPB7      RKDTNVVTLALVSGNAGEGKTTTLCNLAYVFAQGGFSTLMIDADLRRSKLAEYN--DVEC
A0A2E9ISN4      FGQDENISFTVTSSQSGDGKTFNVANIALPFAWVGKRVLLIDADLRLGNLTRRLL-GREL
B9XAX1          GHEEGKRITLFTSADPNEGKTFFSLNHAICQAQGGKLTLLIDLDLRRPSVGESFS-HPPG
A0A5R8KKM9      RKRPDANVISVVSGGSSEGKSTTMVNLATVCAQGGYNTLIIDGDLRRPRMHTFF--DVTN
A0A139TS01      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A3E1EJT7      DESRNARLILVTSTLPSEGKSFITTNLGLTFASQGQRTVIVDCDLRKPNVERSF--RLQT
A0A7C3I5X9      SRGDRFRLLAVTSSMPAEGKSTIAANLAIVIAQTGLRTLLVDADLRRPSVHHGF--EAEG
A0A2D5WGA5      RKDESQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRVLIVDSDLRRPSMHRYL--KVTN
A0A2E7SSH2      RQSEDQTTFSVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYF--KVTN
A0A349GXM8      LAKKHEKILMITSADSREGKTLTALNLSIMVVQMGKRVLLVDMDLRRGRIHRSL--GLDR
A0A4P5YP61      GKAENRRVYLFTSAIPAEGKTFCSLNYAVSLAQQGSKTLLIDGDLRRPAVEKAISGKDKK
A0A6B2LYM4      EESRNAKVILSTSTIPSEGKTFISTNLSITFAAHGERTIVVDADLRMPNVSKEL--NIDG
A0A6D1VXB3      IPNRKPQLIAITSTYPSEGKSSTIVNLATVLGQQG-TVLIIDGDLRKPSLHKSL--GLRP
I0JYY7          IPNRKPQLIAITSTYPSEGKSSTIVNLATVLGQQG-TVLIIDGDLRKPSLHKSL--GLRP
A0A4R7S1J2      GKEEDRRVFVVTSALPSEGKTFCSCNYALSLAQQGLKTLLIDADLRRPKVSASVY-GEDR
A0A2A2XV69      RKNPASNSITIVSGGPGEGKSTTLNNLAYTFAKGGYTTLVVDADLRRPSQHRIF--GIDN
A0A651H7X9      DESKNAQALLITSTTPGEGKSFTATNLALTYAQHGEKTLLIDCDLRKPNIHQGL--QLEN
A0A4Y8P842      IPGRRPQVITITSTQESEGKSGTTVNLATVLGQQG-TVLIIDADLRRPAIHKNL--GLRP
B3DZK9          IAGRRPQVITVTSTLESEGKSGTTVNLATVLGQQG-TVLVIDADLRRPSIHKIL--GLRP
A0A5E6MPC4      LPDRRPQVMLITSCQMGEGKTSTTVNTATVLGQQG-TVLLIDADLRRPNLHKIL--GLRP
A0A6N6PKP9      GKDAGGHAVLFASAVPGEGKSFCAINCAVAFAQQGLRTLLIDADLRLPTVERIIL-QTQG
A0A6N6Z250      GGSARGEVLLVQSAGPGEGKSTVLRNLAACAALGGERVLVIDSDLRRPTQHDLL--SAER
A0A4V1SB02      GEESQRRVLLVTSAVPAEGKTFTATNLAAALATQGLSTLLIDADLRRPALSATM---LER
A0A6N6QEJ2      RKDPGCRTMTVVSGGAGEGKSTTIFNLATIFAQQGSRVLIVDSDLRRPSLHKIL--NVSN
A0A3C1VB86      GRENDRKTYLFTSSLPGEGKTFTSVNYAVSLAQQGLRTLLVDIDLRRPMIEKFFLGKTSR
A0A146G2Q9      RKNPDANTITMISGGAGEGKSTTMSNLASIFASGGYSTLIVDADLRRPSQHRIF--GVEN
A0A2T6D3Y2      RKNPDANTITMISGGAGEGKSTTMSNLASIFASGGYSTLIVDADLRRPSQHRIF--GVEN
A0A6N6P5E3      RKNPNNNTLTLVSGGPGEGKSTTMNNLAFTFARGGYRTLIVDADLRRPSQHRFF--GIEN
A0A2D5VY59      KKDPKFNALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSN
A0A2D8UZZ4      KKDPKFNALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSN
A0A353DV86      KKDPKFNALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLV--GVSN
A0A2E5EPT8      NKKPNANTITVVSGGAGEGKSTTVLNLATIFAQNGNRVLLVDSDLRRPSLHKRL--DIEN
A0A6J4HTK1      RKSPDANTLSLVSGGPGEGKSTTLANLAFTSAQGGYSTLIVDADLRRPVQHSIF--DLSN
A0A6N6PHJ5      RKDDKLNTTAVVSAGAGEGKSTTVLNLATVFAQSGQRVVIVDSDLRRPTLHKLL--KVTN
A0A6M1RXR2      RKDERLNTLVVVSAGAGEGKTTTVLNLATVFAQSNQRVLIVDSDLRRPALHKRL--KVSN
A0A7C3DXS4      RKDERLNTLVVVSAGAGEGKTTTVLNLATVFAQSNQRVLIVDSDLRRPAIHKRL--KVSN
A0A2V2SDV4      RKDDKLNTVAIVSAGAGEGKSTTVFNLAAVFAQGGQRVLIVDSDLRRPTLHKML--RVSN
A0A2V5PK75      RKDDKLNSVAVVSAGAGEGKSTTVFNLACVFAQSRQRVLIVDSDLRRPTLHKML--RVPN
A0A1V6DME1      RKDDKLNSIAVVSAGAGEGKTTTVFNLATVFAQGNQRVIIVDSDLRRPTLHKRF--GVSN
A0A3D3DIJ3      RKDDKLNTIAIVSAGAGEGKSTTVFNLAAVFAQSGQRTIIVDSDLRRPTLHKML--RVTN
A0A6I1K583      RKDEHANAITVVSGGAGEGKSTTVLNLATIFAQNGNKVLLVDSDLRRPSLHKRL--GLSN
A0A350EWA4      RKSEDQNTITVVSGGAGEGKSTTLFNLACIFAQNGARVLIVDSDLRRPSIHKIL--RVSN
A0A5B5WZ91      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDGDLRRSKLHRYY--ELDN
A0A2N8HD92      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A2N8HIT2      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A354EBD3      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A355VEB2      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A2N8IMT3      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
R6K1U5          KKGLEEISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A2N8IWC2      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A2N8I441      KKGLEEISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A2N8I3A6      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A410SCC4      KKGLEEISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A3R5VEW0      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A411SSG2      KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
B2UKW3          KKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY--ELDN
A0A7C3HWX0      RKRPDANSLTVVSGGAGEGKSTTIFNLATVFAQQGQRVLVVDSDLRRPSLHKFL--KVSN
A0A1M6RLZ4      RKNPDDNSITVVSGGAGEGKSTTLVNLAYICAQGGYSTLMIDADLRRPKLHTFF--DINN
A0A7C4KPD7      RKDQGWNTLTVVSAGAGEGKSTTLFNLAVVFAQNGNRVLLVDSDLRRPSLHKRL--GVSN
A0A354T7G8      RKSPDANCFSVVSGGAGEGKSTTMVNLAYVCAQGGYNVLLIDADLRRPSLHHHF--DVSH
A0A512MBZ2      RRNPEANCITVTSGGAGEGKSTTLCNLATVCAQGGYSVLLIDADLRRPSLHRLF--DVSN
A0A2E8MEZ0      RKNPEDNSITVVSGGAGEGKSTTLVNLAYVCSQGGYTTLMVDADLRRPRLHSFF--DINN
A0A6B3LBV6      RRSADANSITMVSGGAGEGKSTTLVNLAYVCAQGGYNTLIIDGDLRRPTLHGHF--DTSN
A0A2E3EC33      RKTADANSMTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDADLRRPQLHTFF--NXNN
A0A2E4GN01      RKTSDANSMTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDXRRPQLHTFF--NINN
A0A1Z8XU55      RKNADANSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINN
A0A2E1RQR9      RKNADANSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINN
A0A2E3ISQ4      RKNADANSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINN
A0A2D6W6F4      RKNADANAITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINN
A0A2D8Z5A8      RKNADANAITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFF--NINN
A0A4Q2YKS3      RKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDGDLRRPRLHTFF--DINN
A0A6N6P3T8      RKNPEDNAITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFF--DINN
                            .     **:                 :.:* * *              

A0A2A2XVF1      PN-------GLTDYFSGNS-RLASVII-PTEI------E----NLALLPAGRRA-PNPAE
A0A2V5UHJ2      LA-------GLSDLLAGQI-ELQSAIR-PTSA------E----NLSFISAGALP-PNPAE
A0A2V5PST3      HR-------GLSNLLAGNV-SIEEVVQ-RTSI------A----GLSVLTRGACP-PNPTE
A0A2V5PXM3      GF-------GLTDYLTGQK-DFKAVVH-ASGS------E----NFFYIPAGSHA-PNPAE
A0A1V5QB01      GR-------GLSDLLAGQA-KPEAVIQ-RTGL------P----NLDLVATGPFP-PNPAE
A0A1J4XH17      KK-------GILQYCEEGA-TLDDIVN-KNVY------S----NFDVITAGGKA-TNPTQ
A0A7C5LI63      DK-------GLSDVLLGEA-TPEEVVR-HTNI------P----KLDVITSGAYP-ANPAE
A0A7C5P291      EK-------GLADVLLGEA-TPEEVIK-QTDV------P----KLDVITVGSYP-ANPAE
A0A139SU05      TS-------GIIAFYEADG-DLDCDLPNDSTLGIVKLSE----NLSLLRSGGRS-RRPTE
A0A139SPN4      TS-------GLIPFYESGA-SLDTDLSTDPTLGIVKLNE----NLSLLRSGGRS-RRPTE
A0A1V6E7N1      QA-------GIITWFEKGA-DLSVEPQKNPDLGIISLGE----NLSLLCSGGRS-KTPSS
A0A2D9MYT1      PK-------GLSSYLLGKVDTIDSIVH-QTEV------A----NLDIICCGAVP-NNPSE
A0A290QGD9      QR-------GVIDLCGGDT-RVEDVVV-KGPH------P----NLDIIPAGGRA-KNPTH
A0A1D8AS58      IK-------GVIDVCAGTH-TIDQVVI-KGVH------P----NLDVIPAGGRA-KNPTQ
I6AQC1          LK-------GVIDVCAGSA-TIDDVVM-RDVH------P----NLDVIATGGRA-KNPTQ
W0ITH7          LK-------GVIDVCAGSA-TIDDVVM-RDVH------P----NLDVIATGGRA-KNPTQ
A0A258ANJ7      TR------KGVVDLLLEEV-SFAEVCL-SGGI------A----HLAIMPAGKRV-ANPAE
A0A139TLN4      KP-------GTGDLDRVGEGGWRSLLEKSSVS------D----HLDYLFAGTLP-DHPSR
A0A1G3ZFT0      SP-------GFAELIQGSV-NIEEALK-LTSH------H----NLTILPRGNYP-VDPAE
A0A1Z8ZMT6      RP-------GIVNVLNGTA-AANQAITVYPGL------D----TLSVIYSGPKS-PNPGE
A0A2E8MCT7      RP-------GIVNVLNGTA-AANQAITVYPGL------D----TLSVIYSGPKS-PNPGE
A0A290Q2Z2      EP-------GLADLLQGKA-TLEKVTQ-RGVS------P----GLDFIPCGAVG-GFTLS
A0A2A2RGK2      KP-------GLSEVLMRTC-TMKNAIV-PTHI------D----NLQIMTAGGRA-PNPSE
A0A2A2XXF7      KP-------GLSELLMRSC-AMKNAVM-PSHI------D----GLSILTAGGRA-PNPSE
A0A2A2R5D6      EA-------GISEAMRGLG-EAHQYIR-ATSV------P----NMHVITAGDMP-ASEMG
A0A3C1VJ32      NL-------GLTNYLLKQN-TVVEVVQ-TTSV------P----NLDFMASGKLP-SSSMG
A0A2N9NTX7      SI-------GLTNYLLKQN-TLEEVIQ-TTNL------P----SMDFLASGKLP-SSSLG
B9XK55          TI-------GLTNYLLKQN-TLEEVIQ-TTRL------P----NLDFMASGKLP-SSSLG
A0A4P5YMI6      SI-------GVTNVLLKQC-PVEEAIQ-TTPI------P----NLHFLPSGRLQ-SSSLG
A0A2E6T482      NI-------GLTNYLLGQV-XIDEVIQ-TTQI------P----SLHFIPSGKLP-SSSMG
A0A3C0DQZ7      NI-------GLTNYLLGQV-TIDEVIQ-TTQI------P----SLHFIPSGKLP-SSSMG
A0A1Z9CBK5      NI-------GLTNLLLGQN-TLDEVIQ-TSDS------P----NLHFIPSGKLP-SSSMG
A0A2D6ZI96      NI-------GLTNLLLGQN-TLDEVIQ-TSDS------P----NLHFIPSGKLP-SSSMG
A0A358KGZ3      TI-------GLTNLLLGQN-TLDEVIQ-TSES------P----NLHFIPSGKLP-SSSMG
A0A2E9ZQX4      TI-------GLTNLLLGQN-TLDEVIQ-TSES------P----NLHFIPSGKLP-SSSMG
A0A3D5JZU0      TI-------GLTNLLLGQN-TLDEVIQ-TSES------T----NLHFIPSGKLP-SSSMG
A0A2E6HCR0      SI-------GLTNLLLGQN-TLDEVIQ-TTDI------P----NMHFIPSGKLP-SSSMG
A0A1Z8WN04      NI-------GLTNLLLGQN-TVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMG
A0A2D7L1N4      NI-------GLTNLLLGQN-TVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMG
A0A2E2R937      NI-------GLTNLLLGQN-TVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMG
A0A520QQY4      NI-------GLTNLLLGQN-TVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMG
A0A2D5MR66      SI-------GLTNLLLGQN-TVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMG
A0A2E0PDQ1      SI-------GLTNLLLGQN-TVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMG
A0A2E2ZZP9      SI-------GLTNLLLGQN-TVEEVVQ-ITDI------P----NLHFIPSGKLP-SSSMG
A0A7C4LRK7      SI-------GLTNYLLKQN-TLEEVIQ-TTSI------P----TLDFMPSGKLP-SSALG
A0A2A2RGF2      SL-------GLTNYLLGQN-KLEEVVQ-HSTL------A----NLHFLPSGRLP-SSALG
A0A2G4I5Y6      SL-------GLTNYLLGQN-TLEEVIQ-HSPL------A----NLHFLPSGRLP-SSALG
A0A6N6PS97      SI-------GLTNYLLKQN-TLEEVVQ-RTPV------P----TLDFLPSGKLP-SSSLG
A0A3M1I883      SI-------GLTNYLMKQN-TLEEVIQ-TTSL------P----TLDFLPSGKLP-SSALG
A0A1V6JZ45      SI-------GLTNYLMKQN-TLEEVIQ-TTKL------P----MMDFLASGKLP-SSSLG
A0A7C7Z746      SI-------GLTNYLLGQN-TLEEVIQ-TSIN------P----FMDFMPSGKLP-SSSMG
A0A520RRW5      AL-------GLTDYLLATK-SLEEVVQ-TTKH------E----NLDFLPSGKLP-SSSMG
A0A356NPK0      AL-------GLTDYLLATK-SLEEVVQ-TTKH------E----NLDFLPSGKLP-SSSMG
A0A2D7B5P5      AL-------GLTDYLLATK-SLEEVVQ-TTKH------E----NLDFLPSGKLP-SSSMG
A0A3D3XGB5      AL-------GLTDYLLATK-SLEEVVQ-TTKH------E----NLDFLPSGKLP-SSSMG
A0A2V6F8A1      AV-------GLTNYLLRQN-TLEQVIQ-TTSI------P----TLDFLPSGKLP-SSSLG
A0A2V5TNH4      SV-------GLTSYLLRQN-TLEEVIQ-TTSI------P----TLDFLPSGKLP-SSSLG
A0A2V5X5Q6      SV-------GLTNYLLRQN-TLEEVIQ-TTSI------P----TLDFLPSGKLP-SSSLG
A0A4P5QM05      SI-------GLVDYLHGRK-TLDEITH-PSRL------E----NLAIIPSGSLA-MEDVG
A0A4Q3C001      NY-------GLTDYLTGKA-SIDEITR-TTKI------D----NLSFIPSGQLP-SDAIG
B4DB23          SF-------GLTDYLLGRA-EIDEIIK-TTKI------D----NLSFIPSGLLP-GDSVG
A0A6B3L938      KP-------GTVELLTGQA-EFSQAVH-ATGT------E----NLYVMVSGKKA-PSPSE
A0A2V5URB2      AT-------GLADYLAGQE-ELDKVIK-LTSI------P----NLWILNGGSVP-PSPTE
A0A2V2DJ66      SK-------GLVSYIEEGD-SLDDVII-KDYF------Q----NLDVLVCERRA-KNPSQ
R7L5A9          KD-------GLIGHIEEGK-PLEDAII-HDYF------P----NLDVLVCEKRA-KNPTQ
A0A5R8KA81      SV-------GLADVLQGKV-TLEEALH-VSNT------E----NLFILSAGTEI-RNPAE
A0A5B5WU87      KP-------GIGNLDRSGEGGWRSLVEKSSVS------D----HLDYLFAGTLP-DHPSR
R7DZW0          KP-------GLGDLEQAGEGGWRSLVEQSPVS------D----HLDYLFAGTVP-DHPSR
A0A2N8HID1      KP-------GLGDLEQAGEGGWRSLVEQSPVS------D----HLDYLFAGTVP-DHPSR
A0A2N8HS06      KP-------GLGDLEQAGEGGWRSLVEQSPVS------D----HLDYLFAGTVP-DHPSR
A0A6N2TNT9      KP-------GLGDLEQAGEGGWRSLVEQSPVS------D----HLDYLFAGTVP-DHPSR
A0A3R5R2M8      RR-------GLTSILLNRLQTAALPIR---RI------EETGISFDFLGAGPAV-PNPVS
A0A411SUQ6      RK-------GLTSILLQQTTDTTGIIR---PL------GENSRGMDILYTGPMV-PNPVT
A0A2N8HZF2      RK-------GFTSILLQQNPDTTGIIR---PL------GGNSRGMDILYTGPMV-PNPVI
A0A354E720      RK-------GLTSILLRQNPDTAGVIR---PV------GEDTRGMDVLYTGPTV-PNPVT
B2UPB6          RK-------GLTSILLQQTTDTTGIIR---PL------GENSRGMDILYTGPMV-PNPVT
A0A2V6JLK8      EI-------GLTNYLTTDM-DLDQAIL-PTNV------E----NLSILPSGILP-SDAVG
A0A2W5Z1A5      KI-------GLSNYLTSNM-RIEEVIR-PTSV------E----NLSLLPSGVIP-SDAVG
A0A2V6EA09      TA-------GLTSYLTTEM-PLEKVIL-PTAV------E----NLSILPSGVLP-ADAVG
A0A2V6GQI7      TA-------GLTSYLTTEM-PLEKVIL-PTAV------E----NLSILPSGVLP-ADAVG
A0A3C1HEJ2      SP-------GVSDYLSGKK-DFSDIIQ-KSQT------E----NFCFIGAGTKS-PNPSE
A0A522ULD9      RL-------GLTNVLMRDV-PIEETIK-PTAI------P----NLHFLPSGKLP-KTSIG
A0A1V6JU76      PM-------GLTAYLTEQTNRVDDVIQ-TTEV------T----NLDVACCGQIR-SQPSE
A0A2A2XXW5      PV-------GLSAYLSGRTDNFSEFVH-TTEV------P----NLDVICCGAVP-PNPSE
A0A6N6Q6V0      PV-------GLAAYLAERVKSVDEIVH-TSDV------P----NLDIVCAGAAP-SNPSE
