BYKdb

Dataset for cluster tadcd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

246 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2A2XVF1      MSKRVDFPRRAFCEFRGIFVRFVFLFLIGMSVAAEPSNEYKLAPNDLLDFRVFQEPELDA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      VVRVSGDGQAIFPLVGGVAIAGASISEAIELIKSRYRDGYLKNPQVTLTVRSYAKKLFTI
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      --------------------------------------------------MSEENPNTGS
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      LGQVQQPGSYDIQSQIRGMSPLSVSRMVVSASSSLTRNAWRAVMKKPRSSSRREMSSPSA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ---------------------------------------------------------MRP
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ----------------------------------------------------MSMKMMSS
A0A290QGD9      -------------------------------------------------------MNPPA
A0A1D8AS58      -------------------------------------------------------MENAP
I6AQC1          -------------------------------------------------------MDSQA
W0ITH7          -------------------------------------------------------MDSQA
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------MLWWSR
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------MKDNHS
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      -----------------------MSSISHLPVQSWSPTAFIGFSQPSCTSGPVSLLLDNK
A0A2V2DJ66      -----MENSDSKTPAQDGASQNAPSSQGAKSVRKKRNSGYGYG--YNYSAYGNYGGYGGY
R7L5A9          -----MESSNN--------NNSQPDSAPTKVIKKKIVASYGSGGYGGYGGYGDYGGYGAY
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      --------MPLNGTAGVSPGLALLWPWSPCACNGHSAAFSSGLIIPVNGNIGTVRLYRTD
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ---------------------MENTESKDNSGQKTVKRVIKKRIISDAAGAYGYGPGYGG
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      --------------------------------------------------MDPSQSAQTQ
A0A2A2PYE8      --------------------------------------------------MSSESGEKQS
A0A2T6CN73      -------------------------------------------------MAAEQEKHAPG
A0A2G4G428      TNSSSSSGSASGTNNTSRGSQRRGYGGGGYGGNYGGGYGGGYGGNYGGGYGGGYGGGYGG
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ----------------------------------------MKNDYVRGGADPNSGGYGGY
A0A0R2XQ77      ----------------------------------------MKNDYVRGAPDPNSGGYSGY
A0A2E9IN28      ----------------------------------------MKNDYVRGGADPNTGGYGGY
A0A6N4WTJ5      ----------------------------------------MKNDYVRGAPDLNSGGYGGG
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ----------------------------MRNTTESMVQDPQEEASKRKPNYHNYHSYHNH
A0A6N6ZHN8      ---------------------------------------------------------MSK
A0A351MR11      -------------------------------------------MPSSYILRQRDDGNTSY
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------MKNEYVRGAPDPNAGGYA
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      -----------------------------------------------------------M
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ---------------------------------------------------------MSQ
A0A4Y8P842      -----------------------------------------------------------M
B3DZK9          -----------------------------------------------------------M
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      -----------------------------------------------------MGVFLFL
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      SPYFKMLDPSRPPAEKRFGSVLPTIHSSLDEVGTALDL-------------RRIYHLLL-
A0A2V5UHJ2      -------------MEQVNQPSPYFIRRTLRPENQTIDLHEFSVVEDQVLPLRDYWLIIK-
A0A2V5PST3      PYNMRTYFPENDTQRPALPDSSESDYAYYGSEEERVQL-------------LDYWKNLV-
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      --------------MENILRPPRPPTAGDAPAQPVSIGSPPPAKGFGIADLKHYFHIVV-
A0A7C5LI63      ----------------------MFNQTPAEARPEAVDI-------------KEYLAVLL-
A0A7C5P291      --------------------MAMTGPNPSESRAESVDI-------------KEYLAIIL-
A0A139SU05      ----MAEPAGSSPTPPVPLGAAPSSSAADAPVEQRRSL-------------RDYYVILR-
A0A139SPN4      -----------------------------MPAGQSRSL-------------RDYYVILR-
A0A1V6E7N1      -------------MADVSAKSTHHSPGKDEEVVERRTL-------------RDYLIILR-
A0A2D9MYT1      -----------------MXQXPFNESREEGLFEESINL-------------RHYWHIVL-
A0A258ANJ7      PSPKASFNTMQPTSLSLPQSPMEMTQRLEADSESSSSF-------------MNPAQLVDG
A0A290QGD9      SPAPHGGPDQAPESPYGYGAYQQPP-----DGPQQRGF-------------QDYVLILR-
A0A1D8AS58      KADKVQGPGEA-YPAYYGGGQGGYGVLGQGESQMHRSM-------------QDYLLILR-
I6AQC1          KQPK---ASDG-RAEYGYGGYNEYPGYGN-EASGQRTL-------------SDYLLILR-
W0ITH7          KQPN---PSDG-RAEYGYGGYNEYPGYGN-EASGQRTL-------------SDYLLILR-
A0A139TLN4      ----------------MKSSSPKPDSLETEGGASVSLF-------------PSPRALLAR
A0A1G3ZFT0      --------------------MNTLTHGKANQENIEIDF-------------VALFHQLL-
A0A1Z8ZMT6      -----------------------MAKLRSTPEPVDSYYDEAQAEIKKSPGLFDLAYLLPR
A0A2E8MCT7      -----------------------MAKLRSAPGPVDSYYQETKADIKKSPGVFDLAYLLPR
A0A290Q2Z2      RVWWWRPEKTSLLTGGEGNSLAARSMAHTHVSKEGASL-------------ADFFHLLR-
A0A2A2RGK2      -------------MSTDKVIQPRPPESAPP--IESIDW-------------REYFHAVI-
A0A2A2XXF7      -------------MNKETDLKKPPSASPPPPSQEGIDW-------------REYFHAVV-
A0A2A2R5D6      --------------------------MAAPASEVSLHF-------------LDYWRVIR-
A0A1J4XH17      NKNEPEDQKSYGGYYNGYGSYSYGYGSGAYEENNQRNI-------------KDYLLILR-
A0A3C1VJ32      ----------------------MDQVTTSAAPEARLHF-------------LDYWRVIR-
A0A2N9NTX7      ----------------------MDPIPVPPPQESKLHF-------------LDYWRIIR-
B9XK55          ----------------------MDPLKTSAPPEAKLHF-------------LDYWRIIR-
A0A4P5YMI6      ----------------------MEAEAISSQPETKLHF-------------LDYWRIIR-
A0A2E6T482      ----------------------MDKIPTTDQSSDKLHI-------------LDYWRILR-
A0A3C0DQZ7      ----------------------MDKIPTTDQSSDKLHI-------------LDYWRILR-
A0A1Z9CBK5      ----------------------MERNTGSDQSSDKLHI-------------LDYWRIIR-
A0A2D6ZI96      ----------------------MERNTGSDQSSDKLHI-------------LDYWRIIR-
A0A358KGZ3      ----------------------MEPTSRKENSSDKLHI-------------LDYWRIIR-
A0A2E9ZQX4      ----------------------MEPTSRKENSSDKLHI-------------LDYWRIIR-
A0A3D5JZU0      ----------------------MEPTSGKENSSDKLHI-------------LDYWRIIR-
A0A2E6HCR0      ----------------------MDNNSGSEQSSDKLHI-------------LDYWRIIR-
A0A1Z8WN04      ----------------------MDNTSGSEQSSEKLHI-------------LDYWRIIR-
A0A2D7L1N4      ----------------------MDNTSGSEQSSEKLHI-------------LDYWRIIR-
A0A2E2R937      ----------------------MDNTSGSEQSSEKLHI-------------LDYWRIIR-
A0A520QQY4      ----------------------MDNTSGSEQSSEKLHI-------------LDYWRIIR-
A0A2D5MR66      ----------------------MDKTSGLEQSSDKLHI-------------LDYWRIIR-
A0A2E0PDQ1      ----------------------MDKTSGSEQSSDKLHI-------------LDYWRIIR-
A0A2E2ZZP9      ----------------------MDKTSGSEQSSDKLHI-------------LDYWRIIR-
A0A7C4LRK7      -----------------MDAAKNNSANTPAAADTSLHF-------------LDYWRIIR-
A0A2A2RGF2      -----------------MDAAPKPTDSAPATPENRLHF-------------LDYWRIIR-
A0A2G4I5Y6      -----------------MDAAPHQAEPAPATPENRLHF-------------LDYWRIIR-
A0A6N6PS97      ------------------MEAAKFVPQDTATQESKLHF-------------LDYWRIIQ-
A0A3M1I883      ----------------------MQSTSSSARPQTEFHF-------------LDYWRIIR-
A0A1V6JZ45      ----------------------MDATKPNPISDSQLHF-------------LDYWRIIR-
A0A7C7Z746      -----------------MELSNSSNNQQINRPASKLHF-------------LDYWRIIR-
A0A520RRW5      -------------------MQTKPSQQPQQQSDSKLHF-------------LDYWRIIR-
A0A356NPK0      -------------------MQTKPSQQPQQQSDSKLHF-------------LDYWRIIR-
A0A2D7B5P5      -------------------MQTKPSQQPQQQSXSKLHF-------------LDYWRIIR-
A0A3D3XGB5      -------------------MQTKPSQQPQQQSDSKLHF-------------LDYWRIIR-
A0A2V6F8A1      ---------------------MEAPKTNSNPVETKLHF-------------LDYWRIIR-
A0A2V5TNH4      ---------------------MEAAKTNSNPVETKLHF-------------LDYWRIIR-
A0A2V5X5Q6      ---------------------METAKTNSNPVETKLHF-------------LDYWRIIR-
A0A4P5QM05      ---------------------------MTESNEAKLHF-------------LDYWRVVK-
A0A4Q3C001      ---------------------------MIDSSEVKLHF-------------LDYWRVIR-
B4DB23          ---------------------------MNDSNEVKLHF-------------LDYWRIIR-
A0A6B3L938      -----------MKKEIDPFSDDAVAEGSDAGSNVPVSN-------------RSAAGLIQV
A0A2V5URB2      EGPMKEISPHRARATMLLEDADLVSEPRLIESDEAPSL-------------RDYWQIVR-
A0A2V2DJ66      YGGYGAYGGYGG-----YGYGTNPAASGEGAEAPNRTL-------------RDYFMILR-
R7L5A9          GGGYGGYGGYGGSYGGYYGGYNSKNPAGEGG-VPNRTF-------------RDYMMILR-
A0A5R8KA81      -----------------MRKSPASSRKIQYDSTTAFTY-------------SDIFHVLR-
A0A5B5WU87      ----------------MNDLSPKKESLDAVGAASVSLF-------------PSPKAILGR
R7DZW0          ----------------MKDLSPKKETLDVGGAAPASLL-------------PSPRAIMGR
A0A2N8HID1      ----------------MKDLSPKKESLDAGGAAPVSLL-------------PSPRAIMGR
A0A2N8HS06      ----------------MKDLSPKKESLDAGGAAPASLL-------------PSPRAIMGR
A0A6N2TNT9      ----------------MKDLSPKKESLDAGGAAPASLL-------------PSPRAIMGR
A0A3R5R2M8      ------------------MNAAPNTTSPMEEEESSFSL-------------DTVLVILR-
A0A411SUQ6      SPGVQYFHTTFHPLSSMTNNTAPTPPVTENTEETALSL-------------DTVLTILR-
A0A2N8HZF2      ----------------MTNNTAPTPPVTENTEETALSL-------------DTVLTILR-
A0A354E720      ----------------MTKNTAPTPPGTENTEETALSL-------------DTVLMILR-
B2UPB6          ----------------MTNNTAPTPPVTENTEETALSL-------------DTVLTILR-
A0A2V6JLK8      ----------------MGGSPPKGPTGMAHNEEVKLHF-------------LDYWRVIR-
A0A2W5Z1A5      ---------------------------MAETDEGKLHF-------------LDYWRVVR-
A0A2V6EA09      ---------------------------MAHNDEVKLHF-------------LDYWRVVR-
A0A2V6GQI7      ---------------------------MAHNDEVKLHF-------------LDYWRVVR-
A0A3C1HEJ2      ----------------MATPSNYLPGDEGPEASSAVDL-------------PSARTLI--
A0A522ULD9      -------------------------MADKEAPEVGLHF-------------LDYWRVVR-
A0A1V6JU76      -------------MSYSYYTSQAAPPEASESSSSNLNL-------------RHYWNIVL-
A0A2A2XXW5      ----------------MEEQFQSQQGNSMSGADPSINL-------------RQYWHVIL-
A0A6N6Q6V0      -----------------MDNSQPNPIRSAGGTD-SRQL-------------RHYWQVML-
A0A1Q6UHJ9      GYGGGYGGGYGGGGYGYGYGYGGGQGEGGSPERPNRTF-------------RDYMMILR-
A0A2V2BXR0      ------------------------------------------------------MMILR-
A0A2D8V0G3      ------------------MEFQQSSQATETSVAENLNL-------------RHYWHILL-
A0A348S017      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A3C1UUV7      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A350I3V2      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A520RGV5      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A3D3XF90      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A2D7B522      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A356NIC2      ------------------MESNNQHSMENQSVAENLNL-------------RHYWHIVL-
A0A2N8HDG3      ----------------MPDTSAPPAVPPAEESESSLSL-------------DVITGILL-
A0A146GCJ0      ---------------------MPKDDGENLTSKPAVNLSFRDDTHGDLFDSERWFNLLR-
A0A2T6D6H8      ---------------------MVNKGAENKDRKSAAQVTLLRELSGEVIDFERLLNLLR-
A0A3D1TI55      --------------------------MDEKQQDSSLHF-------------LDYWRVIR-
A0A3E1ET42      --------------------------MREQLNESKMHA-------------LDYWQVIR-
A0A2A2YDW8      ------------------------MQPQSSNSEAALHA-------------VDYWQVIK-
A0A352XLN9      ------------------------MQPQSSNSEAALHA-------------VDYWQVIK-
A0A3D0YP62      -----------------------MQPQNSQQNEASLHA-------------IDYWQVLK-
A0A3D3DV47      -----------------------MQPQNSQQNEASLHA-------------IDYWQVLK-
A0A2E5XJ49      --------------------MQNDLDRQSAASEASLHA-------------VDYWQVLK-
A0A2E6SBY8      --------------------MQNDPDRQPAASEASLHA-------------VDYWQVLK-
A0A2E5QMS4      --------------------MQNDPDRQTAASEASLHA-------------VDYWQVLK-
A0A2E7YXQ3      --------------------MQNDPDRQTAASEASLHA-------------VDYWQVLK-
A0A2E3H787      --------------------MRNGPDRQTSASEAALHA-------------VDYWQVLK-
A0A2E7AGN1      --------------------MRNGPESQTNASEAALHA-------------VDYWQVLK-
A0A2E7AKY7      --------------------MRNGPESQTNASEAALHA-------------VDYWQVLK-
A0A3D4CU34      --------------------MRNGPESQTNASEAALHA-------------VDYWQVLK-
A0A2E8M146      --------------------MPNGPERQTNASEAALHA-------------VDYWQVLK-
A0A355S8S2      --------------------MPNGPERQTNASEAALHA-------------VDYWQVLK-
A0A2D6DVN8      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A3C1W2R2      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A2E3NAY6      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A2E3II01      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A368B8C5      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A3R7RBB5      --------------------MRNGPERQTNASEAALHA-------------VDYWQVLK-
A0A2A2QX62      ------------------------MNPTTNTSEASLHA-------------IDYWQVAK-
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      -----------------------MNTSAPQQNEAALHA-------------VDYWQVIK-
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      PNDGRYGYGY-QEYPGY----------GNENAAGHRTL-------------GDYLLILR-
A0A2A2PYE8      QNSSGYGYNYGGNYAGYSAVGYGYGEGGGGGSHSQRTF-------------QDYLLILR-
A0A2T6CN73      ESGGGYSYGTGGNYAGYSAAGYGYGD-AGESSTIQRTF-------------QDYLLIVR-
A0A2G4G428      GNYGGGYGGGYGRQRGGYGGGYGGGYGEGSSKDTEVSI-------------STYVNMVR-
A0A6N6PCD8      ----------------MATRPSTKATQPPASEAKLIDL-------------HAWFFLLR-
A0A139TV24      ---------------MPQPTVPPVSSPAPETPDSSLSL-------------DIVAIILR-
A0A2N8HT11      ---------------MPDTPAPPAAPPA-EEPESSLSL-------------DVITSILL-
R7DS70          ---------------MPDTPAPPAAPPA-EEPESSLSL-------------DVITSILL-
A0A2N8HNL6      ---------------MPDTPAPPAAPPA-EEPESSLSL-------------DVITSILL-
A0A6N6PAZ1      ---MPPLHRSNRQFLDRDDASDDSPEPDSAHADGQDKT-------------KRLMLNLL-
A0A6I1K459      -----------------MEPFEQPRAGDVSPEAGTLFN-------------RNLWHAFM-
A0A139TUL1      ----------------------MSIPVIQPEDNDIFSF-------------RFIFSTAR-
A0A2N8HCB0      ----------------------MPVSVIQPEDNDIFSF-------------RFIFSTAR-
A0A2N8HP04      ----------------------MPVSVIQPEDNDIFSF-------------RFIFSTAR-
A0A2N8HRJ0      ----------------------MPVSVIQPEDNDIFSF-------------RFIFSTAR-
A0A6N2U9Y7      ----------------------MPVSVIQPEDNDIFSF-------------RFIFSTAR-
A0A366HAG0      -------------------------MATPNNLELQRHA-------------LDYWQIIR-
A0A2U8DZK4      -------------------------MAYSDPVKESAPL-------------PAFLQTLN-
A0A2T6DFL8      -------------------------MANVHAAPVGASV-------------AGFLQILR-
A0A1D8AWD4      -------------------------MPTLPSTKDSATL-------------GDFVGLLR-
A0A4Q1C9S2      -------------------------MAFSPVSKDSATL-------------GDFVGLLR-
A0A178IH18      -------------------------MARPDSSSETAAL-------------PEFFQVLR-
A0A2T6DT99      -------------------------MASTHASREGASL-------------ADFFQLLR-
A0A1G3ZT33      -------------------------MASIITSRDGGSL-------------TDFFNILR-
A0A3E1E2T2      -------------------------MAQPSASKDSATL-------------ADFLRLLR-
B1ZMW1          -------------------------MVPTSASKDSASL-------------ADFMQLLR-
A0A3M1I8A3      ---------MAYQAYPQTAPADPVSLPPAGGAMGSMTL-------------RHYWHVLL-
A0A4V0XS84      -------------------MNSKGNLTQSKSLADKIDF-------------NEYWNVLR-
A0A351WE84      ------METSEATRASLVILGCGVKFMADSQQDTALHF-------------LDYWRVIK-
D5ENH7          G-------YGYGGGSYGYGGYGSGGGGAGYEQGPQRSA-------------KDYLLMFR-
A0A0R2XQ77      G--------GYGSNSYSDGGYGAGGY--GAGGAPQRSF-------------KDYFLMFR-
A0A2E9IN28      G-----YGYGYGGGYGYGGYGAGGGYGEGGGGAPQRSF-------------KDYFLMFR-
A0A6N4WTJ5      GYGGGSYGYGYGSGYGDGGSYGGGGY---GSGAPQRSF-------------KDYFLMFR-
A0A1V5QDZ6      -------------------------MEQQPSDSSGLHF-------------LDYWRVIR-
A0A4Y8P964      --MSEEIQRIPDQNFPSGQIQDPNSNLTAIPSDPYYSF-------STGQWLKDRLKEIY-
A0A3D4HF88      GYHGYHGYGGHGGAGYGGYGYGYGDDYSTQHRQPPRTF-------------RDYIFILR-
A0A6N6ZHN8      EGKGYGYGYGGGGYYGGYYYGDGYGGYAEAAVSPSRTL-------------KDYFLMLR-
A0A351MR11      SGGYGGYGGYGAYGESRYGGYGSVPAPGYGQAAGVNPL-------------ANYMLMLR-
A0A6G6K641      --------------MRSKNSDIEDDEDDVKGSGEGLSW-------------RVYYQALK-
A0A5B5WI95      -----------------MVNRPSPSPPVMEEEESNLSL-------------DLALAILR-
A0A2N8I9W1      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A4Q5IH27      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A2N8IBZ6      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A2N8IJW9      -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
R6J100          -----------------MANNTAPTPPVTENTEETTSL-------------DTVLLVLR-
A0A1V6J089      --------------------------MAEESQTTALHF-------------LDYWRVIR-
A0A3C1BZR1      --------------------------MAEESQTTALHF-------------LDYWRVIR-
A0A7C4KLL2      -------MVAPSQPHQSTQPIHYMPAPDITAPESPSEL-------------RTIAGILA-
A0A1H6KPB7      ----------------------MSSPAINQKSEASLHA-------------GDYLQILR-
A0A2E9ISN4      -----------MQIPNSTISESKPPTPADNDRETTTAF-------------SNPWALVQL
B9XAX1          ---------------MKLRLSNEREIAEMTEVDRPLDV-------------QEFLQTLI-
A0A5R8KKM9      -------------------------MNPSPPQEHRQHA-------------LDYWQIIR-
A0A139TS01      -----------------------MNAPDQQNGDPIVRN-------------IDYIQVLK-
A0A3E1EJT7      -------MNPPSPYARSSYAPVNPDFTDGEEPEDNDYL-------------RRWWVMVL-
A0A317ZP96      GGYGYGSYGYGGGYGYGGAGYGYGGGYGGGGGGPQRSF-------------KDYFLMFR-
A0A7C3I5X9      ----------MDYDLDRMGTAQGLPGEAEGAGGSKVNL-------------RHFWYVLL-
A0A2D5WGA5      ----------------------MDKLPKTDQSSDKLHI-------------LDYWRIIR-
A0A2E7SSH2      ----------------------MERKPGTEHSSDKLHI-------------LDYWRIIR-
A0A349GXM8      -------------------MATPRPGGGVSTEENKIDF-------------RIYLSVML-
A0A4P5YP61      ------------------MIQNRSESEFDQEAGSSVDL-------------RQIYHVFL-
A0A6B2LYM4      SNNQYQSGGSQGGYYGGYYYGEGYSGYADSGNAPSRSL-------------TDYLLILR-
A0A6D1VXB3      ---MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSF-------STGEWLKERFNEIY-
I0JYY7          ---MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSF-------STGEWLKERFNEIY-
A0A4R7S1J2      ----------------------MSLSSLPPQGPTRLNLPKTFSQDLESEADFDWRGLLI-
A0A2A2XV69      ------------------------MMNSSDSNEIQLHF-------------LDYWRVIR-
A0A651H7X9      QPPHQEPESTRPTPHRYAYSDSGIDSSPYGEGGPQRSI-------------KDYILILR-
A0A4Y8P842      SEELQKKPEDVLAVGSKEALPTEVLLSPYESSDLDWIK-------------QKLWDIYR-
B3DZK9          SEELQKKPKDNLTVGNKDVFQTEVLLSPYESSDLEWLK-------------EKLWDIYR-
A0A5E6MPC4      ----MEEIQPRPRESLGPLASGALPLEVSEEGSGWESV-------------RSLLSDVN-
A0A6N6PKP9      ----MERRIGPDPTLVLICIPMPRSTEKQPNSSLATDL-------------RGLYFALR-
A0A6N6Z250      -----------------------MSAAGADPHSEPLSL-------------GEVLRILR-
A0A4V1SB02      -----------------------------------MNP-------------LHYLYLFL-
A0A6N6QEJ2      -----------------MEAIKTQASAASGISDSKLHF-------------LDYWRILR-
A0A3C1VB86      --------------MPNPDPLDLPPSLETSAPGSISDL-------------HGVIRLLL-
A0A146G2Q9      -----------------------MSLESPDSGEIKLHF-------------LDYWRVIR-
A0A2T6D3Y2      -----------------------MSFESPDSGEIKLHF-------------LDYWRVIR-
A0A6N6P5E3      -------------------MQSNIQTTESGTGEIKLHL-------------LDYWRVVR-
A0A2D5VY59      ----------------------MQSKPVPQQSDSKLHF-------------LDYWRIIR-
A0A2D8UZZ4      ----------------------MQSKPVPQQSDSKLHF-------------LDYWRIIR-
A0A353DV86      ----------------------MQSKPVPQQSDSKLHF-------------LDYWRIIR-
A0A2E5EPT8      ---------------------MEYQSNGPTSSDNRLHF-------------LDYWRILR-
A0A6J4HTK1      ---------------------------MAQTDEVKLHF-------------LDYWRVVR-