A0A1Q6UHJ9      RD-------GIVGYVEDGR-PLEDCVI-KDYY------P----NLDVLPCEKRS-QNPTQ
A0A2V2BXR0      RD-------GIVGYVEDGR-PLEDCVI-KDYY------P----NLDVLPCEKRS-QNPTQ
A0A2D8V0G3      PI-------GLSAYLTGQITDPSEITQ-TTEV------P----NLDLICCGAVP-NNPSE
A0A348S017      PI-------GISSYLTDQVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSE
A0A3C1UUV7      PI-------GISSYLTDQVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSE
A0A350I3V2      PI-------GISSYLTDQVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSE
A0A520RGV5      PI-------GISSYLTDQVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSE
A0A3D3XF90      PI-------GISSYLTDQVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSE
A0A2D7B522      PI-------GISSYLTDQVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSE
A0A356NIC2      PI-------GISSYLTDQVSDIAEITQ-KTEV------P----NLDIICCGAVP-NNPSE
A0A2N8HDG3      RK-------GLSTILLRKVEDPFSVIRTLPEH------A----GVDILYAGPHV-PNPVT
A0A146GCJ0      ID-------GLTDYLSGGA-PLDQVVR-KTDQ------D----NLFLLPAGHRA-PNPSE
A0A2T6D6H8      IS-------GLTNYLSGTA-TLTEVVK-KTPY------E----NLFLLPGGHRA-PNPAE
A0A3D1TI55      DF-------GLTNVLMRDV-PIEETIK-STSV------P----NLHFLPSGKLP-RTSVG
A0A3E1ET42      SV-------GLTNYLTTAL-MLEDVIL-QTPI------E----NLYFMPSGILP-ADAAG
A0A2A2YDW8      SV-------GLSNYLTTEL-MLEDVIL-QTPV------E----NLFFMPSGILP-ADAAG
A0A352XLN9      SV-------GLSNYLTTEL-MLEDVIL-QTPV------E----NLFFMPSGILP-ADAAG
A0A3D0YP62      SV-------GLTNYLTTDL-LLEDVIL-QTPV------D----NLYFMPSGILP-ADAAG
A0A3D3DV47      SV-------GLTNYLTTDL-LLEDVIL-QTPV------D----NLYFMPSGILP-ADAAG
A0A2E5XJ49      SV-------GLTNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2E6SBY8      SV-------GLTNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2E5QMS4      SV-------GLTNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2E7YXQ3      SV-------GLTNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2E3H787      SV-------GLTNYLTTDL-MLEDVIL-QTPV------D----NLYXLPSGILP-ADAAG
A0A2E7AGN1      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2E7AKY7      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A3D4CU34      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2E8M146      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A355S8S2      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2D6DVN8      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A3C1W2R2      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2E3NAY6      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2E3II01      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A368B8C5      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A3R7RBB5      SV-------GLSNYLTTDL-MLEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A2A2QX62      SV-------GLTNYLTTEL-MLEDVIL-QTPV------D----NLYFMPSGILP-ADAAG
A0A4Q3BWH6      SV-------GLTNYLTTEL-MLEDVIL-QTPV------D----NLYFMPSGILP-ADAAG
A0A3N5WCF1      SV-------GLTNYLTTEL-MLEDVIL-QTPV------D----NLYFMPSGILP-ADAAG
A0A4Q3C1K5      SV-------GLTNYLTTEL-MLEDVIL-QTPV------D----NLYFMPSGILP-ADAAG
A0A3R8IT45      LK-------GVIDVCAGSA-TIDDVVM-RDVA------P----NLDVIATGGRA-KSPTQ
A0A2A2PYE8      LK-------GVIDICAGKA-TIADVAI-RNVH------P----NLDVIPAGGRA-KNPTQ
A0A2T6CN73      IR-------GVIDVCSGKA-TLDEVIV-RNQQ------P----NLDVLPTGGRA-KNPTH
A0A2G4G428      TE-------GISRWFNDES-TIDESIV-KNVA------P----NLDVLPVGMSC-RNPTQ
A0A6N6PCD8      GV------IGLSDVLSGKA-VFEEACH-STKV------P----NLTFMPAGNRN-TSPLE
A0A139TV24      RK-------GLSTILLNKVSDLSSVIHPLPDH------P----GVDILYGGPHV-PNPVS
A0A2N8HT11      RK-------GLSTILLRKVEDPFSVIRTLPEH------P----GVDILYAGPQV-PNPVT
R7DS70          RK-------GLSTILLRKVEDPFSVIRTLPEH------P----GVDILYAGPQV-PNPVT
A0A2N8HNL6      RK-------GLSTILLRKVEDPFSVIRTLPEH------P----GVDILYAGPQV-PNPVT
A0A6N6PAZ1      AG----ENGGLTEFLANLA-SFEDVIRHDSGQ------P----NLHLILGGKTA-PNPGE
A0A6I1K459      DL------AGVSDVLLGKA-TLDQSVQ-KTRF------E----NLFLLTAGRTV-PNPAE
A0A139TUL1      SR-------GLAHLLMNPLASPDSVLQSGENF------P----GFDMVPAGPVP-PNPAA
A0A2N8HCB0      AR-------GLVHLLMNPQVSPDSVLQSGRKF------P----GFDLVTAGPVP-PNPVA
A0A2N8HP04      AR-------GLVHLLMNPQVSPDSVLQSGKRF------P----GFDLVTAGPVP-PNPVA
A0A2N8HRJ0      AR-------GLVHLLMNPQVSPDSVLQSGKRF------P----GFDLVTAGPVP-PNPVA
A0A6N2U9Y7      AR-------GLVHLLMNPQVSPDSVLQSGKRF------P----GFDLVTAGPVP-PNPVA
A0A366HAG0      TF-------GLSNYLSSNV-PLEEVVV-QTQV------D----HLYFMPSGVMP-ADSAG
A0A2U8DZK4      TP-------GLADLLQSKV-TLDQCRS-RNIA------P----GLDFIPSGTIS-GFTLS
A0A2T6DFL8      SP-------GLSDLLTAQK-TLDEVIQ-KSIS------P----GLDFIASGAAG-NFTLS
A0A1D8AWD4      DP-------GLTDIVLNKV-PWTAAVV-RDKS------G----LIDFIPAGAAANNVTLG
A0A4Q1C9S2      EP-------GLTDIVLNKV-GWEAAVQ-RDKS------G----LIDFIPAGALANNITLG
A0A178IH18      EP-------GLADLLQGKA-TLDDVTR-RSIA------P----NLDFIPCGSVG-GFTLS
A0A2T6DT99      EP-------GLAEVLQGKA-TLQSVTQ-REIQ------P----NFDFIPCGSVG-SFSLT
A0A1G3ZT33      EP-------GLIDLLLNKA-TLESVVR-RDVV------P----GLDFIASGTPG-GFTLS
A0A3E1E2T2      EP-------GLSEFLLNRK-TLDEVIQ-KGLA------P----NLDFIPSGHAP-GFTLG
B1ZMW1          EP-------GLSDWLMNRQ-PLETIVQ-RELA------P----NLDFIPSGGVP-GFTLG
A0A3M1I8A3      PV-------GLPAYLHGKTDQFEELVT-ATEV------P----NLDMISCAGGS-SQSTE
A0A4V0XS84      NI-------GLSAYLMDQVTDPTEIIN-TSKV------P----NLDVVCCGSIP-MIPSE
A0A351WE84      RI-------GLTNVLMKDS-TLEECVK-PTIV------P----NLSFLPSGRLP-RSMMG
D5ENH7          ER-------GVLDHVEKGM-PIEDVTI-REVY------P----NLDVIPTGGKS-KNPTQ
A0A0R2XQ77      DF-------GLLDHIEKGV-ALDEVIL-KEVY------P----NLDVLPSGGKS-KNPTQ
A0A2E9IN28      DF-------GVLDHIDKGV-DLDEVII-KEVY------P----NLDVLPTGGKS-KNPTQ
A0A6N4WTJ5      EF-------GVLDHIEKDV-SLDEVII-KEVY------P----NLDVLPTGGKS-KNPTQ
A0A1V5QDZ6      RF-------GLTNVLMRDV-PIEETIK-TTSV------P----NLHFLPSGKLP-RTSLG
A0A4Y8P964      RP-------GLSEILTGQV-NVEEAIQ-STAI------P----NVWAIGGGRAA-IHPAD
A0A3D4HF88      EK-------GLQQCLKDGS-RPEDVVH-KDVY------P----NLDVMGSGGHS-QKSTQ
A0A6N6ZHN8      HK-------GVIDYINGND-DLDGLII-HDYM------P----GLDVLVSGGRS-KSPTQ
A0A6G6K641      PI-------GVSDVLAGQC-ALDEVLQ-STPV------A----DLDVLPAGSRS-PNPSE
A0A5B5WI95      RR-------GLTSILLNQVDDPFHIIR---QA------GENNTPFDFLGTGPAA-PNPVT
A0A2N8I9W1      RK-------GLTSILLQQSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVT
A0A4Q5IH27      RK-------GLTSILLQQSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVT
A0A2N8IBZ6      RK-------GLTSILLQQSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVT
A0A2N8IJW9      RK-------GLTSILLQQSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVT
A0A7G6DX28      RK-------GFTSILLQQSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVT
R6J100          RK-------GFTSILLQQSSDTTGIIR---PL------RENSRGMDILYTGPMV-PNPVT
A0A1V6J089      RA-------GLVNVLTGEL-KPEDVIQ-ETGV------P----NLWMLTSGRLR-RGTIG
A0A3C1BZR1      RT-------GMVNVLTGDL-KAEDVIQ-ETGV------P----NLWMMTSGRLR-RGSLG
A0A7C4KLL2      LA-------GLTDILVGSK-SLGEVIHTLEKV------K----NLHWLPAGKPA-PNPAE
A0A1H6KPB7      EY-------GLSNFLTSDL-ALQDVIL-QTHV------D----NLYILPAGPTP-SDASG
A0A2E9ISN4      RH-------GLADWLADDSCDANIHIV-KLKH------E----PISILPAGVFD-DSLPE
B9XAX1          TP-------GVTNYLLGKE-SLSTLVL-KTPY------P----NLYILTAGPKV-ANPAE
A0A5R8KKM9      DV-------GLTTYLSSPM-ELEEVVL-ETPI------E----NLFLMPSGLMP-ADSSG
A0A139TS01      EA-------GLTSYLLEDY-PLEEVIF-QTPV------E----NLYVMPAGPVP-FDPSG
A0A3E1EJT7      TA-------GVISYCLQGS-ALDDIIV-KNVH------P----YLDIISTGGRA-KNPIQ
A0A7C3I5X9      AA-------GLVAYLTGKVATLEEVAQ-RTEV------P----HLDVVCCGSTP-SQPSE
A0A2D5WGA5      NT-------GLTNYLLGQN-TIEEVIQ-TTEL------P----SLHFIPSGKLP-SSSMG
A0A2E7SSH2      NI-------GLTNLLLGQN-TLDEVIQ-TSDS------P----NLHFIPSGKLP-SSSMG
A0A349GXM8      EP-------GVTDVLRHGK-SLREVIQ-PARI------E----NLFVAPSGGDI-DDSAE
A0A4P5YP61      AV-------GVTDYILGQK-TLKEIVQ-QTGI------E----NFSFIPAGTTA-PNPAE
A0A6B2LYM4      KR-------GIIQLIADKG-DLDSYIY-KDFL------P----NLDLLPAGGNT-KKPTQ
A0A6D1VXB3      RP-------GLSEILTGQV-NIEEALQ-LSTI------P----NVWAISGGRAA-IHPTD
I0JYY7          RP-------GLSEILTGQV-NIEEALQ-LSTI------P----NVWAISGGRAA-IHPTD
A0A4R7S1J2      KP-------GLTEYLLGQA-TFTDVIH-SSPI------PAHSGTFRVIPAGFRS-PNPAE
A0A2A2XV69      KN-------GLSDLLTKQL-SLEQVVH-KTKV------E----NLFFMPSGLLP-RDAVG
A0A651H7X9      DT-------GLIDFVRGNA-NFDALAK-RSPH------E----NLDVILTGGRA-KQPSQ
A0A4Y8P842      RP-------GLSEILTGQA-QVEEAVQ-ATSL------P----NVWAIVGGRAA-IHPAD
B3DZK9          RP-------GLSEILTGQA-QVEEAVQ-PTSL------P----NVWAIVGGRAA-LHPAD
A0A5E6MPC4      HP-------GLSELLTNQA-SLGNAVQ-ATAL------P----NVWAIGAGRTP-CHPAD
A0A6N6PKP9      AP-------GLSDLLLGHT-HLGKAIH-LTGI------K----NLSVMPAGKRV-PNLAE
A0A6N6Z250      QP-------GLVDYLAGQR-ELDAVVR-PTEI------P----GLDVITAGDGP-LHSLT
A0A4V1SB02      DVRQNEEFRGLTDVLSGLC-TPDEAIR-ATAV------Q----HLSLMPSGRRA-PNPAE
A0A6N6QEJ2      TV-------GLTNFLLRTA-KLEEVVQ-TTPQ------P----GLDFLPSGKLP-SSSVG
A0A3C1VB86      LP-------GVTDYFLGRK-KFDELCQPHQDV------P----KLSWMAAGSSV-PNPSE
A0A146G2Q9      EV-------GLTDFLTTDV-HLEEVVN-QTKI------D----NLFLMTSGRLP-ADAVG
A0A2T6D3Y2      EV-------GLTDFLTTDV-HLEEVVN-QTKI------D----NLFLMTSGRLP-ADAVG
A0A6N6P5E3      EK-------GLTDFLTQNI-PFEPLVH-STEV------E----NLFFMPSGRLP-IDAVG
A0A2D5VY59      AV-------GLTDFLLGQK-SVEEVIQ-TTKL------D----NLHFLPSGKLP-SSSMG
A0A2D8UZZ4      AV-------GLTDFLLGQK-SVEEVIQ-TTKL------D----NLHFLPSGKLP-SSSMG
A0A353DV86      AV-------GLTDFLLGQK-SVEEVIQ-TTKL------D----NLHFLPSGKLP-SSSMG
A0A2E5EPT8      SP-------GLTDYLLGQG-KLEDVIQ-KTDQ------A----DLDLLPSGKLP-SSAMG
A0A6J4HTK1      KV-------GLTNYLTTDM-RLEDVIV-PTTV------E----NLSLLPSGILP-SDSVG
A0A6N6PHJ5      NL-------GLTNYLLKQN-TLDEVIQ-TTSV------P----TLDFLASGKLP-SSSLG
A0A6M1RXR2      AI-------GLTNYLLRQN-KLEEVIQ-TTQL------P----TLDFMPSGKLP-SSSLG
A0A7C3DXS4      AI-------GLTNYLLRQN-KLEEVIQ-TTQL------P----TLDFMPSGKLP-SSSLG
A0A2V2SDV4      HI-------GLTNYLLKQN-TVEEVIQ-TTSL------P----TLDFMASGKLP-SSSLG
A0A2V5PK75      DL-------GLTNYLLKQN-SLEDVIR-TTPL------P----TLDFLASGKLP-SSSLG
A0A1V6DME1      SI-------GLTNYLLKQN-KLEEVIQ-TSPL------A----TLDFLPSGKLP-SSSLG
A0A3D3DIJ3      AI-------GLTNYLLRQN-TLEEVIQ-TTSL------P----TLDFLSSGKLP-SSSLG
A0A6I1K583      SL-------GLTNYLLGQN-KLEEVIQ-TTSL------P----NLNFLPSGRLP-SSALG
A0A350EWA4      SV-------GLTNYLLGQQ-PIEEVVQ-TSSL------P----SLDVMPSGKLP-SSSMG
A0A5B5WZ91      EV-------GLTSYLLEDY-PLEDVIF-QTPV------E----NLYVMPAGPIP-FDPSG
A0A2N8HD92      EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A2N8HIT2      EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A354EBD3      EL-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A355VEB2      EL-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A2N8IMT3      EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
R6K1U5          EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A2N8IWC2      EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A2N8I441      EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A2N8I3A6      EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A410SCC4      EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A3R5VEW0      EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A411SSG2      EA-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
B2UKW3          EV-------GLTSYLLEDY-PLEEVIF-QTPI------E----NLYVMPAGPTP-FDPSG
A0A7C3HWX0      SL-------GLTNYLLKQA-TLEEVIQ-TTKN------P----LLDFLPSGKLP-SSSLG
A0A1M6RLZ4      TV-------GLTNYLTTDL-MLEDVIL-QTPI------D----NLFFMPSGILP-ADAAG
A0A7C4KPD7      SI-------GLTNFLLKQN-SLAEVIQ-TTSL------P----TLDFMPSGKLP-SSAMG
A0A354T7G8      AT-------GLTNYLTTDI-SLEDVVI-RTQV------E----NLFFLPSGLLP-ADSAG
A0A512MBZ2      AN-------GLTNYLTMNI-RLEDVVV-RTPI------D----NLYFLPSGLLP-ADSAG
A0A2E8MEZ0      SV-------GLTNYLTTDL-ALEDVIL-QTPV------D----NLYFLPSGILP-ADAAG
A0A6B3LBV6      SV-------GLTNYLTTNM-PLEEVIL-QTPI------E----NLYFMPSGILP-ADAAG
A0A2E3EC33      SV-------GLTNYLTTDL-ALEDVIL-QTAY------E----NLYFMPSGILP-SDAAG
A0A2E4GN01      SV-------GLTNYLTTDX-ALEDVIL-QTAY------E----NLYFMPSGILP-SDAAG
A0A1Z8XU55      SV-------GLTNYLTTDL-QLEDVIL-QTAY------E----NLYFMPSGILP-ADAAG
A0A2E1RQR9      SV-------GLTNYLTTDL-QLEDVIL-QTAY------E----NLYFMPSGILP-ADAAG
A0A2E3ISQ4      SV-------GLTNYLTTDL-KLEDVIL-QTAY------E----NLYFMPSGILP-ADAAG
A0A2D6W6F4      SV-------GLTNYLTTDL-XLEDVIL-QTAY------E----NLYFMPSGILP-ADAAG
A0A2D8Z5A8      SV-------GLTNYLTTDL-KLEDVIL-QTAY------E----NLYFMPSGILP-ADAAG
A0A4Q2YKS3      AV-------GLTNYLTTEL-ALEDVIL-QTPV------D----NLYFMPSGILP-SDAAG
A0A6N6P3T8      SV-------GLTNYLTTEL-MLEDVIL-QTPV------D----NLYFMPSGILP-ADAAG
                         *                                  .               