A0A6N6PHJ5      ---------------------MEPLKQQ-AQQESRLHF-------------LDYWRIIR-
A0A6M1RXR2      ---------------------MEPNKVATPPPETKLHF-------------LDYWRIIR-
A0A7C3DXS4      ---------------------MDATKVATPPPETKLHF-------------LDYWRIIR-
A0A2V2SDV4      ---------------------MDPIKAA-APQDSKLHF-------------LDYWRIIR-
A0A2V5PK75      ---------------------MDPLKVP-ASQETKLHF-------------LDYWRIIR-
A0A1V6DME1      ---------------------MDPLKTT-PPPETKLHF-------------LDYWRIIR-
A0A3D3DIJ3      ---------------------MDPLKVA-PPQEAKLHF-------------LDYWRIIR-
A0A6I1K583      -----------------MDAASNYATPAAGTPENRLHF-------------LDYWRIIR-
A0A350EWA4      -----------------------MDSFKQDQPTASLHF-------------LDYWRIIR-
A0A5B5WZ91      -----------------------MNAPDLQNGDPIVRN-------------IDYIQVLK-
A0A2N8HD92      -----------------------MNSQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8HIT2      -----------------------MNAQDQQNSDRIVRN-------------IDYLQVLK-
A0A354EBD3      -----------------------------------VRN-------------IDYLQVLK-
A0A355VEB2      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8IMT3      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
R6K1U5          -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8IWC2      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8I441      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A2N8I3A6      -----------------------MNAQDQQNSDRIVRN-------------IDYLQVLK-
A0A410SCC4      -----------------------MNAQDQQNSDRIVRN-------------IDYLQVLK-
A0A3R5VEW0      -----------------------MSVQDQQNSDRIVRN-------------IDYLQVLK-
A0A411SSG2      -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
B2UKW3          -----------------------MSAQDQQNSDRIVRN-------------IDYLQVLK-
A0A7C3HWX0      ---------------------MDTSKTSSAPQDSPLHF-------------LDYWRIIR-
A0A7C4KPD7      --------------------MDSTKSFGTPQAETKLHF-------------LDYWRIIR-
A0A1M6RLZ4      ----------------------MQQNNSLNPSEASLHA-------------VDYWQIVK-
A0A354T7G8      --------------------------MNETGSEFQKHA-------------MDTWQVVK-
A0A2S7U4L6      ----------------------MQPNNSLNTSDATLHA-------------VDYLQILK-
A0A512MBZ2      --------------------------MSEAGKDIQAQA-------------IDSWQIIR-
A0A2E8MEZ0      ------------------------MQGTNFRNADDAPS-------------VDYWQVVK-
A0A6B3LBV6      ---------------MANPPYFNPNRFQQNSQESGPQV-------------GDYWQVIR-
A0A2E3EC33      ---------------------------MAKQSETKLHA-------------LDYWQVIR-
A0A2E4GN01      ---------------------------MAKQSETKLHA-------------LDYWQVVR-
A0A1Z8XU55      ---------------------------MAKQSETKLHA-------------LDYWQVAR-
A0A2E1RQR9      ---------------------------MAKQSETKLHA-------------LDYWQVAR-
A0A2E3ISQ4      ---------------------------MAKQSETKLHA-------------LDYWQVAR-
A0A2D6W6F4      ---------------------------MAKQSETKLHA-------------LDYWQVAR-
A0A2D8Z5A8      VEKTSECSYFADSKFILNSPQIKYIXTMAKQSETKLHA-------------LDYWQVAR-
A0A4Q2YKS3      -----------------------MQSPSTQQSEAALHA-------------VDYWQVIK-
A0A6N6P3T8      -----------------------MPTPPPQQSETALHA-------------FDYWQVIK-
                                                                            

A0A2A2XVF1      --QRWWVITLLVGVSMMAATGYV-MRQP--KIYESRAVLQV---QQSEQQV-------VN
A0A2V5UHJ2      --RHRWLILSCALALFIGATLYT-FTRT--PLYTADATLLI---ERKAPQILKLQDARAD
A0A2V5PST3      --KRRRIIIQIFIIFLLVGAYFT-FTAT--PVYKATATLKI---EPINPMVTGVTGVGES
A0A2V5PXM3      ------------MVAAIGTTTYL-LRAP--KIYASKLVLQV---EQEEQKILNI----QR
A0A1V5QB01      --KRIWLVALCFVLSLTVMVAIL-VRQV--PVYRCRVTLLM-----------------SK
A0A7C5LI63      --KRKWLILVCFLLSMAGATVFL-FTRQ--PIYRANARLLV---TTAG-SL-------PT
A0A7C5P291      --KRKWLVLICFLLSMAASTAFL-FTRQ--SIWRANCKLLV---TSAGAAL-------PS
A0A139SU05      --ERFWIALPLALLVSLVIGYYQ-ARQT--PMYASTAIIQF-----------------ER
A0A139SPN4      --ERFWIALPLALLVALGIGYYQ-ARQT--PMYASTAIIQF-----------------ER
A0A1V6E7N1      --ERLWIALPIALLVAVGIGYYQ-SRAT--PLYQSRATLRF-----------------EK
A0A2D9MYT1      --ERRWLVAATFLVVIILTAFYL-FSAT--PIFSATTRLQI---DRETENA-------LR
A0A258ANJ7      MRRHSWIPITLSLFGLILGYAYF-KRQK--PVYEAVSVAQF---GSEQSSL-------LG
A0A290QGD9      --ERIWYILAVFLVIFSCVLVYT-LTQT--KIYQSRSLIQI---LRRDPAV-------LK
A0A1D8AS58      --ERVWYIVLVFALVFSAAVIFT-FTRV--PRYTSVASVQV---FRNDPVV-------MQ
I6AQC1          --ERIWYIVVVFLVIFSSALVYT-FSQT--KIFSSSATVQI---MRRPAMT-------LP
W0ITH7          --ERIWYIVVVFLVIFSSALVYT-FSQT--KIFSASATVQI---MRRTAVT-------LP
A0A139TLN4      IIRNWYWCLLSLCICLPLAYLYA-ARLP--FVYGKATTVLI---KNDYPKESVATTVLAT
A0A1G3ZFT0      --EHKWLIAVIIAISLMGGKYYA-SKQI--PVYNPDVLIQV---ESNRGVSGLTIGLPGM
A0A1Z8ZMT6      LIARWHWILIGSLLGVVLGVITI-RMSV--PEYRSTATVRVKSQNSGSMGNSSDSDDIDL
A0A2E8MCT7      LIARWHWILIGILLGVVLGVINI-RMSV--PEYRSTATVRVKSQNSGSMGNSSESEDIDL
A0A290Q2Z2      --LRKALIFLILSLVVITTVVVT-AFLP--KWYLSTLNVRV---EKPEGEVKLFQAQSSG
A0A2A2RGK2      --DRLWIVILCVILGGIYAGFTL-SKIE--TTYRARAVLFI---EQDQARILD-----PR
A0A2A2XXF7      --DRLWIVILCVVVGGIYAGVTL-SKVE--TTYRARAVLFI---EQDKSRILD-----AK
A0A2A2R5D6      --NRAAIIVTVLLLTLMTGYVVTVYVMQ--KMYDAKAQLRV---YKEKSDV-------EF
A0A1J4XH17      --ERVWLLVFVFAIIFLGSIIYL-IKAT--PIYEAEAMLQI---LRDDTTV-------LG
A0A3C1VJ32      --IRKAIIITVFLITAIIATAVT-LILP--ESYASTARIKV---ENEGGIVS------GM
A0A2N9NTX7      --IRKTVILAVFLLVVITATVVT-FILP--PKYKSMARIKI---ERDQTDIP------SL
B9XK55          --IRKTVILAVFLLVVITATIVT-FILP--EQFSSTARIKV---EGDTTDVP------GI
A0A4P5YMI6      --IRKMVILTVFLLVVITTTAVT-YVLP--KTYMSSVRIDV---QKDVSDVQ--------
A0A2E6T482      --VRFVTILLVFLLTAVTTTVVT-FLLP--RTYMSLSRISV---EKDSSDIA------PL
A0A3C0DQZ7      --VRFVTILLVFLLTAVTTTVVT-FLLP--RTYMSLSRISV---EKDSSDIA------PL
A0A1Z9CBK5      --VRIATILLVFLLTAITTTVVT-VMLP--STYMSLSRIAV---EKDTSDIA------PL
A0A2D6ZI96      --VRIATILLVFLLTAITTTVVT-VMLP--STYMSLSRIAV---EKDTSDIA------PL
A0A358KGZ3      --VRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAV---EKDTSDIA------PL
A0A2E9ZQX4      --VRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAV---EKDTSDIA------PL
A0A3D5JZU0      --VRIVTILLVFLLTAITTTVVT-FLIP--KTYMSLSRIAV---EKDTSDIA------PL
A0A2E6HCR0      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSISRIAV---EKDTSDIA------PL
A0A1Z8WN04      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2D7L1N4      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2E2R937      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A520QQY4      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2D5MR66      --VRIATILLVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2E0PDQ1      --VRIAIILVVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A2E2ZZP9      --VRIAIILVVFLLTAITTTVVT-FLIP--PTYMSLSRIAV---EKDTSDIA------PL
A0A7C4LRK7      --VRKTVILTVFMLVVLTTTLVT-QYLP--QYYSSTARIEV---EKDMPDVE------GW
A0A2A2RGF2      --MRALLIFVVFALVVGTTALLT-HNME--PTFMSTVRMDV---QKDVGDIS------S-
A0A2G4I5Y6      --MRGLLIFVVFALVVGTTAVLT-HSME--PTYMSTVRMDV---QKDVGDIT------S-
A0A6N6PS97      --VRKTVIIAVFLLVVITTTVVT-YILP--KTYMSTAQIEV---QKDLSDIP------L-
A0A3M1I883      --IRKMVILAVWLLVVLTTLAVT-FVLK--PTYASTVRIEI---EKDATDIP------T-
A0A1V6JZ45      --IRKTVILAVFLLVVLTTTAVT-FVLK--PTFMSTARIEV---EKQPTDFD------P-
A0A7C7Z746      --IRKMVIIAVFLLVLLSTTAIT-LILP--KTYSSTVRISV---AKDATDIP------G-
A0A520RRW5      --IRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAI---EKDNSDIT------P-
A0A356NPK0      --IRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAI---EKDNSDIT------P-
A0A2D7B5P5      --IRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAI---EKDNSDIT------P-
A0A3D3XGB5      --IRKTVILAVFLLVVLTTAIIT-FLIQ--PTYASSVRIAI---EKDNSDIT------P-
A0A2V6F8A1      --IRKTVILAVFLLVVLTTTAVT-FILP--ESWSSMVRIAV---EKDISDIS------P-
A0A2V5TNH4      --IRKTVILAVFLLVVLTTTAVT-FILP--ESWSSTVRIAV---EKDVSDIN------P-
A0A2V5X5Q6      --IRKTVILAVFLLVVLTTTAVT-FILP--ESWSSTVRIAV---EKDVSDIN------P-
A0A4P5QM05      --LRLGLILLTFFLVMVSAEVYV-YFLP--RQFYSHVTVEI---KPDVFDRL------NE
A0A4Q3C001      --VRAGLITLVFLLVMITAGVTT-YFMP--RQYLAKVSMVV---KPDSTKGV------SI
B4DB23          --LRMGLILLTFFLVMVTAGVTT-YFLP--KKYYSKVTMEV---KQDKSDLV------QT
A0A6B3L938      ALEKWWMIVIFAALGYVAALYYL-SIKE--PTTKARAVVEV---TTKELQLV------GQ
A0A2V5URB2      --KHKWKILACFLAAVVITAIIV-FSMT--PIYTATATLLI---ERKAPQVVKIQQVLSE
A0A2V2DJ66      --ERLWYIIVTFIVIFSGIALYT-LRIT--PLYTSASSVLI------FREAAAPIDGPGS
R7L5A9          --ERFWYIIVTFFIIFAGVLLYT-FRIT--PIYTSAASVQI------LRDSDSPIDGPGS
A0A5R8KA81      --DKAWLIVLCLLVAAFIVAAML-VRSV--PLYQSRVVVQV---EQSETKVL------DS
A0A5B5WU87      IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPKESVAATVLAT
R7DZW0          IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPRESVAATVLAS
A0A2N8HID1      IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPRESVAATVLAS
A0A2N8HS06      IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPRESVAATVLAS
A0A6N2TNT9      IVRKWYWCVLSLCICLPLAYLYA-ARQP--QVYGKATTILI---KDDYPRESVAATVLAS
A0A3R5R2M8      --RFWFLIILAAIAGGSLAFYLA-GRQN--YVYQKTASVMM---RDAKSGTDASSERIMS
A0A411SUQ6      --RYWFIIILAALAGGTAAYYLA-GKQN--YIYQKTASVLM---RDAKTGSDASSERIMA
A0A2N8HZF2      --RYWFIIILAALAGGTAAYYLA-GRQN--YIYQKTASVLM---RDAKTSSDASSERIMA
A0A354E720      --RYWFIIILAALAGGTAAYYLA-GKQN--YIYQKKASVLM---RDSKTGSDASSERIMA
B2UPB6          --RYWFIIILAALAGGTAAYYLA-GKQN--YIYQKTASVLM---RDAKTGSDASSERIMA
A0A2V6JLK8      --IRWVLVLLAFLLVLITAAIFT-YFQP--REYKADVFVEV---KSTAENPRIF------
A0A2W5Z1A5      --VRWVLILLAFSLVLITAAVVT-YFQP--REYQSSAFIEV---RSTAQNPHIF------
A0A2V6EA09      --VRWGLISLAFFLVLITAAIVT-YFQP--REYKASAFIEV---KSTAENPRIF------
A0A2V6GQI7      --VRWGLISLAFFLVLITAAIVT-YFQP--REYKASAFIEV---KSTAENPRIF------
A0A3C1HEJ2      --EKAWVVVLCLLAAGFITYGYL-KRAP--VIYASTVTLKV---EEQSQKIL------SG
A0A522ULD9      --SRKEIVLAVALLVIITVTAWT-MTLP--RMYETEVKVSL---KEDQADV-------EV