A0A2A2XVF1      LLSSADIPKLFA-QLLKRYDRIVIDSAPVNAVSDTLILAPH-ADKTILVIHAGKTPRKAI
A0A2V5UHJ2      LLGSKKMHDLLE-QLREQFEFIFVDSSPLMAVSDAVFLSTM-VDGTLLVIN-RRTPKPLL
A0A2V5PST3      LLRMRKMKEILT-GLGGSFDFILIDSSPAIAVSDPVILSNV-ADGVILVFHAQKTTAASA
A0A2V5PXM3      LLARTGIDGLID-EALLHFERVIIDSAPVHAVSDTLLILDR-VQTLCLVVRSRKTPRNSV
A0A1V5QB01      LVLRPEFKAFMD-HARRQYDRILFDCPPVMAVSEAAILTSL-AEGVVMVVWAGHTSRKLV
A0A1J4XH17      IFLSPRFQQLLE-EAKSRYSKIIIDTPPLGVVSDIMNILPY-TDGLIFVVKFNSVKRKTA
A0A7C5LI63      MLLSWRLKELMD-WARQHYDRIIVDSPPIMGIADAAILGAA-CDGSLFVIWAGRTSRRYV
A0A7C5P291      LLLGWRLKELLD-WARPRYSRVILDCPPVMGIADSAILGAA-VDGVLFVIWAGRTSRRYV
A0A139SU05      LLESPFFGDLLQ-KLGHYYDLIIIDSPPLGAVTDGLLIAER-VDEVAYVCRFNRAHRKHI
A0A139SPN4      LLESDLFGDLLK-KLGRYYDLIVIDSPPLGAVTDGLLIAER-VDEVAYVCRFNRAHRKHI
A0A1V6E7N1      LLETPAFTQLLE-RLKQQYELVVVDSPPLGAVTDSLLLAER-TDEIVYVCRFNKALRKHI
A0A2D9MYT1      LAGSQRMIDFVE-EVRXKYEKIVFDCPPVSAVSDPLIIAAN-TDGTVFVNKFNKIRREHA
A0A290QGD9      VLNSAGFEHMIA-DLRTRYDRVFIDTPPIAAVSDALIILPL-VDGSIFTVFFNKVRRRAA
A0A1D8AS58      ILNSRNFEHLLA-DLRKRYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFFNRVRRKAA
I6AQC1          ILNSKNFEIMIA-ELRKRYDRIFIDTPPLAAVSDALIILPL-VSGSIFTIFFNKVRRKAA
W0ITH7          ILNSKNFEIMIA-ELRKRYDRIFIDTPPLAAVSDALIILPL-VSGSIFTIFFNKVRRKAA
A0A258ANJ7      LLSTCGVERLKEMAFSAGFDRIVIDTAPLIPVNDTLELGTL-ADSTFLVVRCNRTPADII
A0A139TLN4      LLLHDRVRELMK-ELKEHYDFIFMDCVPYASLADARIAARL-ADATLYVMRAGCVKKRDL
A0A1G3ZFT0      LLSSERCKELIS-LFSKQFDIILIDTAPVLLVTDAVLISAT-SATNYLVLGSNVHQASHL
A0A1Z8ZMT6      LLEPGRLRALIG-MFAANFDHIVIDSAPLLPVPDTRILAPL-VDNLALVIRADHTPVKSI
A0A2E8MCT7      LLEPGRLRDLVE-MFSSNFDHIVIDSAPLLPVPDTRILAPL-VDNLALVIRAEHTPVKSI
A0A290Q2Z2      LLYIDRLKALLA-ELRGRYDRVIFDAPPIIGVSDASVLASV-ADDVLLLVQHRRNPHSMV
A0A2A2RGK2      LLTYENIDRVLK-EALSKYDRVVVDSAPLLAVSDTLLIAPH-IDLCTLVVRAFTTPKKMV
A0A2A2XXF7      LLTYENLERVMS-EALSKYDRIVVDSAPLLAVSDTLLVAPH-VDLCTLVVRAFGTPRKMV
A0A2A2R5D6      AFSGLKLREILN-DLKLRYDIVLLDAPPVLGISDGAVLAHE-VDFTLLVIQHRRYPRDIS
A0A3C1VJ32      ILGSAQMKELIA-ELKQRYDFIFFDSPPILGVSDASILASE-VDLVMQVIQYRRYPQPMT
A0A2N9NTX7      ILSSSQMRDLIN-ELKQRYDFVFFDSPPIMGVSDASILASE-VDMTLQVIQYRRYPQPMN
B9XK55          ILSSAQMKDLIT-ELKQRYDYVFFDSPPIMGVSDASILASE-VDMTLQVIQYRRYPQPMN
A0A4P5YMI6      ILNSPQMREFID-EMKRRYDFVFFDSPPIMGVSDASILVSQ-MDLAMLVVQFRKYPQAMS
A0A2E6T482      ILSSSKMREFVS-EMKSRYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQYRKYPQLMT
A0A3C0DQZ7      ILSSSKMREFVS-EMKSRYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQYRKYPQLMT
A0A1Z9CBK5      VLNSAKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQXMT
A0A2D6ZI96      VLNSAKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQXMT
A0A358KGZ3      VLNSAKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A2E9ZQX4      VLNSAKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A3D5JZU0      VLNSAKMKQFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A2E6HCR0      VLSSSKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A1Z8WN04      VLSSAKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A2D7L1N4      VLSSAKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A2E2R937      VLSSAKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A520QQY4      VLSSAKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A2D5MR66      VLSSSKMKGFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A2E0PDQ1      VLSSSKMKDFVA-DMKGRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A2E2ZZP9      VLSSSKMKDFVA-DMKGRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A7C4LRK7      ILNSAAMRDMIT-ELKNRYEYVFFDSPPIMGISDASILASE-VDMTLQVIQYRRYPQPMT
A0A2A2RGF2      ILNSPQMKDFIK-EAKQRYDFVFFDAPPIMGVSDATVLASG-ADLAILVIQYRKYPQSLA
A0A2G4I5Y6      ILNSPQMKDFIK-EAKRRYDFVFFDAPPIMGVSDATVLASG-ADLAILVIQYRKYPQSLA
A0A6N6PS97      VLSSAQMREFIA-IAKERYDFVFFDSPPIMGVSDASILCSE-VDIALLVIQYRKYPEVMT
A0A3M1I883      IINSPRMKELVD-EVRNRYDFVFFDSPPIMGVSDASILCSM-VDIALLVVQYRKYPQAMT
A0A1V6JZ45      ILNSTRMKEFIK-DVQRRYDFVFFDSPPIMGVSDASILASE-VDLSVLVVQYRKYPQAMT
A0A7C7Z746      ILNSPQMKELIK-SVKARYDFVLFDSPPIMGVSDASILASE-VDLAIQVIQYRKYPQAMT
A0A520RRW5      ILNSSKMKSFIA-EARKRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMT
A0A356NPK0      ILNSSKMKSFIA-EARKRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMT
A0A2D7B5P5      ILNSSKMKSFIA-EARKRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMT
A0A3D3XGB5      ILNSSKMKSFIA-EARKRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMT
A0A2V6F8A1      ILNSVQMKDFIK-EAKKRYDFVFFDSPPIMGVSDASILASE-VDLALLVIQYRKYPQAMT
A0A2V5TNH4      ILNSAQMKDFIK-EAKRRYDFVFFDSPPIMGVSDASILASE-VDLSLLVIQYRKYPQAMT
A0A2V5X5Q6      ILNSTQMKDFIK-EAKRRYDFVFFDSPPIMGVSDASILASE-VDLSVLVIQYRKYPQAMT
A0A4P5QM05      ILNGPRMTELIL-QLKKRYDVVFFDSPPILGVSDASILVSE-VDNTIMVVQYRRFPRNML
A0A4Q3C001      ILNSQRMTDMMQ-KVKHQYDLVFFDSPPILGVSDGSVLASE-VDMTIMVVQHRRFPRAML
B4DB23          ILNSQRMTDLIA-KVKSQYDLVFFDSPPILGVSDGSVLASE-VDVTIMVVQHRRFPRVML
A0A6B3L938      LLLPEDIQSLFD-HAAEHFDRVIVDTPPVLPVSDTRLIAQH-AQKSILVVRALKTPVGAV
A0A2V5URB2      LIGSKKMQDTLA-LLKESYDFIFIDSPPIMPVSDAVVLSTL-TDGMIFVVRGQNTPKHIV
A0A2V2DJ66      MLNSEEFVSMIE-SFREKYDKVFIDSPPIGAVSDAISLLPE-VDGVLYVIKFNTAKRKVV
R7L5A9          TLNSEEFAAMIE-KFRDTYDRIFIDSPPIGAVSDAITLLPT-VDGVIYVVKFNTVKRKTI
A0A5R8KA81      LLASPALAEFFD-SLKGKFDRVVLDTAPIHAVSDTLHMVSF-CKFVCLVARCSKTPRKAV
A0A5B5WU87      LLLHDRVRVLME-ELKEHYDFIFMDCVPYASLADARIVARL-ADATLYVMRAGCVRKRDL
R7DZW0          LLLHDRIRKLME-EVKEQYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRAGCVKKRDL
A0A2N8HID1      LLLHDRIRKLME-EVKEQYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRAGCVKKRDL
A0A2N8HS06      LLLHDRIRKLME-EVKEQYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRAGCVKKRDL
A0A6N2TNT9      LLLHDRIRKLME-EVKEQYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRAGCVKKRDL
A0A3R5R2M8      LLSQPILGQMLE-HLKKQYDTVIIDAPPYGILADTAILASW-SDISLYLTRSGMIDKRYF
A0A411SUQ6      LLSHPLLGHILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYL
A0A2N8HZF2      LLSHPLLGHILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYTVRSGKIDKRYL
A0A354E720      LLSHPLLGQILS-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYTVRSGKIDKRYL
B2UPB6          LLSHPLLGHILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYL
A0A2V6JLK8      ILNSQRMSDTIA-QLKMRYDIVFFDSPPILGVSDASVIASE-VDQTVIVVQHRRFPRAML
A0A2W5Z1A5      ILNSQKMSDLIA-ELKTRYDIIFFDSPPMLGVSDASVLASE-VDQTIIVVQHRRFPRAML
A0A2V6EA09      ILNSQRMSDTIA-ELKSRYDLIFFDSPPMLGVSDASVLASE-VDETIIVVQHRRFPRAML
A0A2V6GQI7      ILNSQRMSDTIA-ELKSRYDLIFFDSPPMLGVSDASVLASE-VDETIIVVQHRRFPRAML
A0A3C1HEJ2      LLAQPGFKQLLT-EALSHFDQVVIDSAPVHPVSDTLLLAHR-AKTVCVVVRANKTPRKAA
A0A522ULD9      LLDSQRMRELVK-DLKARYDYVFFDSPPIIGVTDASILASE-VDGVMLVVQYRKFPKVIS
A0A1V6JU76      LLGSQRMVQFMQ-ELSKRYDRVILDCPPVSAVSDPLILSAM-ADAVVFVTKFNKVRRDHA
A0A2A2XXW5      LIGSNRMVRFLE-EASRRYDRVILDCPPVSAVSDPLIVGAM-ADGMVFVTKFNKIRREHA
A0A6N6Q6V0      LISSKRMHQFLE-EVSSRYDRVILDCPPVSAVADPLVVGAM-CDGVIFVTKFNKIRRDHA
A0A1Q6UHJ9      ALSSEEFISMIA-KFREQYDKVFIDSPPVGAVSDAIALLPY-VDGVIYIVKFNSVSRKAI
A0A2V2BXR0      ALSSEEFISMIA-KFREQYDKVFIDSPPVGAVSDAIALLPY-VDGVIYIVKFNSVSRKAI
A0A2D8V0G3      LVGSKRMGELLD-SLRDRYDRIFVDCPPVSAVSDPLMVGAR-TDGMVFVSKFNKIRREHA
A0A348S017      LVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHA
A0A3C1UUV7      LVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHA
A0A350I3V2      LVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHA
A0A520RGV5      LVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHA
A0A3D3XF90      LVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHA
A0A2D7B522      LVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHA
A0A356NIC2      LVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKFNKIRRDHA
A0A2N8HDG3      LLSLPELGTLIQ-MFKERYDAVIIDSPPYGILADTAILAGH-ADISLYVVRSNRIDKRHI
A0A146GCJ0      LLGGSEFREMLA-KLLLTYDRVVVDSAPVNAVSDALLIASC-VDTACLVVRAGKTPKKAS
A0A2T6D6H8      LLNEDDFQKMLD-ELLKSYDRIVVDTAPVNAVSDVLLIANC-IQTTCLVVHAGRTPKKAV
A0A3D1TI55      ILNSQRMRELIK-TLKSRYDYIFFDSPPIVGVSDASVLASE-VDLALLVVQYRKYPKVMS
A0A3E1ET42      ILNSRRMSELIA-DVKNRFDLVLIDSPPILGVSDASVLASE-VDLTIIVIQHRKLPRSML
A0A2A2YDW8      ILNSRRMSELIA-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTIIVVQHRKLPRNML
A0A352XLN9      ILNSRRMSELIA-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTIIVVQHRKLPRNML
A0A3D0YP62      ILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTIVVVQHRKLPRNML
A0A3D3DV47      ILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTIVVVQHRKLPRNML
A0A2E5XJ49      ILNSRRMSELIE-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A2E6SBY8      ILNSRRMSELIE-DVKQRFDLILVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRXML
A0A2E5QMS4      ILNSRRMSELVQ-DVKQRFDLILVDSPPILGVSDASVLASE-VDLTIVVVQHRKLPRNML
A0A2E7YXQ3      ILNSRRMSELVQ-DVKQRFDLILVDSPPILGVSDASVLASE-VDLTIVVVQHRKLPRNML
A0A2E3H787      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A2E7AGN1      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A2E7AKY7      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A3D4CU34      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-ADLTMIVVQHRKLPRNML
A0A2E8M146      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A355S8S2      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A2D6DVN8      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A3C1W2R2      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A2E3NAY6      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNMX
A0A2E3II01      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A368B8C5      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A3R7RBB5      LLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A2A2QX62      ILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A4Q3BWH6      ILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A3N5WCF1      ILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMLVVQHRKLPRNML
A0A4Q3C1K5      ILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A3R8IT45      ILNSKNFEIMIA-ELRKRYDRIFIDTPPLAAVSDALIILPL-ANGAIFTIFFNKVRRKAA
A0A2A2PYE8      ILNSKGFELMIS-DLRKQYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFFNKVRRKAA
A0A2T6CN73      ILNSKAFETMIA-DLRKRYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFFNKVRRKAA
A0A2G4G428      VISSAKFIEMLT-DMRSRYDRIFIDSPPIGAVSDALNLIPN-VDGVIYVVRYNFVSTRNV
A0A6N6PCD8      LLADERFAKLIR-EAREKFDRVILDSAPINAVSDALLIVKH-ADATAFVVRARKTPTRTV
A0A139TV24      LLSRPEIEQLIQ-SFKRSYDAVIIDAPPYGILADTAIFAKL-ADISLYVIRSNKIDKRYI
A0A2N8HT11      LLSLPEMEELIR-LFKERYDAVIIDSPPYGILADTAILASH-ADISLYVIRSNRIDKRHI
R7DS70          LLSLPEMEELIR-LFKERYDAVIIDSPPYGILADTAILASH-ADISLYVIRSNRIDKRHI
A0A2N8HNL6      LLSLPEMEELIR-LFKERYDAVIIDSPPYGILADTAILASH-ADISLYVIRSNRIDKRHI
A0A6N6PAZ1      LLETGRLHQLLE-QACKDYDVVVLDTAPILAVPDTRIIAPL-AHNFCLVARAEYSPKGAV
A0A6I1K459      LLSGQWARQLIR-EAAGKFDHVVLDNAPVNAVSDALLIVKE-AQTVCLVANARKTSYRVV
A0A139TUL1      LLTQGRFEDLIR-YWRTRYDRIIVDGCPYEAVADASLMARH-ADLVLYLIRCGMIEKQYV
A0A2N8HCB0      LLTQDRFEELLR-YWRARYDRIILDGCPYEAVVDASLMARH-ADLVLYVIRCGMIEKQYV
A0A2N8HP04      LLTQGRLEELLR-YWRARYDRIILDGCPYEAVADASLMARH-ADLVLYVIRCGMIEKQYV
A0A2N8HRJ0      LLTQGRLEELLR-YWRARYDRIILDGCPYEAVADASLMARH-ADLVLYVIRCGMIEKQYV
A0A6N2U9Y7      LLTQGRLEELLR-YWRARYDRIILDGCPYEAVADASLMARH-ADLVLYVIRCGMIEKQYV
A0A366HAG0      LLNSQKFVDLLT-DVKSRFDLVLIDSPPIIGVSDASVLAAE-ADMTIIVVQHRKLPRQML
A0A2U8DZK4      LFYADRLKEILA-DLRTQYDRIVFDAPPIIGVSDSAVITSL-IDHVLLLIQYRRNPLSMV
A0A2T6DFL8      LIYANRLRELMT-TLRGRYDRIVFDSPPIIGVSDTSVLMTV-VDGVVLLIQHRRNPQSMV
A0A1D8AWD4      LLYATKLKALVE-EFRGRYDKVLFDSPPIIGVSDASVLASL-ADGIVLLIQHRRNPESMV
A0A4Q1C9S2      LLYANKLRELVA-HCRSRYDKVLFDSPPIIGVSDASVLGSL-ADGIVLLIQHRRNPESMV
A0A178IH18      LLYADRLKALLA-GLGKSYDRIMFDAPPIIGVSDASVITSL-VDDVLLLVQYRRNPQSMV
A0A2T6DT99      LLYVDRLKALIQ-ELRGQYDRIVFDAPPIIGVSDASVLASV-MDDVLLLVQHRRNPQSMV
A0A1G3ZT33      LLYANRLRELIA-QCKGRYGRIVFDSPPVIGVSDASVLSSV-VDGVVLLIQHRRNPQSMV
A0A3E1E2T2      LLHLNRLKDLIA-TLSGRYDKIVFDSPPIIGVSDASVLASA-VDGTVLLIQHRRNPQSMV
B1ZMW1          LLQVNRLKELIA-TLRGRYDKILFDSPPIIGVSDASVLASV-MDGAVLLIQHRRNPQSMV
A0A3M1I8A3      LVASRRMVQFLD-EARKRYDRVILDTPPVSAVSDPLVVASL-SDGCVFVAKFNKVRREHA
A0A4V0XS84      LIGSKRMEKFLL-DMRERYDRVVFDCPPVAAVSDALVLGTL-ADGVIFVVKFNKIHRDHA
A0A351WE84      IIDSQRMRELVK-DLKSRYDYVFFDSPPIIGITDASILASE-VDGVLLVVQYRKYPRVIS
D5ENH7          VLVSAPFEAMLA-DLRDRYDRIVIDSPPLAAVSDALNLLPL-VDGVVYVIKFNTVKRKTA
A0A0R2XQ77      VLNSARFEAMIA-DLRDRYDRIVIDSPPLAAVSDVLNLLPL-ADGVLYVIKFNTVKRKTA
A0A2E9IN28      VLNSARFEAMFA-DLRDRYDRIVVDSPPLAAVSDALNLLPL-VDGILYVIKFNTVKRKTA
A0A6N4WTJ5      VLNSSKFEAMLA-DLRDRYDRIVIDSPPLAAVSDALNLLPL-ADGVIYVIKFNTVKRKTA
A0A1V5QDZ6      LLDSQRMRELVK-NLKARYDYVFFDSPPIMGVTDASILASE-VDGVLLVVQYRKYPKIIT
A0A4Y8P964      LLGSESMQYLTQ-LVRQYFGYVLIDTPPMHGMPDAAIIGTL-TDGLIYVIQNGRTEKKDF
A0A3D4HF88      ILNDKRFIALLE-DLRGSYDRVFIDSPPVAAVSDALNVLPH-VDGVLYVINYNTVKRKTV
A0A6N6ZHN8      ALSSQRFENLMH-ELRMRYDKVIIDCPPLAPVSDALNVVPQ-ADGVLYVIRFKMVKRKTA
A0A6G6K641      LLSGKSLPRLIR-DLLERYDKVVIDSAPIMAVSDTLVVAPH-VDTICLVVRSHKTPAYAV
A0A5B5WI95      LLSQPLLAQILE-CFRKKYDAVIIDTPPYGILADTAILAAL-SDISLYLIRSGMIDKRYF
A0A2N8I9W1      LLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYL
A0A4Q5IH27      LLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYL
A0A2N8IBZ6      LLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYL
A0A2N8IJW9      LLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYL
A0A7G6DX28      LLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYL
R6J100          LLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRSGKIDKRYL
A0A1V6J089      IMNNTRLRNLLD-HLKEQYDYILLDSPPILGVTDAAILASE-VDGVLLVVQYRKYPKIIS
A0A3C1BZR1      IMNNARLRALMD-SLKEKYDFVLLDSPPILGVTDAAILASE-ADGVLLVVQYRKYPKIIS
A0A7C4KLL2      LLAQPSFKEIIQ-TALQHYDRVVLDTAPIHAVSDTLLICNL-AETTVLVVNSTKTPRKPV
A0A1H6KPB7      VLNSYRMRELLD-EVRRRFDIVLIDSPPVLGVSDASLIVSK-ADATIMVVQPRKLPMKAL
A0A2E9ISN4      KVNAARLRGLVH-SLQQDYDVIIIDTAPVSIFSESLAFCQ--ATGGVLVMMDSLTSQASV
B9XAX1          ELGGDAIKQLLL-EASNQFDRIVIDTPPINAVSDTFILLPL-AQIICLVVRAGKTPKHAI
A0A5R8KKM9      MLNSPRFRQLLD-DVKSRFDIVLIDSPPILGVSDASVLAAE-ADLTLLVVQHRKLPRHML
A0A139TS01      ALNSRKFSELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A3E1EJT7      LFNSKEFETLVV-ELSKRYDRVLFDTPPLGAVSDALNILPL-MDGAIYTIHFNRVRRKAA
A0A7C3I5X9      LLSSRRMTEFIQ-EAGRQYDRVVIDCPPVSAVSDPLIVASQ-VDGVVLVAKFNKVRREMA
A0A2D5WGA5      ILSSAKMKEFVT-EMKSRYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQYRKYPQLMT
A0A2E7SSH2      VLNSSKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQYRKYPQLMT
A0A349GXM8      LLQTVDVRGFFV-DVQDDYDYIFVDTSPVLRVTDTVILASQGIGQVLYVARVNFTPKPMI
A0A4P5YP61      LLGQHGIDGLVA-EALLNYDRVVIDSAPVHAVSDTLLMLKR-VQTVCLVARANKTPRKAT
A0A6B2LYM4      ILGSEEFANLIH-ELRLRYDRVIIDTPPIATVSDAMNILPL-VDGVLMVIRFNMVKRKTA
A0A6D1VXB3      LLGSESMHSLIQ-LVRQYFCYILIDTPPMHGMPDAAIIGSV-TDGLIYVIQAGRIERKDF
I0JYY7          LLGSESMHSLIQ-LVRQYFCYILIDTPPMHGMPDAAIIGSV-TDGLIYVIQAGRIERKDF
A0A4R7S1J2      LLASNAFPQLLE-LALKHFDRVVIDTAPIVAVSDTLVIVPH-VQTVLLVIHWKKTPSTVI
A0A2A2XV69      ILNSQRMMEVIQ-ETKSRFDIVFFDSPPILGVSDASVLSSE-LDLTIIVVQHRRFPKEMI
A0A651H7X9      ILNSADFERFIA-EARQRYQRIIIDTPPLAAVSDSLILLPL-VDGALFTIQFNRVKRKAA
A0A4Y8P842      LLGAESFGQLCR-YLREYFAYILIDTPPMRGIPDASIVSMQ-TEGVLYVIEDGKDDRKEV
B3DZK9          LLGAESFSQLCR-SLREYFTYILIDTPPMRGMPDAPIVSMQ-SEGVLYVIEDGRDDRKEV
A0A5E6MPC4      LLGAAAMAYLCQ-WARGHFTYVILDCPPLVGMPDAAVVATL-TDGVLLVIRDGAVDRSDA
A0A6N6PKP9      LFGRSELPAFLQ-CVAGGYDRVVIDSAPVLTVSDTLLLAPH-ADTACLVVRAGVTPGHAV
A0A6N6Z250      LLHRAALEQLLT-QLRGRYDRILLDSPPILGVSDASLLQPL-ADAVVLVVQYGRFPQPAV
A0A4V1SB02      LLAQGGVEKLIQ-QLLAKYDRIVFDSAPVNAVSDTLSIAPL-ANAVCIVLRYGKTPRRAI
A0A6N6QEJ2      ILNSVQMKEFIE-EVKNRYDFVFFDSPPIMGVSDASILVSE-VEMAILVVQYRKYPQQMT
A0A3C1VB86      LLMSADFQKLLS-EGLAHYDRIVIDTAPILPVSDTLLLAGK-VQTVVLVVQACKTSRKAV
A0A146G2Q9      ILNSQRMVDLIE-EVKHRFDIVFFDSPPILGVSDASVLSSA-VDLTIIVVQHRRFPRAML
A0A2T6D3Y2      ILNSQRMVDLIE-EVKHRFDIVFFDSPPILGVSDASVLSSA-VDLTIIVVQHRRFPRAML
A0A6N6P5E3      ILNSQRMVDLVA-STKAAYDIVFFDSPPILGVSDASVIASS-VDLTLVVVQHRRFPRAML
A0A2D5VY59      ILNSQQMKDFIQ-DVKTRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMT
A0A2D8UZZ4      ILNSQQMKDFIQ-DVKTRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMT
A0A353DV86      ILNSQQMKDFIQ-DVKTRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQYRKYPQAMT
A0A2E5EPT8      ILNSQQMRDFVK-EVQSRYDFILLDSPPLMGVSDATVLTSM-VDLTLLVIQYRKYPQSLA
A0A6J4HTK1      ILNSQRMSDMIA-ELKTRYDIIFFDSPPMLGVSDASVLASE-VDQTIIVVQHRRFPRAML
A0A6N6PHJ5      ILSSSAMKDLIG-ELKARYDIVFFDSPPIMGVSDASILASE-VDMTVQVIQYRRYPQPMN
A0A6M1RXR2      ILSSQAMRELIQ-ELKQRYDFVFFDSPPIMGVSDASILASE-VDMALQVIQYRRYPQPMN
A0A7C3DXS4      ILSSAAMRDLIN-ELKQRYDFVFFDSPPIMGVSDASILASE-VDLTLQVIQYRRYPQPMN
A0A2V2SDV4      ILNSPQMKELIG-QLKQHYDFVFFDSPPVMGVSDASIIASE-VDMTLQVIQYRRYPQPLN
A0A2V5PK75      ILSSAQMKELIN-ELKQRYDFVFFDSPPIMGVSDASILASE-VDMTLQVIQYRRYPQPMN
A0A1V6DME1      ILNSAQMKDLIA-QLKQRYDFVFFDSPPIMGVSDASILASE-MDMTVQVIQYRRYPQPMN
A0A3D3DIJ3      ILSSTQMKDLIG-ELKQRYDFVFFDSPPIMGVSDASILASE-VDMTIQVIQYRRYPQPMN
A0A6I1K583      ILNSPQMKEFIK-EAKRRYDFVFFDAPPIMGVSDATVLASG-ADLAILVIQYRKYPQSLA
A0A350EWA4      ILSSVRMKQLVK-ELKSRYDFVFFDSPPIMGVSDASVLASE-VDLTLQVIQYRRYPQPMT
A0A5B5WZ91      ALNSRKFSELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A2N8HD92      TLNSRKFSELLQ-EVKQRFDMVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A2N8HIT2      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A354EBD3      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A355VEB2      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A2N8IMT3      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
R6K1U5          ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A2N8IWC2      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A2N8I441      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A2N8I3A6      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A410SCC4      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A3R5VEW0      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A411SSG2      ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
B2UKW3          ALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQPRKLPLKAL
A0A7C3HWX0      ILNSQRMKDFIQ-DVKKRYDFVFFDSPPIMGVSDASILASE-VDLAILVVQYRKYPQAMT
A0A1M6RLZ4      ILNSRRMSDLVQ-DVKQRFDLVLIDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRKML
A0A7C4KPD7      ILNSPSMKEMIS-ELKRRYDFVFFDSPPIMGISDASILASE-VDMTLQIIQYRRYPQPMT
A0A354T7G8      LLNSQRMVDLIA-DVKSRFDLVLIDSPPILGVSDASVLANE-ADMTMIVVQHRKLPRHML
A0A512MBZ2      ILNSQRMSELIA-DVKSRFDLVLIDSPPILGVSDASVLSNE-ADMTMLVVQHRKLPRHML
A0A2E8MEZ0      ILNSRRMSELLQ-DVKQRFDLVLVDSPPILGVSDAAVLASE-VDLTMVVVQHRKLPRNML
A0A6B3LBV6      ILNSRRMSELIQ-DVKSRFDLVLVDSPPILGVSDASVLCSE-VDMTVVVIQHRKLPRNML
A0A2E3EC33      ILNSRRMSELIA-DVKSRFDLVLVDSPPILGVSDASVLASE-VDLTIIVIQHRKLPRGML
A0A2E4GN01      ILNSRRMSELXA-DVKSRFDLVLVDSPPILGVSDASVLASE-VDLTIIVIQHRKLPRGML
A0A1Z8XU55      ILNSRRMSELIA-DVKSRFDLVFIDSPPILGVSDASVLSSE-VDLTIIVIQHRKLPRGML
A0A2E1RQR9      ILNSRRMSELIA-DVKSRFDLVFIDSPPILGVSDASVLSSE-VDLTIIVIQHRKLPRGML
A0A2E3ISQ4      ILNSKRMSELIA-DVKSRFDLVFIDSPPILGVSDASVISSE-VDLTIIVIQHRKLPRGML
A0A2D6W6F4      ILNSRRMSELIA-XVKSRFDLVFIDSPPILGVSXASVISSE-VXLTIIVIQHRKLPRGML
A0A2D8Z5A8      ILNSRRMSELIA-DVKSRFDLVFIDSPPILGVSDASVISSE-VDLTIIVIQHRKLPRGML
A0A4Q2YKS3      ILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
A0A6N6P3T8      ILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQHRKLPRNML
                                  :  :..*  *   .                            