A0A1V6JU76      --QRRWLVIATFVSVFVLCLVYL-FKAP--RIYSATARLQI---DRESAAS-------LN
A0A2A2XXW5      --ERRWLIVATWSVCIIAGVLYA-FQAT--PMFRAIARLQI---DPENQGV-------LN
A0A6N6Q6V0      --ERRWLIIVIFLGFVSAGFVYA-FRST--PIYESVARLEI---DPEGTGV-------LS
A0A1Q6UHJ9      --ERWAYILITALIILAGVILYT-LRVT--PIYMSVSRVQI------LRDSDVAIEGPGS
A0A2V2BXR0      --ERWAYILITALIILAGVILYT-LRVT--PIYMSVSRVQI------LRDSDVAIEGPGS
A0A2D8V0G3      --ERRWLVITTFISVVILSVLYL-YRAV--PIYQAKTVLQI---NKESTSI-------MD
A0A348S017      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A3C1UUV7      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A350I3V2      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A520RGV5      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A3D3XF90      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A2D7B522      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A356NIC2      --ERRWLVIVAFISVFILSILYL-FKAT--PIYEAKTVLQI---NKESTSM-------MD
A0A2N8HDG3      --RRWYWILLFALIGGGAAYYLT-GRQN--YIFEKTASVIM---RESSKEST------SD
A0A146GCJ0      --SKAWLIAAVAVVVVIGAAAYA-FRLP--KIYESRALLQV---EQLAQKV-------VD
A0A2T6D6H8      --ARAWLVIVVAVIFFAAAFAYA-LRSP--KIYESRALIQV---EQASQNV-------VD
A0A3D1TI55      --ARKEIIITVSVLIILTVFIIT-LIMP--EKYRASVRITI---DQYRPDIELV------
A0A3E1ET42      --NRWGVILLTFFLIALASLVII-ALLD--KKYQSTTRFRV---LL-----------SSA
A0A2A2YDW8      --NRYGVILITLLLVFMTAAVIT-YVMP--RKFESRAVVQV---NP-----------SNR
A0A352XLN9      --NRYGVILITLLLVFMTAAVIT-YVMP--RKFESRAVVQV---NP-----------SNR
A0A3D0YP62      --NRYGVILLTFLLVFLTAAVIT-YVMP--KKYESAALVEV---KP-ISDIDPVGMRGGG
A0A3D3DV47      --NRYGVILLTFLLVFLTAAVIT-YVMP--KKYESAALVEV---KP-ISDIDPVGMRGGG
A0A2E5XJ49      --NRYGVILLTFLLIFMTAAVIT-YVIP--KQYESTALVQV---NHSFVELDPL---NGV
A0A2E6SBY8      --NRYGVILLTFLLIFMTAAVIT-YVIP--KQYESTALVQV---NHSYIELDPL---NGA
A0A2E5QMS4      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFVELDPL---NGA
A0A2E7YXQ3      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFVELDPL---NGA
A0A2E3H787      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFVELDPL---NGA
A0A2E7AGN1      --NRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NYSYIELDPL---NGS
A0A2E7AKY7      --NRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NYSYIELDPL---NGS
A0A3D4CU34      --NRYGVIILTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NYSYIELDPL---NGS
A0A2E8M146      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A355S8S2      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A2D6DVN8      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A3C1W2R2      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A2E3NAY6      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFVELDPL---NGS
A0A2E3II01      --NRYGVILLTFVLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A368B8C5      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A3R7RBB5      --NRYGVILLTFLLIFMTAAVIT-YVLP--KKYESTALLQV---NHSFIELDPL---NGS
A0A2A2QX62      --NRYGVILLTFLLVFMTALVIT-YVMP--KKYESTAVVQV---RPKGAGAVMM---PGT
A0A4Q3BWH6      ------------LLVFMTALVIT-YVMP--KKYESTATVQV---RPMGTGTQVI---PGV
A0A3N5WCF1      --NRYGIILLTLLLVFMTAAVIT-YVMP--KKYESQAVIEV---KPRMPGMSPL---GAA
A0A4Q3C1K5      -------ILLTLLLVFMTAAVIT-YVMP--KKFESEATIEV---KPRSAGISPL---GPG
A0A3R8IT45      --ERIWYIVVVFLVIFSSALVYT-FSQT--KIYRAMATAQI---LRKTATMF------SQ
A0A2A2PYE8      --ERIWYIVVVFLVVFSSSLVYT-LSDT--KIYQSSATVQI---FRRDPTVM-------Q
A0A2T6CN73      --ERIWYIVVVFLVVFSSALVYT-LSKP--KIYESTATVQI---FRRDPTIM-------P
A0A2G4G428      --ERIWWLVLSVLIFFTLSLVYT-YNMM--PEYKASGRLRV---FRLAPNISG-----SN
A0A6N6PCD8      --EKWWIIALCLFGMLALAGAYL-LRKV--PVYTAATIVQV---TEAADNV-------IN
A0A139TV24      --RRWYWILFCALLGGTAAYYMA-ATQN--YVFEKTASVMMREASKD-SS--------TD
A0A2N8HT11      --RRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDSSS--------SD
R7DS70          --RRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDSSS--------SD
A0A2N8HNL6      --RRWYWILLFALLGGAGAYYVT-GKQN--YIFEKTASVIMRESNKDSSS--------SD
A0A6N6PAZ1      --GRWHWIVLGGVLGLLSASYYL-AKCP--KQYTATATLLI---KQQTASV-------MA
A0A6I1K459      --EKAWLVVCIMAAAAAAGIWTS-NRTP--PVYQSRAVMFF---DFGEQKV-------LN
A0A139TUL1      --RYWLWILAAALLGGAGAYFIF-ARQG--YLYEKTARIMLRDDKQKNSQV-------SE
A0A2N8HCB0      --RYWPWILACALLGGGLAYFIS-ARQG--YLYQKTARIMLRDDKQKNAQV-------SE
A0A2N8HP04      --RYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQV-------SE
A0A2N8HRJ0      --RYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQV-------SE
A0A6N2U9Y7      --RYWPWILACALLGGGLAYFIC-ARQG--YLYQKTARIMLRDDKQKNAQV-------SE
A0A366HAG0      --NRLGLILASFIFIFAVAAVLT-YIMP--RKFRGRVEMVI---ERKLDDARVV----GN
A0A2U8DZK4      --LRKALILLILALVVITTIAVT-AFLP--KWYRSKASIRV---LKIGTTSAVF------
A0A2T6DFL8      --QRQWLIALILALVVVTTIGVT-AFLP--KGYRATTKVRV---ERPDGQVKLF------
A0A1D8AWD4      --LRKGLIFLVLGLVLLTTLGVT-ALLP--KWYLSTAKISV---QKPESEVKLF------
A0A4Q1C9S2      --LRKGLVFLVLALVVLTTLGVT-ALLP--KWYLSTTKISV---QKPESEVKLF------
A0A178IH18      --QRKFLILLVMALVVGTAAVVT-ALLP--KWYLSTINIRV---EKPEGKV-VF------
A0A2T6DT99      --LRKALIFLILSLVVVTTAVVT-ALMP--KWYVSTLNVRV---EKPEGEVKLF------
A0A1G3ZT33      --LRKALIFLILALVLLTTLGVT-ALLP--RWYLSTVAMRV---EKPESEVKLF------
A0A3E1E2T2      --LRKSLILLILSLVVITTVAVT-AFLP--RWYLATAKIRV---EKPESEVKLF------
B1ZMW1          --QRKALIALILGLVLITTIVVT-AFLP--RWYLATTKIRV---EKPEGEVKLF------
A0A3M1I8A3      --ERRWLVIMVLILSVAASVGYV-VKAP--RIFRATVRLQI---DPESETGV------NL
A0A4V0XS84      --DQRYLIVATFICVFASCVFYL-YKAP--RIYQATVSLQV---DKDSDNAL------SG
A0A351WE84      --SRKEIVMAVTLLIVITGVAVT-FMQP--KKYSSTVRILV---REDSMDVDVF------
D5ENH7          --ERIWWMIVAFFIIFSGAILYT-FNKT--KVYTAVAQVRL---LREDPAAMG------D
A0A0R2XQ77      --ERVWYLIVAFFIIFSGSILYT-FNKT--KVYTAVATVQL---LRDDPSAMA-------
A0A2E9IN28      --ERIWYLIVAFFIIFSGSILYT-FNKT--KIYTAAAQVQL---FRDDASALG------K
A0A6N4WTJ5      --ERIWYLIVAFFIIFSGSILYT-FNKT--KVYTAVAMVQL---LRDDPSAMAV----MG
A0A1V5QDZ6      --SRKEVILAVLLLVVVTGTSFT-LTLP--KKYMADARILV---RDDSLDVDVF------
A0A4Y8P964      --RYKAIVLISFLLILLFTIIFT-FTQQ--PVYQGVTTVKI---NFNKSEVLPY----KS
A0A3D4HF88      --ERIWFFLVIFLIVFLGSVLYT-FNTT--PLFTAGATVQV---LRDPVNPLG-----AG
A0A6N6ZHN8      --ERIWWLIISVIVVFIAMAVFT-FSSP--RQYRAMAAIEL---LRSPDEV-------LP
A0A351MR11      --ERMWYLVLTVLVFVTAALIYT-VNAT--PEYRASGRLKV---YKYAPNIT------GR
A0A6G6K641      --ERLWLIILFAIAGVVYAAYQS-NKAV--PIYASRAVLQF---ESPRRIMPL-------
A0A5B5WI95      ------RYWFIIMLAAVAGGMLA-FYLAGRQNYVYQKTASI---IMRDAKSGTDASSDRI
A0A2N8I9W1      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A4Q5IH27      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A2N8IBZ6      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A2N8IJW9      ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
R6J100          ------RYWFIIILAALAGGTAA-YYLAGRQNYIYQKTASV---LMRDAKTSSDASSERI
A0A1V6J089      --DRKEVILAVALLTIVSGTAYT-LMMP--KKYTALTQIQV---REDAMDVD------PF
A0A3C1BZR1      --DRKEVILAVALLTIVTGTAYT-LMMP--KKFTATTQLEV---REDAMDVD------PF
A0A7C4KLL2      --EKAWLIILCVVVALLVAAYHL-KNSP--RLYQAVATVQV---EQEEKKA-------VK
A0A1H6KPB7      --NRWKEAVLVFVLVFVAAAVAT-YLMP--PSYTSVINFEI---KKPGAIVSL-----SR
A0A2E9ISN4      IFRHWSWLVCSVVLCTLLGGLYA-YLAT--PIYRATARIEI---LNDS----------RV
B9XAX1          --EKWWLIVLVTCAVTLPAFWWV-RNVP--VGYQARAVLQV---EQEEQRL-------VG
A0A5R8KKM9      --NRLGLIFLCFLLVFAAAAVIT-HVMP--RKYRAVVEIEL---KRQLKDTNVFGQL---
A0A139TS01      --NRWKEVFLVFMLVLVISLVVT-LLMP--PSFRATSKFQI---KRPRPVMGI-----GT
A0A3E1EJT7      --ERKWYALAAFVVIVAGVSAYT-FLST--PIYAGQVTVQV---LKHGSQV-------MR
A0A317ZP96      --ERIWYLIVAFFIIFSGSILYT-FNKT--KVYTSAATVQL---LRDDPSAL------GD
A0A7C3I5X9      --ERRWLVITTYVIVLALTGLYL-YWAP--KVYRATTRLQI---DPEAEAAV------NL
A0A2D5WGA5      --VRFINIMLVFLLTALTTTLVT-FLLD--KTYMSQSRISI---EKDTSDIA------PL
A0A2E7SSH2      --VRIATILLVFLLTAITTTAVT-FLIP--ATYMSLSRIAV---EKDTSDIA------PL
A0A349GXM8      --FRWQLIALCFLYTMLGAVAYL-YLAP--KTYESNTKIMI---YRDPLLT---------
A0A4P5YP61      --ERIWAVLLVLTLTTFLGGLYV-VRSP--KIYSATLTLQV---EQESKIVDL-------
A0A6B2LYM4      --ERIWWLVVSIFVVFLGFALYT-FNAP--KLYRAAASVEI---LRQKDQV-------FQ
A0A6D1VXB3      --RYKAVVVISFLLILLFTILFT-FTQK--PVYRGVATIKI---NFNKSEVLPY----KT
I0JYY7          --RYKAVVVISFLLILLFTILFT-FTQK--PVYRGVATIKI---NFNKSEVLPY----KT
A0A4R7S1J2      --TAREKLWLLILLPLIGAAVSYGYLKQAKPVFSSNATLEV---EEKQRVVDV-------
A0A2A2XV69      --IRLPLIVLVFLLVVITTGVVT-YFLP--KQYESSVTMQV---NQNDTYL-------QV
A0A651H7X9      --ERIWYIIIIFLAVFSAALIYT-LTRP--KVYEAVASVEI---LRTSPVV-------LQ
A0A4Y8P842      --FRRQALLF-FLVVLFIVLLFT-FTQK--PIYRGESLVKV---NSTKAEVVPY----KQ
B3DZK9          --FRKQALLF-FLVCLFVVFLFT-FSQK--PIYRGESVVKI---NSTKSEVVPY----KQ
A0A5E6MPC4      --RYRGAALLFFAAVFLLTVVAT-FSQK--PIYEGIAVVKIGTGAESSSIVPYRQIGQDQ
A0A6N6PKP9      --EKAWLLALVTVLGIAAAAFVV-RRSQ--KIYAATTTIQI---EEERQRV-------VR
A0A6N6Z250      --EHWLVVFTVAALAIFAAAAWTQLFME--PWYYAESTIRV---EQADRESDVLRPM---
A0A4V1SB02      --RYSWLIILIVAIMMGGTWAWL-SKQS--PVYASRAVLQV---DMDEGNL-------VN
A0A6N6QEJ2      --LRKAIILTVFLLVVGTVAVVT-HFLT--PLYLSTVGMKV---EKDTPDV-------GP
A0A3C1VB86      --DKSWLIVSCLVLALLAAAVYV-ERAP--RVYAATTTVQV---EQADAKV-------VK
A0A146G2Q9      --VRLPLIILVLLLVVITAGVVT-YFMP--KQYASTVTMQI---RQNDKVLQVF------
A0A2T6D3Y2      --VRLPLIILVLLLVVITAGVVT-YFMP--KQYASTVTMQI---RQNDKVLQVF------
A0A6N6P5E3      --VRLPLIILVFLLVVITAGIGT-YLTP--RQFLSSVTMQV---KEDNNKMQIF------
A0A2D5VY59      --IRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAI---EKDSADI-------TP
A0A2D8UZZ4      --IRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAI---EKDSADI-------TP
A0A353DV86      --IRKTVILAVFLLVVLTTALVT-YILK--PTYSSSVRIAI---EKDSADI-------TP
A0A2E5EPT8      --LRKGVIFVNFIFVVLVATFVT-YLLP--KTYKSTVRMDV---KKDTASDI------EL
A0A6J4HTK1      --VRWVLILLAFLLVLITAAVVT-YFQP--REFQSSVFIEV---RSTAQNVR------LF