A0A2A2XVF1      QRSVHLLR-KAQA--KVAGFVLNR-LPTGRAAGYYYYY-------YGDKYEKDSVYGTKT
A0A2V5UHJ2      RKARARLT-TPHS--KILGMLLNR-INIH--NNEYGGY-------YQQYY--EYYSQDPP
A0A2V5PST3      RKTKERFD-AIRA--PILGVILNG-INL---EDPDYAY-------YRHYYGSDYGTVAAA
A0A2V5PXM3      LRAVQMLN-EAGA--PLAGVILNL-IPRSG-GGYGYYY-------YDSYYAYGYYGKYGH
A0A1V5QB01      QLAAKLIQ-ERGA--RILGCVLNN-LDF---SRVGYYY-------YSTYY--GYYDYDHI
A0A1J4XH17      KAHLSRLL-ESNV--PVFGAVINQ-ISLDIVNYYYSNY-------YDKTYYDYYNNGELP
A0A7C5LI63      RVAKMTAV-SRGA--KLFGFILNNLEPGRVGYYHYYPY-------YYSYYSRGYYYAHKE
A0A7C5P291      RVAKTTAV-SRGA--KIFGFVLNNLEPGRVGYYHYYPY-------YYSYYSHGYYYARSE
A0A139SU05      QLYMRALR-NAKT--EVLGVVLNGLTPRRVEYYSNYRY-------YRSYG--KYTERVDR
A0A139SPN4      QLYMRALR-NAKT--EILGVILNGLAPRRVEYYSNYRY-------YRSYG--KYTNVEPA
A0A1V6E7N1      QLYTKLLL-SGKN--EVLGIVLNGLSPRRIKYYSNYRY-------YRSYK--KYYGTHG-
A0A2D9MYT1      RKTVQRVQ-DAGI--NIVGVCIND-LDFE--GKDSYYY-------SYYYYQNRYYASHYK
A0A290QGD9      QYAARRLI-DSHV--PNFGAVLNG-LNMNVSGYYYGQY-------TDKSYKDYYVVMSKK
A0A1D8AS58      QFSARKLL-EANV--PCFGAVLNG-LNLAVSGYYYAQY-------YDKSYKDYYVTMAKQ
I6AQC1          QHAARKLL-ESNV--PVYGAVLNG-LNLAVAGYYYAQY-------YDKSYKDYYVMTESE
W0ITH7          QHAARKLL-ESNV--PVYGAVLNG-LNLAVAGYYYAQY-------YDKSYKDYYVMTESE
A0A258ANJ7      LEAIRKLH-QTGI--PITGLVLNR-LTQRTRS-------------FDQYYHRSYYKGSET
A0A139TLN4      SSLQKTWK-SGEL--KRMGIVLCD-VENRSRPSRKYAM-------YRSFDTSSPCPGK--
A0A1G3ZFT0      EMAIKRLS-SAGV--TVHGSIFNFHNATS--KKSSYQY-------YSSHY---YYEDESD
A0A1Z8ZMT6      QGALEMLK-DDGV--SSSGVILND-FTENRLQGGKYGY----------GYGYGQYGDDA-
A0A2E8MCT7      QRAFDMLE-DDGV--FSSGVILND-FTENRLQGGKYGY----------GYGYGHYGDDT-
A0A290Q2Z2      VRAQQIIE-GLHK--QIVGVVLNR-VPVN--SSDDYGY-------YTRNY--AYYSAREN
A0A2A2RGK2      MRAIKSLE-ETKT--TPAGLILNF-LPSG--RGGYYAY----------YYSGKYYGSYGA
A0A2A2XXF7      ARAIKSLE-ETKT--HPAGLILNF-LPSG--RGGYYAY----------YYSGKYYGSYGA
A0A2A2R5D6      MRAKRAVE-EVKG--NLLGVVLNA-VAVK--SDEAYYY-------YSSYG--NYYYNRNG
A0A3C1VJ32      IRAKQMIE-KVGG--NFVGMVLNN-INMS--QDEGYYY-------YSGYYHDYYYSRDPS
A0A2N9NTX7      IRAKQLIE-KVGG--NLIGIVLNN-INMS--QDESYYY-------YSGYYHDYYSRNEDQ
B9XK55          IRAKQLIE-KVGG--NLIGIVLNN-INMS--QDESYYY-------YSGYYHDYYSKNEDE
A0A4P5YMI6      VRAKQTIE-KVGG--NLMGAVLNN-INIA--QDSYYYY-------YSGYQYT--------
A0A2E6T482      QRAKEMVT-KVGG--DLVGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSREK
A0A3C0DQZ7      QRAKEMVT-KVGG--DLVGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSREK
A0A1Z9CBK5      QRAKDMVV-KVGG--NLVGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSREG
A0A2D6ZI96      QRAKDMVV-KVGG--NLVGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSREG
A0A358KGZ3      QRAKDMVI-KVGG--DLVGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSRET
A0A2E9ZQX4      QRAKDMVI-KVGG--XXVGVVLNN-INIS--QDSYYYY-------YSGYYXDYYXKSRET
A0A3D5JZU0      QRAKDMVI-KVGG--DLVGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSRET
A0A2E6HCR0      QRAKDMVI-KVGG--DLAGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSREN
A0A1Z8WN04      QRAKEMVT-KVGG--NLIGVVLNN-INIS--QDSYYYY-------YSGYYYDNYYKSRED
A0A2D7L1N4      QRAKEMVT-KVGG--NLIGVVLNN-INIS--QDSYYYY-------YSGYYYDNYYKSRED
A0A2E2R937      QRAKEMVT-KVGG--NLIGVVLNN-INIS--QDSYYYY-------YSGYYYDNYYKSRED
A0A520QQY4      QRAKEMVT-KVGG--NLIGVVLNN-INIS--QDSYYYY-------YSGYYYDNYYKSRED
A0A2D5MR66      QRAKEMVT-KVGG--NLVGVVLNN-INIS--QDSYYYY-------YSGYYYDNYYKSREN
A0A2E0PDQ1      QRAKDMVT-KVGG--NLVGVVLNN-INIS--QDSYYYY-------YSGYYYDNYYKTREN
A0A2E2ZZP9      QRAKDMVT-KVGG--NLVGVVLNN-INIS--QDSYYYY-------YSGYYYDNYYKSREN
A0A7C4LRK7      IRAKQMIE-KVGG--NLMGIVLNN-INMS--QDSYYYY-------YSGYFEESYYQQDGE
A0A2A2RGF2      IRSRQMVE-KVGG--RLIGVVLNN-INLA--SDASYYY-------YSGYN---YHSNNNA
A0A2G4I5Y6      IRSRQMVE-KVGG--RLIGVVLNN-INLA--SDASYYY-------YSGYN---YRSNNND
A0A6N6PS97      VRAKQMVD-KVGG--NLIGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYSKHDD
A0A3M1I883      LRAKQMVQ-KVGN--NLLGIVLNN-INIS--QDSYYYY-------YSGYYYDYYYGSSSE
A0A1V6JZ45      LRAKQMVE-KVGG--TMLGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYSKGEY
A0A7C7Z746      IRAKQMVE-KVGG--NLLGVVLNN-INIS--QDENYYY-------YSGYYYDYYYSRRDD
A0A520RRW5      IRAKQMVE-KVGG--NLLGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYSKQDG
A0A356NPK0      VRAKQMVE-KVGG--NLLGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYSKQDG
A0A2D7B5P5      VRAKQMVE-KVGG--NLLGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYSKQDG
A0A3D3XGB5      VRAKQMVE-KVGG--NLLGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYSKQDG
A0A2V6F8A1      LRAKQMVE-KVGG--TMLGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYSKREE
A0A2V5TNH4      IRAKQMVE-KVGG--ALLGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYAKREE
A0A2V5X5Q6      IRAKQMVE-KVGG--AMLGVVLNN-INIS--QDSYYYY-------YSGYYYD-YYAKREE
A0A4P5QM05      QRVKSTVA-HVGG--NLIGVVLNN-VDIH--QDDSYRY-------YSNYK--DYYGPKRD
A0A4Q3C001      QRVKQAVI-QVGG--TLIGVVLNN-VDTR--HDEGYSY-------YNNYN--DYYAPRTE
B4DB23          QRVKQAVL-NVGG--RLIGVVLNN-VDAK--HDDGYSY-------YYNYN--EYYGPRRG
A0A6B3L938      LRARDLLQ-DAKI--SLAGVVVNA-LRVKHTGGSGYYGYHG----YGEYGHEGYYGDND-
A0A2V5URB2      REAISQLG-NNRS--KILGVVLNR-VDV---RSAEYRD-------YYRYYNPEFYYPSAR
A0A2V2DJ66      RRCVRRMM-ESNV--PILGAVMNM-VNTGAVSGYSINY-------YDKNYQNYYMTPPEI
R7L5A9          RAYIRRMM-ESNV--PILGAVMNM-VNPSSASVYSMNY-------YDKSYQNYYTAPMES
A0A5R8KA81      IRAAQMLE-EAGK--APSGIILNM-LPARRNSGLYYHY-------YSGSYGKPVYGKPVA
A0A5B5WU87      PCLQKTWK-NGKL--KRMGIVLCD-VENHSRSSRKYAM-------YRSFDTSSPCPGK--
R7DZW0          AGLQKIWK-NGEL--KRMGIVLCD-VEPHGRSSRGYAV-------YRSLDTSSPCAGK--
A0A2N8HID1      AGLQKIWK-NGEL--KRMGIVLCD-VEPHGRSSRGYAV-------YRSLDTSSPCAGK--
A0A2N8HS06      AGLQKIWK-NGEL--KRMGIVLCD-VEPHGRSSRGYAV-------YRSLDTSSPCAGK--
A0A6N2TNT9      AGLQKIWK-NGEL--KRMGIVLCD-VEPHGRSSRGYAV-------YRSLDTSSPCAGK--
A0A3R5R2M8      PQVQKLAD-TGKL--PNLAFIING-VNF---KSASYNY-------YGYGYGYGYGTGSRS
A0A411SUQ6      LQIQQLAD-QGKL--PNMAYIING-VNF---KSASYSY-------YGYGYGYQYGYGTK-
A0A2N8HZF2      LQIQQLAD-QGKL--PNMAYIING-VNF---KSASYSY---------YGYGYQYGYGTK-
A0A354E720      TQIQQLAD-QGKL--PNMAYIING-VNF---KSASYSY-------YGYGYGYQYGYGAK-
B2UPB6          LQIQQLAD-QGKL--PNMAYIING-VNF---KSASYSY-------YGYGYGYQYGYGTK-
A0A2V6JLK8      TRVKQAIL-GVGG--TVLGVVLNN-VDLK--HDQNYYY-------YTNYY--GYYQPRDK
A0A2W5Z1A5      TRVKQAIT-GSGG--TVLGVVLNN-VDLR--HDQNYYY-------YTNYY--GYYQPQDR
A0A2V6EA09      TRVKQAIL-SVGG--TLLGVVLND-VDLK--HDQNYYY-------YTHYY--AYYQPRGK
A0A2V6GQI7      TRVKQAIL-SVGG--TLLGVVLND-VDLK--HDQNYYY-------YTHYY--AYYQPRGK
A0A3C1HEJ2      LTAVQKLQ-KSRA--NIAGFILNG-ITLL--HRSDYYD-------YSDYY--ARYREKDH
A0A522ULD9      MRAKRMIE-NTGS--HILGVVLNN-INIM--RDDYYYY-------YHSYYADYYYRSQES
A0A1V6JU76      RRTIQRIQ-DAGI--HICGVVLND-IDFE--GRDSYYY-------SYTYYQNRYYSSYHR
A0A2A2XXW5      LRSVQRIQ-DSGI--HLVGLVLND-IDFE--GKDSYYY-------SYHYYQNQYYSSHYR
A0A6N6Q6V0      LRSVQRIQ-DAGI--NLIGLVLND-IDFE--GKDSYYY-------SYHYYQNRYYSSHYR
A0A1Q6UHJ9      QKNVRRLM-VSNV--PVVGAIMNM-VSQGSAAGYSLNY-------YDKSYQNYYTMPDVE
A0A2V2BXR0      QKNVRRLM-VSNV--PVVGAIMNM-VSQGSAAGYSLNY-------YDKSYQNYYTMPDVE
A0A2D8V0G3      RKTVQRIQ-DAGI--YILGTVIND-IDFEGKDSYYYSYYY-----YQNRYYASYYSNEKK
A0A348S017      RKTIQRIQ-DAGI--YILGTVIND-IDFEGKDSYYYSYYY-----YQNRYYASYYSNEKK
A0A3C1UUV7      RKTIQRIQ-DAGI--YILGTVIND-IDFEGKDSYYYSYYY-----YQNRYYASYYSNEKK
A0A350I3V2      RKTIQRIQ-DAGI--YILGTVIND-IDFEGKDSYYYSYYY-----YQNRYYASYYSNEKK
A0A520RGV5      RKTIQRIQ-DAGI--YILGTVIND-IDFEGKDSYYYSYYY-----YQNRYYASYYSNEKK
A0A3D3XF90      RKTIQRIQ-DAGI--YILGTVIND-IDFEGKDSYYYSYYY-----YQNRYYASYYSNEKK
A0A2D7B522      RKTIQRIQ-DAGI--YILGTVIND-IDFEGKDSYYYSYYY-----YQNRYYASYYSNEKK
A0A356NIC2      RKTIQRIQ-DAGI--YILGTVIND-IDFEGKDSYYYSYYY-----YQNRYYASYYSNEKK
A0A2N8HDG3      STVQQLAD-SGQL--PNLGFIINA-VDF---KAGSYSY-------YGYGYHYGNTSKNAH
A0A146GCJ0      LRAVKQLQ-KSGA--KLAGFIFNR-LPVGGRSAGYYYY----------YYGGEYSKNSVY
A0A2T6D6H8      LRAVRQLQ-KTGA--RLGGFVFNR-LPVGGQSAGYYYY----------YYGGDYAKNGVY
A0A3D1TI55      NRAKKMVE-NVGG--RLVGVVLNN-INVM--RDDYYYY-------YHTYY-SHYYGPQEE
A0A3E1ET42      LRVKQAIE-NVGG--NLLGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYSPTNA
A0A2A2YDW8      LRVKQAVE-NVGG--HVLGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPAES
A0A352XLN9      LRVKQAVE-NVGG--HVLGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPAES
A0A3D0YP62      VRVKQAVE-NVGG--HVIGVVLNN-VDVR--SDNQYQY-------YTSYY--TYYAPTTG
A0A3D3DV47      VRVKQAVE-NVGG--HVIGVVLNN-VDVR--SDNQYQY-------YTSYY--TYYAPTTG
A0A2E5XJ49      LRVKQAVE-NVGG--QVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A2E6SBY8      LRVKQAVE-NVGG--QVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPTAD
A0A2E5QMS4      MRVKAAVE-NVGG--QVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSSD
A0A2E7YXQ3      MRVKAAVE-NVGG--QVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSSD
A0A2E3H787      LRVXQAVE-NVGG--QVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A2E7AGN1      MRVKQAVE-NVGG--YVVGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A2E7AKY7      MRVKQAVE-NVGG--YVVGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A3D4CU34      LRVKQAVE-NVGG--YVVGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A2E8M146      VRVKQAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A355S8S2      VRVKQAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A2D6DVN8      VRVKEAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A3C1W2R2      VRVKEAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A2E3NAY6      VRVKEAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A2E3II01      VRVKEAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A368B8C5      VRVKEAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A3R7RBB5      VRVKEAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSAD
A0A2A2QX62      MRVKQAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAP-AE