A0A6N6PHJ5      --IRKTVIIAVFMLVVITATLVT-FILP--EQFASTATIKI---ERDKSDID------EM
A0A6M1RXR2      --IRKTVILAVFFLVVLTAVIVT-YMMP--QRYASTALIKV---ERDISDIR------GF
A0A7C3DXS4      --IRKTVILAVFFLVVLTATLVT-YMLP--QRYASTARIKV---ERDITDIR------GL
A0A2V2SDV4      --IRKAIILAVFLLVVITTVVVT-FIYP--ESFSGTARIRV---ERDQSDIS------GV
A0A2V5PK75      --IRKTVILAVFLLVVITATLVT-FILP--ESYSSKARI-------DSPDIS------GI
A0A1V6DME1      --IRKTVILAVFLLVVLTATLVT-WILP--VSYSSEARIKV---DRDVSDIP------GM
A0A3D3DIJ3      --IRKTVILAVFLLVVITATLVT-FILP--ESYSSKARIKI---DRDQTDIS------GL
A0A6I1K583      --MRGLLIFVVFALVVGTTAVLT-HWME--PTFMSTVRMDV---QKDVGDISSLMPQQQQ
A0A350EWA4      --IRKTVILAVFLLVVLTTTLVT-FLLP--ESYSSTVTIEV---KKDSSTL-------DR
A0A5B5WZ91      --NRWKEVFLVFMLVLVISLVVT-LLMP--PSFRATSKFQI---KRPRPVMGI-----GT
A0A2N8HD92      --NRWKEVFLVFLLVLVISVVVT-FLMP--PAYQTRCQFQI---KLPKPVMEI-----GQ
A0A2N8HIT2      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMEI-----GQ
A0A354EBD3      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A355VEB2      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A2N8IMT3      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
R6K1U5          --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A2N8IWC2      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A2N8I441      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A2N8I3A6      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A410SCC4      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A3R5VEW0      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A411SSG2      --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
B2UKW3          --NRWKEVFLVFLLVLVISVVVT-FLMP--PSYRATSQFQI---KLPKPVMDI-----GR
A0A7C3HWX0      --IRKTVILAVFLLVVLTTVGVT-MMLK--PTYSSTARIEI---GKETKAIDPLGRT---
A0A7C4KPD7      --VRKTVILTVFMLVVLTTTLVT-QFLP--PTYESVARIEV---EKDMPDVEGFRER-PV
A0A1M6RLZ4      --NRYGIILLTFILVVVTAAVIT-YVMP--KKYESVAQIEI---KPLGIKTD------TV
A0A354T7G8      --NRIGLITLCFILIFAAAAILT-YIMP--RKYRGHVEMTI---ERITQDINVFDRN---
A0A2S7U4L6      --NRYGIILLTFILVVLTAAVIT-YVMP--KKYEAIAVVKI---NPLGTN--------NQ
A0A512MBZ2      --NRFGLICLSFLLVFATAAIIT-YIMP--RKYRGRVEMKI---ERLQNKVQVFNRD-TS
A0A2E8MEZ0      --NRYGVILLTFLLVFMTAAVIT-SVMP--RKYESSSVVQV---HPSVLLMTPFLGG---
A0A6B3LBV6      --NRYEVILLSLLLVLITAGFIT-VMME--EKYESTVVVQL-------TDISQMGGDLTN
A0A2E3EC33      --NRYTVILLTFFLVIMTAAVIA-YLRP--PEYLGRVQIQV---QREARDLEVFRET-GS
A0A2E4GN01      --NRYSVXLLTFFLVXMTAMVIA-YLRP--PEYLGRVQIQV---QREARDLEVFRET-GT
A0A1Z8XU55      --NRYSVILXTFALVFMTALVIA-YLRP--SEYLGRVXIQV---QRVARDIEVFRET-GS
A0A2E1RQR9      --NRYSVILXTFALVFMTALVIA-YLRP--SEYLGRVXIQV---QRVARDIEVFRET-GS
A0A2E3ISQ4      --NRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQV---QREARDIEVFRET-GS
A0A2D6W6F4      --NRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQV---QREARDIEVFRET-GS
A0A2D8Z5A8      --NRYAVILLTFALVFMTALVIA-YLRP--SEYLGRVQIQV---QREARDIEVFRET-GS
A0A4Q2YKS3      --NRYGVILLTLLLVFMTAAVIT-YVMP--KKFESSAVIEV---KPRGQILSPFGERGSE
A0A6N6P3T8      --NRYGLILLTLLLVFMTASVIT-YVMP--KKYESYAKIEV---KPRGTLITVFKGM-ED
                                                                            

A0A2A2XVF1      IDGVSQENP-SSP-----DFINTVVQSITSRNLMLRVIDA--------NKLRT-------
A0A2V5UHJ2      SVDYNDYNN---------EFYKTQYEILKSRALAERVVRD--------EGLESHPLFGGG
A0A2V5PST3      GARTAEGGGPY-------DYYQTQYKLLASSALAARVIAD--------LRLDS-------
A0A2V5PXM3      VQQEDPQSL---------EFLKTVEQTFESRSLFERVLDT--------NNLATDPRFLKI
A0A1V5QB01      GVPMPYSLR-QVESQPMGDYLATQQLIIQSGQLISRARAR--------LNKPA-------
A0A7C5LI63      AEVVVEQAR---------TFFATQLNIMQSQTMLRRVQQR--------MKKTP-------
A0A7C5P291      AELSREDER---------SFYSTQVEIMSSPTMLRRVQQR--------LKKTD-------
A0A139SU05      PETVVTTQTVMDATIRNELDLNTYIHQLTSNRVRTRVLES--------LTPEE-------
A0A139SPN4      PETIVTTQGVVDASIRNEIDLNTYIHQLTSNRVRTRVLES--------LTPEE-------
A0A1V6E7N1      PDRIVATEGVTRPEVQSEFDINTYLEILKSDKLRQRVVNS--------LSPQE-------
A0A2D9MYT1      MESFVMEGA-REQ-----DYLQTQYKNLQSRSLMEMALEETLQNAMILDGLKA-------
A0A258ANJ7      LNSMSTPGL-GDE-----KSVNTLIQAAKSREVIGRVISE--------LNLTQLPSFSGG
A0A290QGD9      VQSVTDNDV-RSL-----EDLNTIVQILESGTIIQKVSDR--------LTGEKLAQFMAP
A0A1D8AS58      VQSVVNNEI-RSA-----EDLNTQVKVLESLAIVQRVADR--------LTGADLELFMAP
I6AQC1          TPELLPTNV-IST-----EDMNTMVKIFESPTIIQKVSER--------ITGDELRRFMQP
W0ITH7          TQNPIDNNV-LST-----EDMNTMVKIFESPTIIQKVSER--------ITGDELRRFMQP
A0A139TLN4      SNGIVNTAS---------TNLDNEIFLLSSYSLMEEVVRK--------LKLDV-------
A0A1G3ZFT0      GGGSGPSLG---------SPAAIQIALIKSRYILTPVIQS--------LHLNT-------
A0A1Z8ZMT6      QSLEAAEDI-RSD-----FDRTELFLAVASDPTVRNLANLIPPEAPSIMEVFT-------
A0A2E8MCT7      QGLEAVEDI-RSD-----FDRTELFLAVASDPTVRNLANLIPPDPPSIMGIFT-------
A0A290Q2Z2      Y---------YDP-----YFLQDQFKIMQSAKVLYPVIEN--------LGLND-------
A0A2A2RGK2      FSQVRDEQI-RSI-----DMINTVVDLIRSYPFSQRVSAR--------LKLDQ-------
A0A2A2XXF7      MEQVRDEQI-RSI-----DMINTVVDLLRSYSFAQRVSAR--------LKLDQ-------
A0A2A2R5D6      MGNSRTDAP-FDL-----VFFTSEISTIQSKKILNPVIEK--------LGLQK-------
A0A1J4XH17      VRSVESNEV-RTS-----EDLNTQIKVLESSTLAKAVADR--------LQKEN-------
A0A3C1VJ32      GNSPAATSFGYDP-----YFIQTTFEIMQSQLVLSNVIAT--------MNLNVE------
A0A2N9NTX7      TQQQGSFSP-YDP-----YFMQTEFELMKSEVVLDKVIKN--------LNLNEE------
B9XK55          TQTPNYSGH-YDP-----YFIQTEFEVIQSEVILDRVIEG--------LNLNEA------
A0A4P5YMI6      FSGMSESKA-YDP-----FFVLTQFEKLQSTAVIYPVITD--------LGLREK------
A0A2E6T482      LGMQAGPTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK--------CDLTNK------
A0A3C0DQZ7      LGMQAGPTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK--------CDLTNK------
A0A1Z9CBK5      MGVQATQSS-FDP-----XFISTEFEKIQSQVVLDAVVES--------CELQEK------
A0A2D6ZI96      MGVQATQSS-FDP-----XFISTEFEKIQSQVVLDAVVES--------CELQEK------
A0A358KGZ3      LGMQATQSS-FDP-----YFISTEFEKIQSQKVLDEVVKS--------CELREK------
A0A2E9ZQX4      LGMQATQSS-FDP-----YFISTEFEKIQSQKVLDEVVRS--------CELREK------
A0A3D5JZU0      LGMQATQSS-FDP-----YFISTEFEKIQSQKVLDEVVKS--------CELREK------
A0A2E6HCR0      MGVQTAQSS-FDP-----YFISTEFEKIQSQIVLDAVVRS--------CELRDE------
A0A1Z8WN04      MGAQSSQSS-FDP-----YFISTEFEKIQSQIVLDAVVET--------CELREE------
A0A2D7L1N4      MGAQSSQSS-FDP-----YFISTEFEKIQSQIVLDAVVET--------CELREE------
A0A2E2R937      MGAQSSQSS-FDP-----YFISTEFEKIQSQIVLDAVVET--------CELREE------
A0A520QQY4      MGAQSSQSS-FDP-----YFISTEFEKIQSQIVLDAVVET--------CELREE------
A0A2D5MR66      MGVQASQSS-FDP-----YFISTEFEKIQSQIVLDAVVAT--------CELREE------
A0A2E0PDQ1      MGVQAAQSS-FDP-----YFISTEFEKIQSQIVLDAVVSS--------CELREE------
A0A2E2ZZP9      MGVQAAQSS-FDP-----YFISTEFEKIQSQIVLDAVVSS--------CELREE------
A0A7C4LRK7      YQGRQTPSF-HDP-----YWLTTQFEIIQSGAILHRVIKK--------LRLNER------
A0A2A2RGF2      LMPQQQQGG-FDP-----YFVMTQFEILQSKEVLYKVIDD--------LKLVPR------
A0A2G4I5Y6      LMPQQQQGG-FDP-----YFVMTQFEILQSKEVLYKVIDE--------LKLVQR------
A0A6N6PS97      LLQGQQQSS-YDP-----YFIRTEFEKIRGQRVLYPVIEE--------LSLSET------
A0A3M1I883      IGGQQRDPS-FDP-----YFMATEFEKIQSMSVLMPVIHS------PTNAAGEKLPPDRQ
A0A1V6JZ45      FLRPQVQNQ-FDP-----YFIQTEFEKIQSKPILYKVIES--------LDLRKT------
A0A7C7Z746      MVAQQRSDN-HDP-----YWIQTQFERIKSRQVLHRVVSN------QVVNLPNR------
A0A520RRW5      LMGLQAAQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA--------LGLNHK------
A0A356NPK0      LMGLQAAQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA--------LGLNHK------
A0A2D7B5P5      LMGLQAAQQ-HDP-----YWVLTEYEKIQSKKVIHPVINX--------LGLNHK------
A0A3D3XGB5      LMGLQAAQQ-HDP-----YWVLTEYEKIQSKKVIHPVINA--------LGLNHK------
A0A2V6F8A1      LGITQNSTQ-YDP-----FFLQTEFEKIRSQKVLYKVIDN--------LKLNER------
A0A2V5TNH4      IGFAQNNSA-YDP-----FFIQTEFEKIRSRKVLYKVIEN--------LKLNER------
A0A2V5X5Q6      IGFTQNNSA-YDP-----FFIRTEFEKIRSRKVLYKVIEN--------LRLNER------
A0A4P5QM05      VGTQTSSGR-IDP-----QFVATQIQVLKKAEILNPVIEK--------LNLVK-------
A0A4Q3C001      FESSA-QRS-YDP-----AFVATEFHTLRKSDILYPVIDQ--------LELVK-------
B4DB23          FGPGQFRQT-YDP-----QFVATQFQILQKTEILYPVIER--------LDLIK-------
A0A6B3L938      GDAERDSMI-FRD-----EIIGTIASKITGQGQFVKVIQR--------PEVQA-------
A0A2V5URB2      SIEADER-----------SYYESQYEMLKSRSLAAEVIKG--------QGLDR-------
A0A2V2DJ66      SDRTRNDKV-LSV-----EDFNTQVKILESNEVIRAVRSR--------LKEDDLRKLMAP
R7L5A9          TERSRNNVI-MSM-----EDFNTQVKLFESAEIVKAVKSR--------MKEDELKRFIAP
A0A5R8KA81      VQEVNPQDL-RMN-----DLLATIMENLKNRDLLLRVVRR--------AELGKDMTFPEV
A0A5B5WU87      SNGIVNTVA---------TNLDNEMFLLSSHSLLETVVRK--------LKLDV-------
R7DZW0          TNGIVNTGA---------TNLDNEIFLLSSHSLLKTVVRN--------LKLDV-------
A0A2N8HID1      TNGIVNTGA---------TNLDNEIFLLSSHSLLKTVVRN--------LKLDV-------
A0A2N8HS06      TNGIVNTGA---------TNLDNEIFLLSSHSLLKTVVRN--------LKLDV-------
A0A6N2TNT9      TNGIVNTGA---------TNLDNEIFLLSSHSLLKTVVRN--------LKLDV-------
A0A3R5R2M8      ELGIDSGA----------ANLANESFVLKSTAIMQKVVED--------LKLNT-------
A0A411SUQ6      ELNIDPNA----------ANLANESLVLKSTALMNKVVED--------LNLNT-------
A0A2N8HZF2      ELGIDSGA----------ANLANESFILKSTALMKKVVED--------LNLNT-------
A0A354E720      ELNIDPNA----------ANLANESLVLKSTALMNKVVED--------LNLNT-------
B2UPB6          ELNIDPNA----------ANLANESLVLKSTALMNKVVED--------LSLNT-------
A0A2V6JLK8      GQGDPNQPI-HDP-----QLAPTVYQVIQRTGILYPVIEQ--------LKLQD-------
A0A2W5Z1A5      SQIDPSQPV-HDP-----TLAPTVFQVIQRTGILYPVIDE--------LKLQE-------
A0A2V6EA09      GN-DLHQPV-HDP-----ELAPTVFQVIQRTGILYPVIDD--------LKLQD-------
A0A2V6GQI7      GN-DLHQPV-HDP-----ELAPTVFQVIQRTGILYPVIDD--------LKLQD-------
A0A3C1HEJ2      LQEGVRDDG-ERP-----EDLKTIIETLKSRAVIERVIET--------NHLATDPRVVEP
A0A522ULD9      FGPGGAAFS-YNP-----YFLRTQFEIIQSRQILYKVVDN--------LNLTK-------