A0A4Q3BWH6      MRVKQAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAP-AE
A0A3N5WCF1      LRVKQAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAP-AE
A0A4Q3C1K5      LRVKQAVE-NVGG--NVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAP-AE
A0A3R8IT45      QHAARKLL-ESNV--PVFGAVLNG-LNLAVAGYYYAQY-------YDKSYKDYYVMAGAE
A0A2A2PYE8      QFSAKKLL-EANV--PNFGAVLNG-LNLAVSGYYYAQY-------YDKSYKDYYVVMSKN
A0A2T6CN73      QFAAKRLL-DSNV--PNFGAVLNG-LNLVVSGYYYAQY-------YDKSYKDYYVV-SKG
A0A2G4G428      AECITRLR-EVGV--PILGAVLNR-MSMR--MASVYTDS------FDASYEKYYNAAAGA
A0A6N6PCD8      LRALHLLE-GADQ--TPAGFILNR-LPSR--LAGYYYY-------DAGNYSSAGVYGI--
A0A139TV24      ATIQQLAN-EGKL--PNMGFVINA-VDF---KAAGHHY-------YGYGYHYNYGYNTTN
A0A2N8HT11      ATVQQLAE-SGQL--PNMGFVINA-VDF---KSSSYSY-------YGYGYHYGNTSKNNP
R7DS70          ATVQQLAE-SGQL--PNMGFVINA-VDF---KSSSYSY-------YGYGYHYGNTSKNNP
A0A2N8HNL6      ATVQQLAE-SGQL--PNMGFVINA-VDF---KSSSYSY-------YGYGYHYGNTSKNNP
A0A6N6PAZ1      HRTIQILA-EDGT--HISGIIFNGFVEKRSLMGENYSYGYYKTSRYGRAYRYGYDAAYGA
A0A6I1K459      QRALEMLR-RAGA--KPSGVVLNF-LPQS--AGSGYYY-------YYSGN--KYYGKKGV
A0A139TUL1      PSIQEVAA-RGEF--RSVALILNA-ENF---KNSRFHY-------YSEYSGSETAG----
A0A2N8HCB0      PAIQGLAD-KGEF--RAVALILNA-ENF---KNSRFHY-------YSEY--SETDG----
A0A2N8HP04      PVIQGLAD-KGEF--RSGAVILNA-ENF---KNSRFHY-------YDEY--SETDG----
A0A2N8HRJ0      PVIQGLAD-KGEF--RSGAVILNA-ENF---KNSRFHY-------YDEY--SETDG----
A0A6N2U9Y7      PVIQGLAD-KGEF--RSGAVILNA-ENF---KNSRFHY-------YDEY--SETDG----
A0A366HAG0      QRVKQTIE-QVGG--KVAGAVLNN-VNIN--SDATYGY-------YTSYY--GYYSGDGK
A0A2U8DZK4      LRAQQTIL-GLDK--EILGVVLNR-VPKN--AGADYAY-------YSKNY--AYYGSKSA
A0A2T6DFL8      LRAQQIVG-GVKA--SILGIVLNQ-IPGN--AGGDYGY-------YTSNY--AYYHEGSR
A0A1D8AWD4      QRAKQIID-GLKV--PVIGVVLNQ-VPTG--TGEDYSY-------YTNNY--SYYS---H
A0A4Q1C9S2      QRAKQIIDQQVKV--PVIGVVLNQ-VPTG--SGEDYGY-------YTNNY--SYYS---H
A0A178IH18      VRAQQIIA-GLHK--EILGIVLNR-VPKN--AGDDYGY-------YTNNY--AYYSSRDV
A0A2T6DT99      MRAQQIIE-GLGK--TIVGIVLNR-VPRN--SGEDYGY-------YTHNY--AYYSSHGR
A0A1G3ZT33      LRAKQIIE-GLKT--PLVGVVLNQ-VPHG--SGDDYGY-------YTGNY--DYYSEGHK
A0A3E1E2T2      VRAQQIVE-SLKA--PLLGVVLNQ-VPLN--SGDDYGY-------YTNNY--SYYSEGSG
B1ZMW1          LRAQQIVE-AIKT--PLLGVVLTQ-VPEN--AGGDYGY-------YTHNY--SYYSDGSH
A0A3M1I8A3      RKTLRRLL-DAGV--HICGVLLND-IDFE--GRDSYYY-------SYYFYQNRYYSSYRS
A0A4V0XS84      RKSIQRIQ-SAGI--NIFGTVVND-ID----YSNSQYY-------YSEYYSNQIASPEFG
A0A351WE84      SRAKRMVE-NVGG--KLLGVVLNN-INIM--RDDYYYY-------YHASY--TQYNPD--
D5ENH7          VANVRRLW-ESNT--PVFGAILNN-ITTSL-SSYYYSQ-------YSDKAYQDYYIHQED
A0A0R2XQ77      VVNVRRLW-ESNT--PIFGAILNN-ISSTL-ASYYYSS-------YSDKAYQDYYISQDV
A0A2E9IN28      VVNVRRLW-ESNT--PVFGAILNN-ITSSL-SSYYYSN-------YSDKAYQDYYIHHEE
A0A6N4WTJ5      VVNVRRMW-ESNT--PVFGAILNN-ITSSL-SNYYYSS-------YSDKAYQDYYIHQDE
A0A1V5QDZ6      SRAKRMIE-NVGG--NVLGVVLNN-INIM--RDDYYYY-------YHSYYSQYYQSDESK
A0A4Y8P964      LQNLQILA-SVNT--KILGVVLNK-------TDGSYQS-------YYSYY--AYKAKDEL
A0A3D4HF88      KASVRRLF-ESNV--PVFGVIMNQ-IT----AAMSSYY-------YTNYYEKSYDKYYTG
A0A6N6ZHN8      SINIRRLR-ESNV--PVFGAILNN-IN----TNVAGYY-------YSHYYYDKSYKNYYM
A0A6G6K641      MRASVALR-KTDK--IPAGIVLNR-MPAA--AAGQYYY-------YSSSH----------
A0A5B5WI95      NQIQKLAD-SGKL--PNLAYIINA-VDF---KSSSYSY-------YGYNYGYRYSYGSG-
A0A2N8I9W1      LQIQQLAD-QGKL--PNMAYIING-VNF---KSSSYSY-------YGYGYGYQYGYGSGE
A0A4Q5IH27      LQIQQLAD-QGKL--PNMAYIING-VNF---KSSSYSY-------YGYGYGYQYGYGSGE
A0A2N8IBZ6      LQIQQLAD-QGKL--PNMAYIING-VNF---KSSSYSY-------YGYGYGYQYGYGSGE
A0A2N8IJW9      LQIQQLAD-QGKL--PNMAYIING-VNF---KSSSYSY-------YGYGYGYQYGYGSGE
A0A7G6DX28      LQIQQLAD-QGKL--PNMAYIING-VNF---KSSSYSY-------YGYGYGYQYGYGSGE
R6J100          LQIQQLAD-QGKL--PNMAYIING-VNF---KSSSYSY-------YGYGYGYQYGYGSGE
A0A1V6J089      LRAKRMIE-NAGG--QVLGAVLNN-INI---MRDDYYY-------YYHYTTRKYYGVVRH
A0A3C1BZR1      LRAKRMIE-NAGG--RLMGAVLNN-INI---MRDDYYY-------YYHYATKKYYGSSKH
A0A7C4KLL2      LRSIQLLR-NAGG--NPCGVVLNL-VPLRRGGGYYYDS-------YYYYHTDSYHKEKNK
A0A1H6KPB7      VREKMVIE-NAGG--HLMGVVMNN-VDIS--GDTQYQY-------YTTYY--SYYSPTEG
A0A2E9ISN4      QNCLNELR-GI----RTLGFCVNG-VNESYLRSNGYDA-------YGSYGT---------
B9XAX1          MRAVELMA-RANV--PPTGIVLNF-LP----QHSGYRY-------YYHYTPRNGYKSIGV
A0A5R8KKM9      QRVKHSVD-AVGG--DVVGVVLNN-VDIH--SDNTYGY-------YTSYY--TYYNSDQR
A0A139TS01      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSAESG
A0A3E1EJT7      QQCTRRLL-AVNV--PVFGAVMNG-MNTGI-TGDYYME-------NNSKLFKEYYNPGGE
A0A7C3I5X9      RKSVQRLL-DAGV--QPCGVVIND-IDFE--GRDAYYY-------SYYYYQNRYYKGY--
A0A2D5WGA5      QRAKEMVT-KVGG--DLVGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSREK
A0A2E7SSH2      QRAKDMVI-KVGG--NLVGVVLNN-INIS--QDSYYYY-------YSGYYYDYYYKSRET
A0A349GXM8      RYSLDMLK-DA----NILGLVMNS-IEMHKISSLYYAY-------QYPNY--AYYSNAYA
A0A4P5YP61      LRAVQMLR-QAEA--PLAGLILNR-LPRR--VGLGGYY-------YDSYYNYSYYGKYGA
A0A6B2LYM4      SVNIRRLR-ESNV--PIFGAVLNN-LN----THVAGYY-------YSHYYDKSYKSYKHY
A0A6D1VXB3      LQNLQILA-TVNA--RILGVVLNK-------TTTSYQS-------YYSYY--AYKEKNEI
I0JYY7          LQNLQILA-TVNA--RILGVVLNK-------TTTSYQS-------YYSYY--AYKEKNEI
A0A4R7S1J2      QRALNLLG-ESGK--SPSGLILNN-VPEG--SRGYYYH-------YSP----GYYGSKGV
A0A2A2XV69      QRVKQAIE-NVGG--NILGVVLNN-VDIR--HDQSYGY-------YTSYY--NYYSPSKN
A0A651H7X9      QTVVRRLS-ETSV--PVFGAILNG-LNLSLAGYYYAQY-------YDKSYKDYYVVTSED
A0A4Y8P842      QNNVEAFS-RINT--RILGIILNK-ADPV--SSSYYYS-------YSYKY----------
B3DZK9          QNNIEAFS-RINS--RVLGIILNR-ADPL--SHSSYY--------YAYKY----------
A0A5E6MPC4      RRVVETLS-VVNT--RILGIVLNR-V-----QQANRSY-------YAYHY--AYRLSEEQ
A0A6N6PKP9      VRAVEKLR-ESGA--KIAGFVLNA-LPIR--NGGYYYH-------YQAPG----------
A0A6N6Z250      ERAARSVR-QHGS--LVRGVIFNQ-VPAR--QQGAYGY-------YGYGYRR--------
A0A4V1SB02      LRAVGLLR-KSNA--RMAGVIMNR-MPAR--RGASYYY-------Y--YYGDPYVKDGVY
A0A6N6QEJ2      LRAKQMVE-KIGGAERLLGVVLNN-INIS--QDSYYYY-------YSGYYYDYYSKSEDS
A0A3C1VB86      ERSVQLLK-NASA--PTGGVVLNL-LPKRRLSGYYYSY-------HHGYGYGNYGEKAA-
A0A146G2Q9      QRVKQAVL-NVGG--NILGVVLNN-VDVR--HDQHYQY-------YTSYY--NYYYQKPQ
A0A2T6D3Y2      QRVKQAVH-NVGG--NILGVVLNN-VDVR--HDQHYQY-------YTSYY--NYYYQKPQ
A0A6N6P5E3      IRVKQALA-NVGA--NVIGCILNN-TDTR--SDEYYEY-------YTSYY--SYYQPKQF
A0A2D5VY59      IRAKQMVE-KVGG--NLLGVVLNN-INIS--QDSYYYY-------YSGYYYDYYSKQDDS
A0A2D8UZZ4      IRAKQMVE-KVGG--NLLGVVLNN-INIS--QDSYYYY-------YSGYYYDYYSKQDDS
A0A353DV86      IRAKQMVE-KVGG--NLLGVVLNN-INIS--QDSYYYY-------YSGYYYDYYSKQDDS
A0A2E5EPT8      VRSRQMIE-KVGG--TLLGIVLNN-INVS--SDASYYY-------YSGYH---YHDNPSS
A0A6J4HTK1      TRVKQAVL-GVGG--TVLGVVLNN-VDLK--HDQNYYY-------YTNYY--GYYQPRDK
A0A6N6PHJ5      VRAKQLIE-KVGG--NLVGIVLNN-INMS--QDESYYY-------YSGYYQDYYAKNEDS
A0A6M1RXR2      IRAKQMIE-KVGG--NLVGIVLNN-INLS--QDESYYY-------YSGYYHDYYYRSDDS
A0A7C3DXS4      IRAKQLIE-KVGG--NLIGIVLNN-INLS--QDESYYY-------YSGYYHDYYYRSEDS
A0A2V2SDV4      IRAKQLIE-KVGG--NLVGIVLNN-INMS--QDENYYY-------YSGYYHE-----EGT
A0A2V5PK75      VRAKQLIE-KVGG--NLVGIVLNN-INMS--QDESYYY-------YSGYYHDYYSVNED-
A0A1V6DME1      IRAKQLIE-KVGG--NLIGIVLNN-INMS--QDESYYY-------YSGYYHDYYYRSSES
A0A3D3DIJ3      IRAKQLIE-KVGG--NLVGIVLNN-INMS--QDESYYY-------YSGYYHDYYYRSEE-
A0A6I1K583      IRSRQMVE-KVGG--RLIGVVLNN-INLA--SDASYYY-------YSGYH---YHSNNNA
A0A350EWA4      IRAKQMIE-KVGG--NLLGVVLNN-INMA--QDENYYY-------YSGYY-YDYYSKQND
A0A5B5WZ91      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSAESG
A0A2N8HD92      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGG
A0A2N8HIT2      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGG
A0A354EBD3      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSTDGS
A0A355VEB2      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSTDGS
A0A2N8IMT3      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGS
R6K1U5          LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGS
A0A2N8IWC2      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGS
A0A2N8I441      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGS
A0A2N8I3A6      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGS
A0A410SCC4      LRQKQVIE-SVGG--NLVGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGS
A0A3R5VEW0      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGA
A0A411SSG2      LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGA
B2UKW3          LRQKQVIE-SVGG--NLAGVVMNN-VDIT--SDHQYQY-------YTTYY--SYYSADGA
A0A7C3HWX0      LRAKQMVE-KVGG--TLLGVVLNN-INIS--QDSYYYY-------YSGYY-YDYYSKSS-
A0A1M6RLZ4      VRVKQAVE-NVGG--TVLGVVLNN-VDVK--SDSQYQY-------YTSYY--TYYAPSE-
A0A7C4KPD7      IRAKQMIE-KVGG--NLMGIVLNN-INMS--SDSYYYY-------YSGYFEESYYK----
A0A354T7G8      MRVKQSVE-NAGG--KVVGVVLNN-VDLR--SDAQYQY-------YTSYY--TYYAPTNS
A0A512MBZ2      MRVKQTVE-NVGG--RVLGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYSPNNQ
A0A2E8MEZ0      LRVKQAVE-NVGG--QVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPSS-
A0A6B3LBV6      QRVKKAVE-SVGG--TLLGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYASGD-
A0A2E3EC33      IRVKQAIE-NVGG--KALGVVLNN-VDVR--SDNQYQY-------YTSYY--TYYSPSN-
A0A2E4GN01      IRVKQAIE-NVGG--KALGVVLNN-VDVR--SDNQYQY-------YTSYY--TYYSPSN-
A0A1Z8XU55      VRVKQAIQ-NVGG--TALGVVLNN-VDVR--SDNQYQY-------YTSYY--TYYAPRN-
A0A2E1RQR9      VRVKQAIQ-NVGG--TALGVVLNN-VDVR--SDNQYQY-------YTSYY--TYYAPRN-
A0A2E3ISQ4      LRVKQAIQ-NVGG--TALGVVLNN-VDVR--SDNQYQY-------YTSYY--TYYAPRN-
A0A2D6W6F4      LRVKQAIQ-NVGG--TALGVVLNN-VDVR--SDNXYQY-------YTSYY--TYYAPRN-
A0A2D8Z5A8      LRVKQAIQ-NVGG--TALGVVLNN-VDVR--SDNQYQY-------YTSYY--TYYAPRN-
A0A4Q2YKS3      IRVKQAVE-NVGG--HVIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPAEG
A0A6N6P3T8      QRVKQAVE-NVGG--TIIGVVLNN-VDVR--SDSQYQY-------YTSYY--TYYAPAES
                                  .  .                                      

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      AITDNAPALSENGHGRLSRRSRLNGSFPVTLKPVASEKSSNGVSTGALDVVRAKLGEAMG
A0A2V5PST3      ENGNGGEHTDVEVLMNDGPFEKDPWPKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVED
A0A2V5PXM3      GQKEKARAAAA-------------------------------------------------
A0A1V5QB01      RESKEDAKT---------------------------------------------------
A0A1J4XH17      EKKSNLDKATKLATRVKSALSKKKNKEKTLV-----------------------------
A0A7C5LI63      EEEARAGEIKAGEAPAAEKKEEDQIEDVY-------------------------------
A0A7C5P291      EDKGKGGDIKGLEVPRAESGKDD-IDDVY-------------------------------
A0A139SU05      PERETKRPKKVVEEAEVSEIA---------------------------------------
A0A139SPN4      RGELDREPARAPEAAPAAEPAVAA------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      SDKPXEEEAXQLPLQPGVKXAGKEEXSA--------------------------------
A0A290QGD9      DDTQSPLK----------------------------------------------------
A0A1D8AS58      DGEPDAR-----------------------------------------------------
I6AQC1          EGEDTAEADDKVPEMPTSRS----------------------------------------
W0ITH7          EGEDTAEADDKVPEMPTSRS----------------------------------------
A0A258ANJ7      DETAPLRPASRGLHTPSNFG----------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      HPKKKRRTLV--------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      RSSERRDKRSRTEQAERAKSDERITFTERERDERRKS-----------------------
A0A2A2RGK2      KGVYGE------------------------------------------------------
A0A2A2XXF7      KGVYGE------------------------------------------------------
A0A2A2R5D6      EKKPRSGAATPQRATLAKNDEQSHGSEDF-------------------------------
A0A3C1VJ32      ----EQEAEAKKADL---AAKGPG-DTE------------VNIKQKY-------------
A0A2N9NTX7      ----EKGSGPD---------EGPGDKTK------------LDIKPKY-------------
B9XK55          ----SE-TATD---------AGEG-KAR------------TDIKPKY-------------
A0A4P5YMI6      ----SENQPEAPAVAKRATKGALAEKPA------------AELNQKY-------------
A0A2E6T482      ----EEENADKSEDG--AKEGKLLAKADLGA---------GEDKPKY-------------
A0A3C0DQZ7      ----EEENADKSEDG--AKEGKLLAKADLGA---------GEDKPKY-------------
A0A1Z9CBK5      ----EEDAGEEKKAD---KDQKLVAQANPGG---------SDVKPKY-------------
A0A2D6ZI96      ----EEDAGEEKKAD---KDQKLVAQANPGG---------SDVKPKY-------------
A0A358KGZ3      ----EDEPVEDKKDG---KEEKLIAQADAAG---------EDVNPKY-------------
A0A2E9ZQX4      ----EEEPVEDKKDG---KEEKLIAQADAXG---------XDVXPKX-------------
A0A3D5JZU0      ----EEEPVEDKKDG---KEEKLIAQADAVG---------EDVKPKY-------------
A0A2E6HCR0      ----EEESEDVKESE---NGKSLVSEAASDR---------EDVKPKY-------------
A0A1Z8WN04      ----EEGSDGTGSDNKEIKDKSITTE-VDSS---------SDVKPKY-------------
A0A2D7L1N4      ----EEGSDGTGSDNKEIKDKSITTE-VDSS---------SDVKPKY-------------
A0A2E2R937      ----EEGSDGTGSDNKEIKDKSITTE-VGGS---------SDVKPKY-------------
A0A520QQY4      ----EEGSDGTGSDNKEIKDKSITTE-VDSS---------SDVKPKY-------------
A0A2D5MR66      ----EEESLPEKGSD---QEKSITNESADRD---------GSVKPKY-------------
A0A2E0PDQ1      ----EEESIAVKESD---KDKLINTEATENN---------ESVEPKY-------------
A0A2E2ZZP9      ----EEEPIAEKESD---KDKLINTEDAENN---------ESVEPKY-------------
A0A7C4LRK7      ----KKSKSRSGGKS---RETEVASTGG-------------EIKQKY-------------
A0A2A2RGF2      ----DEPGTNGKPPG---KADRHKPAAPTADA--------PTIKPKY-------------
A0A2G4I5Y6      ----DESSTNGKPPG---KVDRHKPVAPVADA--------TSIKPKY-------------
A0A6N6PS97      ----GDKYGDKYGDS---YEGSKKKKKKGSEKPTEVAETTVKIEQKF-------------
A0A3M1I883      YGRRRRKSSRKRRKS---REKDSSAEAPATAATETEEAETPELKEKF-------------
A0A1V6JZ45      ----GESKSSEDDES---RKAAPKKPAE------------AELKTKY-------------
A0A7C7Z746      ----DDSDDSKKSRK---KSGNLKRSGDSKKASSAKGETAVNLKTKY-------------
A0A520RRW5      ----DNTSSKKKSDG---KSGKTSARGD------------LELKNKF-------------
A0A356NPK0      ----DNTSSKKKSDG---KSGKTSARGD------------LELKNKF-------------
A0A2D7B5P5      ----DNTSSKKKSDG---KSGKTSARGD------------LELKNKF-------------
A0A3D3XGB5      ----DNTSSKKKSDG---KSGKTSARGD------------LELKNKF-------------
A0A2V6F8A1      ----EP-S--KNNGE---KKKPAGERAQ------------LDLKQKY-------------
A0A2V5TNH4      ----EPPA--KNNGE---KKTPAGERAQ------------LDLKQKY-------------
A0A2V5X5Q6      ----EPAA--KNNGE---KKKPAGERAQ------------LDLKQKY-------------
A0A4P5QM05      TPE-DRKKPEVAAA--------NADNEDAY------------------------------
A0A4Q3C001      SPK-QASGQQPRRPAAAPTPASTGSKHGDY------------------------------
B4DB23          TPKIEAPAPQLARP--------RDTHREDY------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      LT----------------------------------------------------------
A0A2V2DJ66      ENQQEGRRQPPEVSHSDGEEKNS-------------------------------------
R7L5A9          DEDEQPPEDVPPEMPSESKQ----------------------------------------
A0A5R8KA81      S-----------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      RRNEPETAPEDSDKQ---------------------------------------------
A0A411SUQ6      ---EPQQTSRKQDK----------------------------------------------
A0A2N8HZF2      ---KPQQTSRKQNK----------------------------------------------
A0A354E720      ---DPQQTARKRD-----------------------------------------------
B2UPB6          ---EPQQTSRKQDK----------------------------------------------
A0A2V6JLK8      ETHRRGRQKSRVAANGSADNGHIDTDEY--------------------------------
A0A2W5Z1A5      QS-RRSRSR-AGVGAESNGASDNGRDEY--------------------------------
A0A2V6EA09      ET-RRGRSRKAAATVAHNGASGSDEDEY--------------------------------
A0A2V6GQI7      ET-RRGRSRKAAATVAHNGA--SDSDEY--------------------------------
A0A3C1HEJ2      SPAAPAPKAANSGK----------------------------------------------
A0A522ULD9      MPKPETVGGVTAAEVRKEST----------------------------------------
A0A1V6JU76      ERAESRRQAVVESSGSTPAPHA--------------------------------------
A0A2A2XXW5      NK--SADEPADKKSASEKSKSA--------------------------------------
A0A6N6Q6V0      TK--PGKPEAEKGAGVAKAKG---------------------------------------
A0A1Q6UHJ9      EEDSEGEEAQEGGESEDPENSENSK-----------------------------------
A0A2V2BXR0      EEDSEGEEAQKGGESEDPENSENSK-----------------------------------
A0A2D8V0G3      LGSKKGEGAKDGELVQGGKAGKDDEPSKA-------------------------------
A0A348S017      LEPNK----KSKSVVQLDKTAKKSESEV--------------------------------
A0A3C1UUV7      LEPNK----KSKSVVQLDKTAKKSESEV--------------------------------
A0A350I3V2      LEPNK----KSKSVVQLDKTAKKSESEV--------------------------------
A0A520RGV5      LEPNK----KSKSVVQLDKTAKKSESEV--------------------------------
A0A3D3XF90      LEPNK----KSKSVVQLDKTAKKSESEV--------------------------------
A0A2D7B522      LEPNK----KSKSVVQLDKTAKKSESEV--------------------------------
A0A356NIC2      LEPNK----KSKSVVQLDKTAKKSESEV--------------------------------
A0A2N8HDG3      S-----------------------------------------------------------
A0A146GCJ0      GEKSV-------------------------------------------------------
A0A2T6D6H8      GAKAG-------------------------------------------------------
A0A3D1TI55      RTPDRPKELDVGEAY---------------------------------------------
A0A3E1ET42      EARKPRQAAPAGGAP----QRPAPAKAGAGR---------GENEDY--------------
A0A2A2YDW8      ELPQPQPSTSSRPATPS-------STASTSN---------QNDTLY--------------
A0A352XLN9      ELPQPQPSTSSRPATPS-------STASTSN---------QNDTLY--------------
A0A3D0YP62      DEIARDTATAAPAPS---------QQAQPAR---------NDEDLY--------------
A0A3D3DV47      DEIARDTATAAPAPS---------QQAQPAR---------NDEDLY--------------
A0A2E5XJ49      PDPVA--GGSPGGPPGGGSRTVS-TS-APQD---------EDEALY--------------
A0A2E6SBY8      ADPVP--XASPGGASAGRVRSAA-ASPSSQD---------DDGGLY--------------
A0A2E5QMS4      VDPISSPPRKMTVST-GASPTAT-PSTPEED---------DDGLSY--------------
A0A2E7YXQ3      VDPISSPPRKMTVST-GASPTAT-PSTPEED---------DDGLSY--------------
A0A2E3H787      ADPVPGAGFEAAAES-ATAEATG-SSKDEND---------DDGLTY--------------
A0A2E7AGN1      ADPVPGGGVTKSAER-ASVKTPG-GKNETDD---------EEGLTY--------------
A0A2E7AKY7      ADPVPGGGVTKSAER-ATVKTPG-GKNELDD---------EKGLTY--------------
A0A3D4CU34      ADPVPGGGVTKSAER-ASVKTPG-GKNETDD---------EEGLTY--------------
A0A2E8M146      SDPVPTVGATASATSGSALESKV-VANDSEE---------DEGLNY--------------
A0A355S8S2      SDPVPTVGATASATSGSALESKV-VANDSEE---------DEGLNY--------------
A0A2D6DVN8      SDPVPSVGATASGTS-AATESTV-ATSDEDK---------DEGLTY--------------
A0A3C1W2R2      SDPVPSVGATASGTS-AATESTV-AANDEDK---------DEGLTY--------------
A0A2E3NAY6      SDPVPTGGTTSSGTT-EAIESTV-ATNDADD---------DEGLTY--------------
A0A2E3II01      SDPVPTVGTTASGTS-AAIESAV-AATDADK---------DEGLTY--------------
A0A368B8C5      SDPVPTVGTTASGTS-AAIESAV-AANDADK---------DEGLTY--------------
A0A3R7RBB5      SDPVPTVGTTASGTS-AAIESAV-AANDADK---------DEGLTY--------------
A0A2A2QX62      SQSLPSQGSSSAPAKPAPPRSTS-RGDAADD---------AKQDLY--------------
A0A4Q3BWH6      SQPMPTQSGSQAPSQSPAPRSSS-RASSTDD---------SKQDLY--------------
A0A3N5WCF1      AQVVAP--PPGSSSAPSKPQAAATRGADS--------------ELY--------------
A0A4Q3C1K5      SQIGPPVSSPTSSTPAAKPQAPA-RGNDS--------------ELY--------------
A0A3R8IT45      DAIDNSASNEEEDVVAPGSKS---------------------------------------
A0A2A2PYE8      DTEQEK------------------------------------------------------
A0A2T6CN73      DTEQER------------------------------------------------------
A0A2G4G428      AAKDDAGDAVASTENPEDNPKV--------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      S-----------------------------------------------------------
A0A2N8HT11      S-----------------------------------------------------------
R7DS70          S-----------------------------------------------------------
A0A2N8HNL6      S-----------------------------------------------------------
A0A6N6PAZ1      YGSDSEKKPRSRK-----------------------------------------------
A0A6I1K459      YGATSSRG----------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      GDGTMKAKRKTRQSTPAKGAKVKSPRAKADE---------VF------------------
A0A2U8DZK4      RTR-----------DKTAGDTINFSEKK--------------------------------
A0A2T6DFL8      RTRRSARSDK--KPEAGGEDRLDLHE----------------------------------
A0A1D8AWD4      EKPVPGAAGAAGPNEARGSDRIEMRETREPE---------RKR-----------------
A0A4Q1C9S2      EKP-----AVAGKAAERGAERLDLDEK---P---------RRR-----------------
A0A178IH18      RRRSRRHRSGRDRDDEADA-RETFTEPER-------------------------------
A0A2T6DT99      RRSRRSRRDDADGESDSRGDRIEYVERERRR---------SKE-----------------
A0A1G3ZT33      RRKSARTEAA--AVPAGGAERIVLDEPDSRR---------HG------------------
A0A3E1E2T2      RRRR---SAAKPKSPGRGGDELKLS-----------------------------------
B1ZMW1          RRHRPGPSAAHQAAPAVEGDRLVLREPERKD---------PA------------------
A0A3M1I8A3      RPDQIGAVRST-------------------------------------------------
A0A4V0XS84      EAKSSSVATDSDRANGASRSASFNGGGKSAT---------VPLASTLATSPRRPVGSEKS
A0A351WE84      -----------------GQEKVPAKTIAASA---------DGKDSLF-------------
D5ENH7          EFEEELAGSVEPDKQ---------------------------------------------
A0A0R2XQ77      ELEDELAGSVEP--EMEPRS----------------------------------------
A0A2E9IN28      ELEEEMAGSVEPQSELGPKA----------------------------------------
A0A6N4WTJ5      EFEEELAGSVEP--EMRPKA----------------------------------------
A0A1V5QDZ6      PADELADTSNRKKDAL--------------------------------------------
A0A4Y8P964      QNKNETQNLSPFQSLRFLNGWVKKKSSDKTT---------DS------------------
A0A3D4HF88      GSNPKA------------------------------------------------------
A0A6N6ZHN8      SGNEEGTREVENTHRKTPPSEEMHV-----------------------------------
A0A6G6K641      -----------------------------------------GERKVYGSA----------
A0A5B5WI95      -REAAGKN----------------------------------------------------
A0A2N8I9W1      PRQTTRKQD---------------------------------------------------
A0A4Q5IH27      PRQTTRKQD---------------------------------------------------
A0A2N8IBZ6      PRQTTRKQD---------------------------------------------------
A0A2N8IJW9      PRQTTRKQD---------------------------------------------------
A0A7G6DX28      PRQTTRKQD---------------------------------------------------
R6J100          PRQTTRKQD---------------------------------------------------
A0A1V6J089      ENDDNLTES---------------------------------------------------
A0A3C1BZR1      DKEDDATEA---------------------------------------------------
A0A7C4KLL2      SGGEEQVSQSGDDKQAKQETASSVPR----------------------------------
A0A1H6KPB7      VEPSAALNPLPVTSRS-SKRSEVAKKTESTD---------QPGDDLY-------------
A0A2E9ISN4      -----------------RHIESAFLYGMESE---------TPKNKRWKFR----------
B9XAX1          YGNDYPAKIPLNT-----------------------------------------------
A0A5R8KKM9      GKKDRQPVANAPQK---TLASLQSPKSEKNR---------TSYQDAF-------------
A0A139TS01      ASGGNADASSLKKA---ERSGKAKELAATQS---------NDNEDLY-------------
A0A3E1EJT7      PPVTSQSS----------------------------------------------------
A0A7C3I5X9      -----------------YQAGAGAETEPAEE---------STPVQKA-------------
A0A2D5WGA5      EEESGDAAKDG------KKEPKLLAKADVGG---------EDEKPKY-------------
A0A2E7SSH2      EEESTEDNKNG------GND-KLIAQADIGG---------DDVKPKY-------------
A0A349GXM8      YGYDYYYDEKGGNRRSRRQIRWRKQLEHAGA---------WIRKTLMPM-----------
A0A4P5YP61      KGVYGAKA----------------------------------------------------
A0A6B2LYM4      YLQNKGME---------DLDEEVAASGPSDG---------PQETKTS-------------
A0A6D1VXB3      QNKNQTQSLSPFHSLQFLNDWVQEKIKRPDK-----------------------------
I0JYY7          QNKNQTQSLSPFHSLQFLNDWVQEKIKRPDK-----------------------------
A0A4R7S1J2      YGASA-------------------------------------------------------
A0A2A2XV69      VPEKS------------GQNAQAASPATTKP---------TPQSGEY-------------
A0A651H7X9      EKEMR-------------------------------------------------------
A0A4Y8P842      -----------------------RSAVPSDS---------QEIMRKEKEG----------
B3DZK9          -----------------------RSQASSNS---------QELMRKEEEA----------
A0A5E6MPC4      RRAEALRAPSQPPS----------------------------------------------
A0A6N6PKP9      -----------------YGSDEVYGASAALA---------DEAVVEYASK----------
A0A6N6Z250      -----------------ENTGPASSSTTAAK---------PSIEGARWRE----------
A0A4V1SB02      GSSVNPKKKRGKKANDEDAAWPESTPAVSPS---------QASRAKE-------------
A0A6N6QEJ2      KPDGEKKKKS-------RSGKAGAAVADDKS---------AEVKPKY-------------
A0A3C1VB86      -----------------DKTSDDTRGNLASE---------ARPENLL-------------
A0A146G2Q9      QQKADKKPA--------KKAPVSAVQQLNGE---------KDQEDTY-------------
A0A2T6D3Y2      QQKADKKPA--------KKAPVSAVQQLNGE---------KDQEDTY-------------
A0A6N6P5E3      SEKPSSKQPQIDLV---GEKKEKKVAVVDAE---------AGSTGDY-------------
A0A2D5VY59      EGGSSA-----------QPKTKSSKTASRGD---------VELKNKF-------------
A0A2D8UZZ4      EGGSSA-----------QPKTKSSKTASRGD---------VELKNKF-------------
A0A353DV86      EGGSSA-----------QPKTKSSKTASRGD---------VELKNKF-------------
A0A2E5EPT8      SGSLNIDSKPRELK---GKVDRQRGQDSSEE---------PDLKSKY-------------
A0A6J4HTK1      ETRRSSRKAAAATV-------------ASNG---------QSDSEEY-------------
A0A6N6PHJ5      EPLAEGQA---------KKPADKKTEG--------------EIKQKY-------------
A0A6M1RXR2      EKSDSGKG---------REKTDK-AAGELAR---------TEIKPKY-------------
A0A7C3DXS4      EKIGSDKD---------KEKAGKTASADTAR---------VEIKSKY-------------
A0A2V2SDV4      ----NDEE---------QEAAPGGPASQKS------------------------------
A0A2V5PK75      ------QE---------SAARPDEPAGDKAR---------RA------------------
A0A1V6DME1      ----SDKD---------EAAGEKKADDSQAK---------VEIKKKY-------------
A0A3D3DIJ3      ------QE---------PVVKEGAESGGKDK---------LDIKQKY-------------
A0A6I1K583      DEPGANGKPPG------KVDRRKPVAPATDA---------PTIKPKY-------------
A0A350EWA4      DDGDQSG----------RKNGHPATKDEPAS---------RLDLKKY-------------
A0A5B5WZ91      ASDGNADASSLKKA---ERSGKAKELAATQS---------SDNEDLY-------------
A0A2N8HD92      SSGGNVDASSMKKA---ERSGKAKELAANQS---------HDSEDLY-------------
A0A2N8HIT2      SSGENADASSMKKA---ERSGKAKELAATQS---------HDSEDLY-------------
A0A354EBD3      SSGENAEASSMKKA---ERSGKAKELAATQS---------HDSEDLY-------------
A0A355VEB2      SSGENAEASSMKKA---ERSGKAKELAATQS---------HDSEDLY-------------
A0A2N8IMT3      SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
R6K1U5          SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
A0A2N8IWC2      SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
A0A2N8I441      SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
A0A2N8I3A6      SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
A0A410SCC4      SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
A0A3R5VEW0      SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
A0A411SSG2      SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
B2UKW3          SSGENADASSMKKV---ERSGKAKELAATQS---------HDSEDLY-------------
A0A7C3HWX0      ---ESEPEGKSAKPAKDVPKAVAAVTGAGDP---------AKK-----------------
A0A1M6RLZ4      ---APQEVRAAAQP-------------QGAQ---------SNSADLY-------------
A0A7C4KPD7      ---DSDDKSSSRRK---GKRSGSDAGSTSAE---------VEIKQKY-------------
A0A354T7G8      PTGGAGGKTRRRKVKAETTANALTSPRTVSR---------PEGEDVF-------------
A0A512MBZ2      AA-APGEQPQKRRRRSDAPAAPNAAPSPASR---------APQGDLF-------------
A0A2E8MEZ0      -L-EETGTPQQMTA---APASSKTEEKKSER---------SSSEDLY-------------