A0A1V6JU76      LNEV-VMSM-TDQ-----DYLQTQYRNLLSRSLLEIVIKR--------EKIN--------
A0A2A2XXW5      LNSM-ALGN-SDQ-----NYLTTQYRNLESRSLILAVMNK--------LKLET-------
A0A6N6Q6V0      LRDMVTIGS-KDQ-----EYLQTQYRNLQSRSLIDKVIQK--------LRLD--------
A0A1Q6UHJ9      TDRSRNNTV-LTI-----EDFNTQVKILESNEIIKAVKSR--------MKEDEIVRFMAP
A0A2V2BXR0      TDRSRNNTV-LTI-----EDFNTQVKILESNEIIKAVKSR--------MKEDEIVRFMAP
A0A2D8V0G3      VGSQVVFNS-NDQ-----EYLQTQYKNLLSRSLIESVITD--------LELKQ-------
A0A348S017      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDE-------
A0A3C1UUV7      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDE-------
A0A350I3V2      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDE-------
A0A520RGV5      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDE-------
A0A3D3XF90      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDE-------
A0A2D7B522      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDE-------
A0A356NIC2      GATPIVFNS-NDQ-----EYLQTQYKNLLSRSLIESVVRD--------LGLDE-------
A0A2N8HDG3      RIKVDLGMD-SGA-----ANLANESFILRSSTVMRSTVED--------LALNI-------
A0A146GCJ0      IADVSQENP-QST-----DFLKTVVEALKSRKLLARVVKA--------EGLDKDPDFAPP
A0A2T6D6H8      IDDIARENP-QTT-----DFVNTVVQALTSRKLMLRVVKA--------TGLDHNPEFAPP
A0A3D1TI55      --DRGRQSQ-YDP-----YFYLTQFELIRSRPVLTGVIRD--------MNLQE-------
A0A3E1ET42      IDPFQTNEI-SNRSAYSGNWLETEFKTVTAHETLSLVIKK--------LNLDQ-------
A0A2A2YDW8      FGTAFGDDN-NSQIQMTPQFFATQFEIIRSQMTLRRVVDK--------LRLTN-------
A0A352XLN9      FGTAFGDDN-NSQIQMTPQFFATQFEIIRSQMTLRRVVDK--------LRLTN-------
A0A3D0YP62      IGTPM------TR-----QFMNTQFEIIVAPETLGRAIDK--------IQLET-------
A0A3D3DV47      IGTPM------TR-----QFMNTQFEIIVAPETLGRAIDK--------IQLET-------
A0A2E5XJ49      AGAPMTGAS-PSH-----AYIYNQFKIIESEKTLARVVER--------LDLTT-------
A0A2E6SBY8      AGPPMTGAS-PSH-----SYIQNQFKIIESEKTLARVVER--------LDLXT-------
A0A2E5QMS4      AGHPMTGAS-PSH-----AYIQNQFKIIESEKTMLRVVER--------LDLTT-------
A0A2E7YXQ3      AGHPMTGAS-PSH-----AYIQNQFKIIESEKTMLRVVER--------LDLTT-------
A0A2E3H787      AGRPMTGAS-PSQ-----AYIQNQFKVIESEKTLLRVVER--------LDLTT-------
A0A2E7AGN1      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLSRVVET--------LDLTT-------
A0A2E7AKY7      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLSRVVET--------LDLTT-------
A0A3D4CU34      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLSRVVET--------LDLTT-------
A0A2E8M146      VGQPMTGAS-PSH-----AYIQNQFKIIESETVLNRVVES--------LDLTT-------
A0A355S8S2      VGQPMTGAS-PSH-----AYIQNQFKIIESETVLNRVVES--------LDLTT-------
A0A2D6DVN8      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLLRVVEQ--------LDLPT-------
A0A3C1W2R2      VGQPMTGAS-PSH-----AYIQNQFKIIESEKTLLRVVEQ--------LDLPT-------
A0A2E3NAY6      VGQPMTGAS-PSH-----AYIQNQFKIIESERTMSRVVER--------LDLTT-------
A0A2E3II01      VGQPMTGAS-PSH-----AYIQNQFKIIESERTMSRVVER--------LDLPT-------
A0A368B8C5      VGQPMTGAS-PSH-----AYIQNQFKIIESERTMGRVVER--------LDLTT-------
A0A3R7RBB5      VGQPMTGAS-PSH-----AYIQNQFKIXESERTMGRVVER--------LDLTT-------
A0A2A2QX62      EPRGQ--YE-MTS-----TFFPTEFEVIKAQKTLDSAIEN--------LDLVN-------
A0A4Q3BWH6      TDNRS--ME-NGA-----TFLPTEFAVIKAQKTLDAAIEN--------LDLVN-------
A0A3N5WCF1      MTETSGGGR-MSP-----QFFGTEFEKIKSRNSLAKVVDN--------LQLVN-------
A0A4Q3C1K5      FSDNQ--NL-MTP-----QFFGTEFEKIKSYNSLSKVVAK--------LELMS-------
A0A3R8IT45      SREMLDSTM-FST-----EDINTMVKVFESSIIIQKVSER--------ITGEELKKFMEP
A0A2A2PYE8      VQQVVDTDI-RSA-----EDLNTQIKVIESVTMIQRVAER--------ITGDDLRAFLAP
A0A2T6CN73      GQQVVDTDI-RST-----EDLNTQVKVIESEAIIESVASR--------ITGQELREFLAP
A0A2G4G428      TAAESNFSI-TSA-----DDFYTAVESMRSSTIIEAVSRQ--------LTTAE-------
A0A6N6PCD8      IPGVAQDNF-KSD-----IALKSVEGAMNSNSLLLRVAKL--------NDLET-------
A0A139TV24      RIMVELGVD-SGA-----ANLANESFILRSSTVMRHTVED--------LKLNV-------
A0A2N8HT11      RIKVELGMD-SGA-----ANLANESFILRSSTVMRNTVED--------LTLNV-------
R7DS70          RIKVELGMD-SGA-----ANLANESFILRSSTVMRNTVED--------LTLNV-------
A0A2N8HNL6      RIKVELGMD-SGA-----ANLANESFILRSSTVMRNTVED--------LTLNV-------
A0A6N6PAZ1      RDQIEEIDM-RSA-----EAMNTVAERIRRMDLLERVASR--------HDVRELPGLMPI
A0A6I1K459      IEDVDKREK-GGV-----DLLNTIANNIRSSGIIKRVVTA--------HNLTRHPYFTGG
A0A139TUL1      IILSDLGVR-AGE-----ANLANESYVVQSSEVMGRVVKG--------LELGV-------
A0A2N8HCB0      IILSDLGFK-PGE-----ANLANESYVVKSSEVMGRVVKG--------LGLDV-------
A0A2N8HP04      IILSDLGFK-PGE-----ANLANESYVVKSSEVMGRVVKG--------LGLDV-------
A0A2N8HRJ0      IILSDLGFK-PGE-----ANLANESYVVKSSEVMSRVVKG--------LGLDV-------
A0A6N2U9Y7      IILSDLGFK-PGE-----ANLANESYVVKSSEVMSRVVKG--------LGLDV-------
A0A366HAG0      ANLQDDNLA-STD-----SFLKTQFEIITKRRTLDRVVDK--------LDLLE-------
A0A2U8DZK4      --QAQSNDY-YDP-----YFVQDQLRTIKSPKIINPVIER--------LKLNE-------
A0A2T6DFL8      --QAQTSPS-YDP-----VFLQDQFKIMQSEKILYPVIER--------LDLNR-------
A0A1D8AWD4      --QAQSNTY-YDP-----YFIQDQFRIIQAEKILYPVIES--------LGLNE-------
A0A4Q1C9S2      --QAQNNSY-YDP-----YFIQDQFKIIQSEKIIYPVIDA--------LGLNA-------
A0A178IH18      --ENQANNY-YDP-----YFLQDQFKVIQSPKILNPVIEN--------LGLNR-------
A0A2T6DT99      --QNQQSAY-YDP-----YFLQDQFKIMQSAKILYPVIER--------LQLNE-------
A0A1G3ZT33      --QAQSSSY-YDP-----YFLQDQFKTIQSDIILKPVIEI--------LNLNA-------
A0A3E1E2T2      --QAQSSSS-YDP-----YFLQDQFKILQSEKILYPVIKN--------LKLST-------
B1ZMW1          --QAQSSSY-YDP-----YFLQDQFKIMQSEKILYPVIEN--------LGLNT-------
A0A3M1I8A3      RDGFGGVSR-MDP-----EYLQTQYKNLLSRSLLERVVKA--------ERLEQDPRYSKE
A0A4V0XS84      IKGVVVQNR-QDP-----DYLQTVAKNLKSRTLMKALIAD--------LKLDEDIRYSRA
A0A351WE84      --ERQMIQG-YNP-----FFLRTQERILKSTPLLYAVIDN--------LNLQA-------
D5ENH7          QVDLAQDSI-RTA-----EDLNTQISLLNSSKIIQQVERR--------MSEEQRKKFMQP
A0A0R2XQ77      SAEMEMNQI-RSS-----EDLNTQISVLNSGAIVQGVERR--------LQDDERERFMAP
A0A2E9IN28      GAEMEQNQI-RGA-----EDLNTQISVMESATIIKGVEQR--------LQDEMRERFMAP
A0A6N4WTJ5      AGELEPNQI-RSA-----EDLNTQISVLNSGKIIQGVERR--------LQDDERERFMAP
A0A1V5QDZ6      --ERQIPQA-YNP-----FFLRTQYEVIQSRKVLYQVVEN--------LDLQK-------
A0A4Y8P964      VGEDQAGLF-DYE-----NYFKTQVEILKSRSLAQRVVER--------LDLDEHPDWLGL
A0A3D4HF88      AEDITKEEI-RTS-----EDLNTQIKILESLAIVNSVADR--------IKGAERKMLMEP
A0A6N6ZHN8      FKDVVDLDM-RSS-----EDYNTQVKVLQSSEIINRVADR--------IKGPTKQRLIQP
A0A351MR11      GAGEELYAI-MSA-----DDFNTAIEVMKSSGIIEAVERR--------LTTSE-------
A0A6G6K641      -DTVQQDDL-SNE-----QSLNTLIETLNSRTMLQRVAIR--------LKLDR-------
A0A5B5WI95      MSELGIDSG-AAN-------LANESFILKSTAVMKKVVED--------LKLNT-------
A0A2N8I9W1      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNT-------
A0A4Q5IH27      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNT-------
A0A2N8IBZ6      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNT-------
A0A2N8IJW9      MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNT-------
R6J100          MAELGIDSG-AAN-------LANESFILKSTALMKKVVED--------LNLNT-------
A0A1V6J089      YQRDINRMG-YNP-----FFLMTQEKILKSKPVLTTVIRN--------LNLQK-------
A0A3C1BZR1      YERQASRMG-YNP-----FFLMTQEKIMKSRPVLTAVIRN--------LNLQK-------
A0A7C4KLL2      VDPIVREDL-RSS-----ETLNTIVQKFKSRALLERVVET--------NRLAQNPAFVPQ
A0A1H6KPB7      GAERVLQNN-ASE-----NYIPTQFEILVSDMNLMAVSKK--------LNLAQ-------
A0A2E9ISN4      ETRATTQYD-RQE-----RSLSRQMLLLNSNRLHQQVR----------ANLAE-------
B9XAX1          IEEVSRQDL-RTG-----EMLNTIVQNVKNTKVLGRVVRN--------IGLATNSFFLPG
A0A5R8KKM9      ---NQNNNL-AGD-----GFLKTQLEIIQKPKTLERVVEK--------LKLLE-------
A0A139TS01      GEDVVASSN-ITD-----NYIPMQYSVLTSSEVLKVVSKK--------LNLAA-------
A0A3E1EJT7      VADVVDSNI-TSE-----PDFNTQIKVLESLTILQNVANR--------LTPDE-------
A0A317ZP96      TVEMEQNQI-RSA-----EDLNTQISLLESGTIIQGVEQR--------LQDDMRKRFMAP
A0A7C3I5X9      GGVTVQSIQ-ANQ-----DYLQTQYRNLLSRSLLNVVIRK--------ERLTE-------
A0A2D5WGA5      LGMQTGPTA-FDP-----YFIQTEFEKIQSQKVLDKVVEK--------CELED-------
A0A2E7SSH2      MGMQATQSS-FDP-----YFISTEFEKIQSQVVLDEVVKK--------CDLKK-------
A0A349GXM8      ----VSNEG-AQW-----TSLHTHTYMLNNEKLHERVMNK----------LAE-------
A0A4P5YP61      -TKFKPDEQ-TTT-----EILKTFEQTIVSRPVLERVAAT--------NQLTKNGEFLTI
A0A6B2LYM4      IQDIVRQEV-ANA-----EDFNTQIKILESLNIVQAVDER--------LKGNL-------
A0A6D1VXB3      VGEDQAGLF-DFE-----NFFKTQVEILKSRSLAQRVVER--------LDLDEHPDWLGL
I0JYY7          VGEDQAGLF-DFE-----NFFKTQVEILKSRSLAQRVVER--------LDLDEHPDWLGL
A0A4R7S1J2      -KEVTDKDW-ANT-----EAMNTLAATMRSSTFLERLIDR--------EKLQT-------
A0A2A2XV69      FDDRGGGRG-FDP-----RFITTQFEIIQRKEILYPVIEA--------LGLEQ-------
A0A651H7X9      VQDVLDPTI-RTT-----EDFNTQVRRMESISLIQRVASR--------LTGEE-------
A0A4Y8P842      VSNDEPGLF-DWE-----TFFKTQCEIIKSRSLAQRVVER--------LDLDEHP-----
B3DZK9          VSNDEPGLF-DWE-----TFFKTQCEIIKSRSLAQRVVER--------LELDEHL-----
A0A5E6MPC4      IGQESANAF-EYD-----TFFRTEIEILKSRAMAERVVDR--------LNLEEHPDWVGL
A0A6N6PKP9      ADPRGMDEL-STE-----KELKTIVENLESPALMLRLARH--------PELAE-------
A0A6N6Z250      -----GMQT-IDR-----TFINNQFETIQSRTVLLPVIER--------LQLER-------
A0A4V1SB02      IEGLDSTPI-KGT-----DQLNTVVQSLTSNKVLLAVANH--------TNYGK-------
A0A6N6QEJ2      FLQGPSQTG-FDP-----YFFNTEFEVLKSRRILDKVSER--------LHLAK-------
A0A3C1VB86      VEQVVSEDM-RSQ-----ETLNTVAQKLSNLALLTQVLEE--------NHLLP-------
A0A146G2Q9      --GQGGVQG-LDP-----RFLATQFEIIQRKEILYPVIDA--------LGLDR-------
A0A2T6D3Y2      --GQGGVQG-LDP-----RFLATQFEIIQRKEILYPVIDA--------LGLDR-------
A0A6N6P5E3      --GMDSGQH-YDP-----RFSTTQFQIIQRKEILYPVIDA--------LKLMQ-------
A0A2D5VY59      LIGMQMSQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA--------LELRN-------
A0A2D8UZZ4      LIGMQMSQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA--------LELRN-------
A0A353DV86      LIGMQMSQQ-HDP-----YWVLTEFEKIQSKVVLHPVIDA--------LELRN-------
A0A2E5EPT8      LGGTPQGPD-FDP-----FFILTQFERLQSAEVLYPVIEK--------MNLGR-------
A0A6J4HTK1      GGGDPNAPV-HDP-----QLAPTVYQIIQRTGILYPVIED--------LKLQD-------
A0A6N6PHJ5      AGNSRIS-S-FDP-----YFIQTEFEVIQSETILSNVVDV--------LGLND-------
A0A6M1RXR2      VDPLYNP-G-YDP-----YFIETEFQVINSEVVLTNVVNE--------LDLMR-------
A0A7C3DXS4      TDPLYSP-G-YDP-----YFIETEFEVINSELILTNVIHD--------LNLMV-------
A0A2V2SDV4      LQGQAFPSS-YDP-----YYINTEFELIQSEVILQPVITK--------LDLNK-------
A0A2V5PK75      AKRMPTA-G-YDP-----YFIQTEFETIQSERVLGKVIDK--------LELND-------
A0A1V6DME1      TQTPLLP-G-YDP-----YFIQTEFEVIQSERILSNVVHQ--------LNLSV-------
A0A3D3DIJ3      ADRSTLA-G-YDP-----FFIQTEFELIQSELILGKVVAD--------LDLNT-------
A0A6I1K583      GG--------FDP-----YFVMTQFEILQSKEVLYKVIDD--------LKLVQ-------
A0A350EWA4      IGGPTAVQG-FDP-----YFLQTEFEKIQSKTVLYQVITN--------LNLAD-------
A0A5B5WZ91      GEDVVASSN-MTD-----NYIPMQYSVLTSSEVLKVVSKK--------LNLAA-------
A0A2N8HD92      GGDVVATSN-VTA-----NYIPMQYSVLTSTEVLKIVSKK--------LNLAA-------
A0A2N8HIT2      GGDVVASSN-VTA-----NYIPMQYSVLTSTEVLKVVSRK--------LNLAA-------
A0A354EBD3      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A355VEB2      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A2N8IMT3      GGDVIATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
R6K1U5          GGDVIATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A2N8IWC2      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A2N8I441      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A2N8I3A6      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A410SCC4      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A3R5VEW0      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A411SSG2      GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
B2UKW3          GGDVVATSN-VTA-----NYIPMQYSVLTSAEVLKVVSRK--------LNLAA-------
A0A7C3HWX0      ----QVQQP-YDP-----YFITTEFEKIQSSAVLYPVIER--------LRLDT-------
A0A7C4KPD7      LSNFDP------------YWMQTQFEIIKSSTVLDAVINK--------LKLNE-------
A0A1M6RLZ4      LGQDTSGRL-MTR-----QFFATQFQLIESEENLKRAAIR--------CQLPE-------
A0A354T7G8      ---RGDSLA-FTQ-----EYIKTQFETITKPSTLYPVIQS--------LDLAK-------
A0A2S7U4L6      VLGSGSSAL-MTR-----QFFGTEFKKIESDENLKRAAEL--------VQLPQ-------
A0A512MBZ2      DMLAGSD-----------VFVKTEFESINKPETLYPVIEK--------LDLQK-------
A0A2E8MEZ0      -SQMTPGST-MTA-----RYMENEFETITAPETLAEAAEN--------IDLPR-------
A0A6B3LBV6      TLTEGQKMF-ASR-----NFIANQFERMTSQQVLQRVVRD--------EDLVQ-------
A0A2E3EC33      VGNLGTESL-PYM-----TFMQTQFEIIQSRETLKEVINNGKDSLGQPLDLXA-------
A0A2E4GN01      VGNLGSESL-PYM-----TXMQTQFEIIQSRETFKEVINNGKDSLGRPLXLME-------
A0A1Z8XU55      VGNLGSEQL-PYM-----TFMQTQFEIIQSRETLKQVISKGKDSAGNPLDLKK-------
A0A2E1RQR9      VGNLGSEQL-PYM-----TFMQTQFEIIQSRETLKQVISKGKDSAGNPLDLKK-------
A0A2E3ISQ4      VGNLGSEQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGENSAGNLLDLKK-------
A0A2D6W6F4      VGNLGSDQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGVDSAGNLLDLKK-------
A0A2D8Z5A8      VGNLGSDQL-PYM-----TFMQTQFEIIQSRETLKEVIKNGVDSAGNLLDLKK-------
A0A4Q2YKS3      ASGMDRMTP---------RFFETEFEKIKSSKSLEKVVNN--------LDLVK-------
A0A6N6P3T8      TSGFGRSTV---------NFFNTEFEKIKSRNSLMKVIDN--------LDLAN-------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      KTNDAAKEGL--------------------------------------------------
A0A2V5PST3      ---------------------------NKIFTGASITSDNPIKRVRSWILGTLNSLISPV
A0A2V5PXM3      D-----------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      -------------------------GRRNPKQLIGETGLSETNVIERLHQISKAGFFGLT
A0A258ANJ7      H-----------------------------------------------------------
A0A290QGD9      Y-----------------------------------------------------------
A0A1D8AS58      F-----------------------------------------------------------
I6AQC1          Y-----------------------------------------------------------
W0ITH7          Y-----------------------------------------------------------
A0A139TLN4      --TYWKKSGFRKEEIYDRSPIAVHFSERGNPAEAGFRVIPVSDTEFRLESGVNDSRPERE
A0A1G3ZFT0      ----NLSPSHPQSRWSRILSRSQPEAEMTLFTFPPEDNRPYYLVSEKGNKISLFDSNHQR
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ---EWGTRLF--------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ----WGKK----------------------------------------------------
A0A2N9NTX7      ----WG-K----------------------------------------------------
B9XK55          ----WK-Q----------------------------------------------------
A0A4P5YMI6      ----WAQR----------------------------------------------------
A0A2E6T482      ----WDPN----------------------------------------------------
A0A3C0DQZ7      ----WDPN----------------------------------------------------
A0A1Z9CBK5      ----WKEH----------------------------------------------------
A0A2D6ZI96      ----WKEH----------------------------------------------------
A0A358KGZ3      ----WKKH----------------------------------------------------
A0A2E9ZQX4      ----WKKH----------------------------------------------------
A0A3D5JZU0      ----WKKH----------------------------------------------------
A0A2E6HCR0      ----WKDD----------------------------------------------------
A0A1Z8WN04      ----WKDD----------------------------------------------------
A0A2D7L1N4      ----WKDD----------------------------------------------------
A0A2E2R937      ----WKDD----------------------------------------------------
A0A520QQY4      ----WKDD----------------------------------------------------
A0A2D5MR66      ----WKDD----------------------------------------------------
A0A2E0PDQ1      ----WKDD----------------------------------------------------
A0A2E2ZZP9      ----WKDD----------------------------------------------------
A0A7C4LRK7      ----FAER----------------------------------------------------
A0A2A2RGF2      ----WDQK----------------------------------------------------
A0A2G4I5Y6      ----WDQK----------------------------------------------------
A0A6N6PS97      ----LSKR----------------------------------------------------
A0A3M1I883      FIPAWSKRLG--------------------------------------------------
A0A1V6JZ45      ----WGQR----------------------------------------------------
A0A7C7Z746      ----WSEK----------------------------------------------------
A0A520RRW5      ----WMER----------------------------------------------------
A0A356NPK0      ----WMER----------------------------------------------------
A0A2D7B5P5      ----WMER----------------------------------------------------
A0A3D3XGB5      ----WMER----------------------------------------------------
A0A2V6F8A1      ----WGER----------------------------------------------------
A0A2V5TNH4      ----WGGR----------------------------------------------------
A0A2V5X5Q6      ----WGER----------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      --------------------------------------------------------NPQF
A0A2V2DJ66      YKDMFTFGPR--------------------------------------------------
R7L5A9          YHNMFTFGIR--------------------------------------------------
A0A5R8KA81      RDYIMTE-----------------------------------------------------
A0A5B5WU87      --TYWKKDKFRKVEVYEDSPIAVQFTPEGGAADARFCVVPLSGKEFRLEKDEKDRGGQET
R7DZW0          --TYWKKNGFRKVEIYQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHET
A0A2N8HID1      --TYWKKNGFRKVEIYQDSPIAAQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHET
A0A2N8HS06      --TYWKKNGFRKVEIYQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHET
A0A6N2TNT9      --TYWKKNGFRKVEIYQDSPIAVQFTQEGKTADARFLVIPVSGTEFRLEKDEKDHHGHET
A0A3R5R2M8      --SYWQAQDFREIDLYRNSPILAVFEEIGSNRSCRISVTPVGEQSFILAYSNSREEPAFL
A0A411SUQ6      --SYWQKKDFRELDLYHATPLLVHFEQIDKQRACTLHITPLDEKRFTLGHPNDQGELILL
A0A2N8HZF2      --SYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQL
A0A354E720      --SYWQKKDFRELDLYHASPLLVNFEQIDKQRACTLHITPLDEKRFTLGHPNNQGELILL
B2UPB6          --SYWQKKDFRELDLYHATPLLVHFEQIDKQRACTLNITPLDEKRFMLGHPNDQGELILL
A0A2V6JLK8      ---KWARD-G--------------------------------------------------
A0A2W5Z1A5      ---KWANHSA--------------------------------------------------
A0A2V6EA09      ---KWGKDLG--------------------------------------------------
A0A2V6GQI7      ---KWGKDLG--------------------------------------------------
A0A3C1HEJ2      E-----------------------------------------------------------
A0A522ULD9      ---EWGK-----------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      FNDMFTLGPR--------------------------------------------------
A0A2V2BXR0      FNDMLTLGPR--------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      --SYWKQQDLRQIDLYRDSPITVTFDGIAENRFCNVDITLQEGNTLVLTYHDINGNPVQE
A0A146GCJ0      R-----------------------------------------------------------
A0A2T6D6H8      R-----------------------------------------------------------
A0A3D1TI55      ---VWGR-----------------------------------------------------
A0A3E1ET42      ---TW-GLTF--------------------------------------------------
A0A2A2YDW8      ---RW-NVTE--------------------------------------------------
A0A352XLN9      ---RW-NVTE--------------------------------------------------
A0A3D0YP62      ---SW-GQDR--------------------------------------------------
A0A3D3DV47      ---SW-GQDR--------------------------------------------------
A0A2E5XJ49      ---RWSGYDR--------------------------------------------------
A0A2E6SBY8      ---RWSGYDR--------------------------------------------------
A0A2E5QMS4      ---RWRGYDR--------------------------------------------------
A0A2E7YXQ3      ---RWRGYDR--------------------------------------------------