A0A6B3LBV6      -----DQAAKPKKR---GKKEVSSSVGGGDV---------KLGDDVY-------------
A0A2E3EC33      -I-DPNQKISSDKP---KAPSSKEPKGSSEE---------ISIEDKF-------------
A0A2E4GN01      -M-DPNQKISSDKT---KSSSSKESKSSSEE---------ISAEDKY-------------
A0A1Z8XU55      -L-DPNMNSNSDDL---FKSGDKLASNDKDN---------LTAEDKF-------------
A0A2E1RQR9      -L-DPNMNSNSDDL---FKSGDKLASNDKDN---------LTAEDKF-------------
A0A2E3ISQ4      -L-DPNMESDSIGS---TKSESKVASNDQNN---------LSAEDKF-------------
A0A2D6W6F4      -L-DPDMESGSIGS---PKAGSKLASNDQNN---------LSAEDKF-------------
A0A2D8Z5A8      -L-DPDMESGSIGS---PKPGSKLASNDQNN---------LSAEDKF-------------
A0A4Q2YKS3      QV-GPPVNAET-------APRQQKSGGREND------------SELY-------------
A0A6N6P3T8      QI-GPPALGASPKP---QAASKSQPTAQGND------------TELY-------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      PMASLVLRDSIRALGESSESFPEAKLEVLVQHVSQEILDDYQRQRFEEETLKEIKKTTEQ
A0A2V5PST3      HISLLGEARNRFPKNRLQELFDRICEEILDDKLKNDFQQSMQEELRVL------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      SFKMNRNS----------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      HGAAQPDGPVKADSAISKKKPNGTAVDNPSLTSEPAAIQEPRDGADGATASGAASISEKT
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      SEALPHRPSKNPAAIPKPATKKTMNKESREELSPEFLKLVIVRLTQAMGPIAPLVLREHI
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
A0A7G6DX28      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ----------------------------------------------
A0A2V5UHJ2      SALGETLESFPQARLEELVQRLCKEIVTDSFRQQFEEEMAKLTSDV
A0A2V5PST3      ----------------------------------------------
A0A2V5PXM3      ----------------------------------------------
A0A1V5QB01      ----------------------------------------------
A0A1J4XH17      ----------------------------------------------
A0A7C5LI63      ----------------------------------------------
A0A7C5P291      ----------------------------------------------
A0A139SU05      ----------------------------------------------
A0A139SPN4      ----------------------------------------------
A0A1V6E7N1      ----------------------------------------------
A0A2D9MYT1      ----------------------------------------------
A0A290QGD9      ----------------------------------------------
A0A1D8AS58      ----------------------------------------------
I6AQC1          ----------------------------------------------
W0ITH7          ----------------------------------------------
A0A258ANJ7      ----------------------------------------------
A0A139TLN4      ----------------------------------------------
A0A1G3ZFT0      ----------------------------------------------
A0A1Z8ZMT6      ----------------------------------------------
A0A2E8MCT7      ----------------------------------------------
A0A290Q2Z2      ----------------------------------------------
A0A2A2RGK2      ----------------------------------------------
A0A2A2XXF7      ----------------------------------------------
A0A2A2R5D6      ----------------------------------------------
A0A3C1VJ32      ----------------------------------------------
A0A2N9NTX7      ----------------------------------------------
B9XK55          ----------------------------------------------
A0A4P5YMI6      ----------------------------------------------
A0A2E6T482      ----------------------------------------------
A0A3C0DQZ7      ----------------------------------------------
A0A1Z9CBK5      ----------------------------------------------
A0A2D6ZI96      ----------------------------------------------
A0A358KGZ3      ----------------------------------------------
A0A2E9ZQX4      ----------------------------------------------
A0A3D5JZU0      ----------------------------------------------
A0A2E6HCR0      ----------------------------------------------
A0A1Z8WN04      ----------------------------------------------
A0A2D7L1N4      ----------------------------------------------
A0A2E2R937      ----------------------------------------------
A0A520QQY4      ----------------------------------------------
A0A2D5MR66      ----------------------------------------------
A0A2E0PDQ1      ----------------------------------------------
A0A2E2ZZP9      ----------------------------------------------
A0A7C4LRK7      ----------------------------------------------
A0A2A2RGF2      ----------------------------------------------
A0A2G4I5Y6      ----------------------------------------------
A0A6N6PS97      ----------------------------------------------
A0A3M1I883      ----------------------------------------------
A0A1V6JZ45      ----------------------------------------------
A0A7C7Z746      ----------------------------------------------
A0A520RRW5      ----------------------------------------------
A0A356NPK0      ----------------------------------------------
A0A2D7B5P5      ----------------------------------------------
A0A3D3XGB5      ----------------------------------------------
A0A2V6F8A1      ----------------------------------------------
A0A2V5TNH4      ----------------------------------------------
A0A2V5X5Q6      ----------------------------------------------
A0A4P5QM05      ----------------------------------------------
A0A4Q3C001      ----------------------------------------------
B4DB23          ----------------------------------------------
A0A6B3L938      ----------------------------------------------
A0A2V5URB2      ----------------------------------------------
A0A2V2DJ66      ----------------------------------------------
R7L5A9          ----------------------------------------------
A0A5R8KA81      ----------------------------------------------
A0A5B5WU87      ----------------------------------------------
R7DZW0          ----------------------------------------------
A0A2N8HID1      ----------------------------------------------
A0A2N8HS06      ----------------------------------------------
A0A6N2TNT9      ----------------------------------------------
A0A3R5R2M8      ----------------------------------------------
A0A411SUQ6      ----------------------------------------------
A0A2N8HZF2      ----------------------------------------------
A0A354E720      ----------------------------------------------
B2UPB6          ----------------------------------------------
A0A2V6JLK8      ----------------------------------------------
A0A2W5Z1A5      ----------------------------------------------
A0A2V6EA09      ----------------------------------------------
A0A2V6GQI7      ----------------------------------------------
A0A3C1HEJ2      ----------------------------------------------
A0A522ULD9      ----------------------------------------------
A0A1V6JU76      ----------------------------------------------
A0A2A2XXW5      ----------------------------------------------
A0A6N6Q6V0      ----------------------------------------------
A0A1Q6UHJ9      ----------------------------------------------
A0A2V2BXR0      ----------------------------------------------
A0A2D8V0G3      ----------------------------------------------
A0A348S017      ----------------------------------------------
A0A3C1UUV7      ----------------------------------------------
A0A350I3V2      ----------------------------------------------
A0A520RGV5      ----------------------------------------------
A0A3D3XF90      ----------------------------------------------
A0A2D7B522      ----------------------------------------------
A0A356NIC2      ----------------------------------------------
A0A2N8HDG3      ----------------------------------------------
A0A146GCJ0      ----------------------------------------------
A0A2T6D6H8      ----------------------------------------------
A0A3D1TI55      ----------------------------------------------
A0A3E1ET42      ----------------------------------------------
A0A2A2YDW8      ----------------------------------------------
A0A352XLN9      ----------------------------------------------
A0A3D0YP62      ----------------------------------------------
A0A3D3DV47      ----------------------------------------------
A0A2E5XJ49      ----------------------------------------------
A0A2E6SBY8      ----------------------------------------------
A0A2E5QMS4      ----------------------------------------------
A0A2E7YXQ3      ----------------------------------------------
A0A2E3H787      ----------------------------------------------
A0A2E7AGN1      ----------------------------------------------
A0A2E7AKY7      ----------------------------------------------
A0A3D4CU34      ----------------------------------------------
A0A2E8M146      ----------------------------------------------
A0A355S8S2      ----------------------------------------------
A0A2D6DVN8      ----------------------------------------------
A0A3C1W2R2      ----------------------------------------------
A0A2E3NAY6      ----------------------------------------------
A0A2E3II01      ----------------------------------------------
A0A368B8C5      ----------------------------------------------
A0A3R7RBB5      ----------------------------------------------
A0A2A2QX62      ----------------------------------------------
A0A4Q3BWH6      ----------------------------------------------
A0A3N5WCF1      ----------------------------------------------
A0A4Q3C1K5      ----------------------------------------------
A0A3R8IT45      ----------------------------------------------
A0A2A2PYE8      ----------------------------------------------
A0A2T6CN73      ----------------------------------------------
A0A2G4G428      ----------------------------------------------
A0A6N6PCD8      ----------------------------------------------
A0A139TV24      ----------------------------------------------
A0A2N8HT11      ----------------------------------------------
R7DS70          ----------------------------------------------
A0A2N8HNL6      ----------------------------------------------
A0A6N6PAZ1      ----------------------------------------------
A0A6I1K459      ----------------------------------------------
A0A139TUL1      ----------------------------------------------
A0A2N8HCB0      ----------------------------------------------
A0A2N8HP04      ----------------------------------------------
A0A2N8HRJ0      ----------------------------------------------
A0A6N2U9Y7      ----------------------------------------------
A0A366HAG0      ----------------------------------------------
A0A2U8DZK4      ----------------------------------------------
A0A2T6DFL8      ----------------------------------------------
A0A1D8AWD4      ----------------------------------------------
A0A4Q1C9S2      ----------------------------------------------
A0A178IH18      ----------------------------------------------
A0A2T6DT99      ----------------------------------------------
A0A1G3ZT33      ----------------------------------------------
A0A3E1E2T2      ----------------------------------------------
B1ZMW1          ----------------------------------------------
A0A3M1I8A3      ----------------------------------------------
A0A4V0XS84      ----------------------------------------------
A0A351WE84      ----------------------------------------------
D5ENH7          ----------------------------------------------
A0A0R2XQ77      ----------------------------------------------
A0A2E9IN28      ----------------------------------------------
A0A6N4WTJ5      ----------------------------------------------
A0A1V5QDZ6      ----------------------------------------------
A0A4Y8P964      ----------------------------------------------
A0A3D4HF88      ----------------------------------------------
A0A6N6ZHN8      ----------------------------------------------
A0A6G6K641      ----------------------------------------------
A0A5B5WI95      ----------------------------------------------
A0A2N8I9W1      ----------------------------------------------
A0A4Q5IH27      ----------------------------------------------
A0A2N8IBZ6      ----------------------------------------------
A0A2N8IJW9      ----------------------------------------------
A0A7G6DX28      ----------------------------------------------
R6J100          ----------------------------------------------
A0A1V6J089      ----------------------------------------------
A0A3C1BZR1      ----------------------------------------------
A0A7C4KLL2      ----------------------------------------------
A0A1H6KPB7      ----------------------------------------------
A0A2E9ISN4      ----------------------------------------------
B9XAX1          ----------------------------------------------
A0A5R8KKM9      ----------------------------------------------
A0A139TS01      ----------------------------------------------
A0A3E1EJT7      ----------------------------------------------
A0A7C3I5X9      ----------------------------------------------
A0A2D5WGA5      ----------------------------------------------
A0A2E7SSH2      ----------------------------------------------
A0A349GXM8      ----------------------------------------------
A0A4P5YP61      ----------------------------------------------
A0A6B2LYM4      ----------------------------------------------
A0A6D1VXB3      ----------------------------------------------
I0JYY7          ----------------------------------------------
A0A4R7S1J2      ----------------------------------------------
A0A2A2XV69      ----------------------------------------------
A0A651H7X9      ----------------------------------------------
A0A4Y8P842      ----------------------------------------------
B3DZK9          ----------------------------------------------
A0A5E6MPC4      ----------------------------------------------
A0A6N6PKP9      ----------------------------------------------
A0A6N6Z250      ----------------------------------------------
A0A4V1SB02      ----------------------------------------------
A0A6N6QEJ2      ----------------------------------------------
A0A3C1VB86      ----------------------------------------------
A0A146G2Q9      ----------------------------------------------
A0A2T6D3Y2      ----------------------------------------------
A0A6N6P5E3      ----------------------------------------------
A0A2D5VY59      ----------------------------------------------
A0A2D8UZZ4      ----------------------------------------------
A0A353DV86      ----------------------------------------------
A0A2E5EPT8      ----------------------------------------------
A0A6J4HTK1      ----------------------------------------------
A0A6N6PHJ5      ----------------------------------------------
A0A6M1RXR2      ----------------------------------------------
A0A7C3DXS4      ----------------------------------------------
A0A2V2SDV4      ----------------------------------------------
A0A2V5PK75      ----------------------------------------------
A0A1V6DME1      ----------------------------------------------
A0A3D3DIJ3      ----------------------------------------------
A0A6I1K583      ----------------------------------------------
A0A350EWA4      ----------------------------------------------
A0A5B5WZ91      ----------------------------------------------
A0A2N8HD92      ----------------------------------------------
A0A2N8HIT2      ----------------------------------------------
A0A354EBD3      ----------------------------------------------
A0A355VEB2      ----------------------------------------------
A0A2N8IMT3      ----------------------------------------------
R6K1U5          ----------------------------------------------
A0A2N8IWC2      ----------------------------------------------
A0A2N8I441      ----------------------------------------------
A0A2N8I3A6      ----------------------------------------------
A0A410SCC4      ----------------------------------------------
A0A3R5VEW0      ----------------------------------------------
A0A411SSG2      ----------------------------------------------
B2UKW3          ----------------------------------------------
A0A7C3HWX0      ----------------------------------------------
A0A1M6RLZ4      ----------------------------------------------
A0A7C4KPD7      ----------------------------------------------
A0A354T7G8      ----------------------------------------------
A0A512MBZ2      ----------------------------------------------
A0A2E8MEZ0      ----------------------------------------------
A0A6B3LBV6      ----------------------------------------------
A0A2E3EC33      ----------------------------------------------
A0A2E4GN01      ----------------------------------------------
A0A1Z8XU55      ----------------------------------------------
A0A2E1RQR9      ----------------------------------------------
A0A2E3ISQ4      ----------------------------------------------
A0A2D6W6F4      ----------------------------------------------
A0A2D8Z5A8      ----------------------------------------------
A0A4Q2YKS3      ----------------------------------------------
A0A6N6P3T8      ----------------------------------------------
                                                              

© 1998-2021Legal notice