A0A2E3H787      ---RWRGFDR--------------------------------------------------
A0A2E7AGN1      ---RWSGFDE--------------------------------------------------
A0A2E7AKY7      ---RWSGFDE--------------------------------------------------
A0A3D4CU34      ---RWSGFDE--------------------------------------------------
A0A2E8M146      ---RWNGFDQ--------------------------------------------------
A0A355S8S2      ---RWNGFDQ--------------------------------------------------
A0A2D6DVN8      ---RWNGFDR--------------------------------------------------
A0A3C1W2R2      ---RWNGFDR--------------------------------------------------
A0A2E3NAY6      ---XWNNFDR--------------------------------------------------
A0A2E3II01      ---RWNGFDR--------------------------------------------------
A0A368B8C5      ---RWNNFDR--------------------------------------------------
A0A3R7RBB5      ---RWNNFDR--------------------------------------------------
A0A2A2QX62      ---RW-NSDR--------------------------------------------------
A0A4Q3BWH6      ---RW-NTDL--------------------------------------------------
A0A3N5WCF1      ---RW-NVDK--------------------------------------------------
A0A4Q3C1K5      ---KW-GVDK--------------------------------------------------
A0A3R8IT45      Y-----------------------------------------------------------
A0A2A2PYE8      Y-----------------------------------------------------------
A0A2T6CN73      Y-----------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      --SYWKKRDLRQIDLYRESPVEVIFENIPSDRSCSFDITLKGDSALSLTYQGSDGKPVQL
A0A2N8HT11      --SYWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQE
R7DS70          --SYWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQE
A0A2N8HNL6      --SYWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAVTLTYHDAAGNPIQE
A0A6N6PAZ1      E-----------------------------------------------------------
A0A6I1K459      T-----------------------------------------------------------
A0A139TUL1      --SYWEKRNIRKVELYHTTPLKVEFGEEVDFQPCSLAVTPLNGREFSLSYREKGGRETAL
A0A2N8HCB0      --SYWEKRNIRKVDLYHTTPLKVEFSEEAAFQPCSLAVTPLNGREFSLSCREKEGGENVL
A0A2N8HP04      --SYWEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTPLNGREFSLSYRAKESGENVL
A0A2N8HRJ0      --SYWEKRNIREVDLYHTTPLKAEFSEQVAFQPCSLAVTPLNGREFSLSYRAKESGENVL
A0A6N2U9Y7      --SYWEKRNIREVDLYHTTPLKAEFSEQVAFQPCSLAVTPLNGREFSLSYRAKESGENVL
A0A366HAG0      K---WNLKSK--------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      M-----------------------------------------------------------
A0A4V0XS84      K-----------------------------------------------------------
A0A351WE84      V---WGQ-----------------------------------------------------
D5ENH7          YEGAFSFSGP--------------------------------------------------
A0A0R2XQ77      YADVLSFTGP--------------------------------------------------
A0A2E9IN28      YTDALSLSGP--------------------------------------------------
A0A6N4WTJ5      YTDALSLSGP--------------------------------------------------
A0A1V5QDZ6      V---WGE-----------------------------------------------------
A0A4Y8P964      K-----------------------------------------------------------
A0A3D4HF88      Y-----------------------------------------------------------
A0A6N6ZHN8      Y-----------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      --SYWYSQDFRKIELYNSSPILAVFEEIGKQRSCSFSITPRGEQNFILAYTTSQKKTTTL
A0A2N8I9W1      --SYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLHITPLDEKRFMLSHYNNQGESVQL
A0A4Q5IH27      --SYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLHITPLDEKRFMLSHYNNQGESVQL
A0A2N8IBZ6      --SYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQL
A0A2N8IJW9      --SYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQL
R6J100          --SYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRFMLSHSNNQGESVQL
A0A1V6J089      V---WGAQLN--------------------------------------------------
A0A3C1BZR1      V---WGMEFN--------------------------------------------------
A0A7C4KLL2      D-----------------------------------------------------------
A0A1H6KPB7      Q---WQTDD---------------------------------------------------
A0A2E9ISN4      E---WKKKL---------------------------------------------------
B9XAX1          NTNVLSE-----------------------------------------------------
A0A5R8KKM9      L---WSLPAN--------------------------------------------------
A0A139TS01      E---WGMTD---------------------------------------------------
A0A3E1EJT7      LRLLLEPYKS--------------------------------------------------
A0A317ZP96      YTDALSLRGP--------------------------------------------------
A0A7C3I5X9      D-----------------------------------------------------------
A0A2D5WGA5      K---WKPANG--------------------------------------------------
A0A2E7SSH2      R---WKELYK--------------------------------------------------
A0A349GXM8      A---WADR----------------------------------------------------
A0A4P5YP61      YERKKGLFDA--------------------------------------------------
A0A6B2LYM4      RNRFLAPYEK--------------------------------------------------
A0A6D1VXB3      KKESFRKHSI--------------------------------------------------
I0JYY7          KKESFRKHSI--------------------------------------------------
A0A4R7S1J2      R---PDLFGG--------------------------------------------------
A0A2A2XV69      T---WKKLYG--------------------------------------------------
A0A651H7X9      ------MRRF--------------------------------------------------
A0A4Y8P842      D---WIGLKP--------------------------------------------------
B3DZK9          D---WLGLKP--------------------------------------------------
A0A5E6MPC4      K---PGWRKA--------------------------------------------------
A0A6N6PKP9      I---PAFRAQ--------------------------------------------------
A0A6N6Z250      R---LSAALG--------------------------------------------------
A0A4V1SB02      E---IAQSQK--------------------------------------------------
A0A6N6QEJ2      V---YAGRAK--------------------------------------------------
A0A3C1VB86      P---EGTVVT--------------------------------------------------
A0A146G2Q9      K---WGM-----------------------------------------------------
A0A2T6D3Y2      K---WGM-----------------------------------------------------
A0A6N6P5E3      K---WDL-----------------------------------------------------
A0A2D5VY59      R---WMK-----------------------------------------------------
A0A2D8UZZ4      R---WMK-----------------------------------------------------
A0A353DV86      R---WMK-----------------------------------------------------
A0A2E5EPT8      V---WGARYG--------------------------------------------------
A0A6J4HTK1      K---WAKDGH--------------------------------------------------
A0A6N6PHJ5      K---WGKKYN--------------------------------------------------
A0A6M1RXR2      R---WGEKYA--------------------------------------------------
A0A7C3DXS4      K---WGAKYA--------------------------------------------------
A0A2V2SDV4      V---WGAKYG--------------------------------------------------
A0A2V5PK75      D---WGKKYH--------------------------------------------------
A0A1V6DME1      E---WGKKYA--------------------------------------------------
A0A3D3DIJ3      E---WGRKYA--------------------------------------------------
A0A6I1K583      R---WDQKYR--------------------------------------------------
A0A350EWA4      F---YRD-----------------------------------------------------
A0A5B5WZ91      E---WGM-----------------------------------------------------
A0A2N8HD92      E---WGM-----------------------------------------------------
A0A2N8HIT2      E---WGM-----------------------------------------------------
A0A354EBD3      E---WGM-----------------------------------------------------
A0A355VEB2      E---WGM-----------------------------------------------------
A0A2N8IMT3      E---WGM-----------------------------------------------------
R6K1U5          E---WGM-----------------------------------------------------
A0A2N8IWC2      E---WGM-----------------------------------------------------
A0A2N8I441      E---WGM-----------------------------------------------------
A0A2N8I3A6      E---WGM-----------------------------------------------------
A0A410SCC4      E---WGM-----------------------------------------------------
A0A3R5VEW0      E---WGM-----------------------------------------------------
A0A411SSG2      E---WGM-----------------------------------------------------
B2UKW3          E---WGM-----------------------------------------------------
A0A7C3HWX0      N---WARYYN--------------------------------------------------
A0A7C4KPD7      R---FAE-----------------------------------------------------
A0A1M6RLZ4      R---WNL-----------------------------------------------------
A0A354T7G8      R---WEL-----------------------------------------------------
A0A2S7U4L6      K---MQI-----------------------------------------------------
A0A512MBZ2      K---WSL-----------------------------------------------------
A0A2E8MEZ0      R---WGL-----------------------------------------------------
A0A6B3LBV6      K---WAL-----------------------------------------------------
A0A2E3EC33      K---WGL-----------------------------------------------------
A0A2E4GN01      E---WGV-----------------------------------------------------
A0A1Z8XU55      A---WGV-----------------------------------------------------
A0A2E1RQR9      A---WGV-----------------------------------------------------
A0A2E3ISQ4      S---WGV-----------------------------------------------------
A0A2D6W6F4      S---WGV-----------------------------------------------------
A0A2D8Z5A8      S---WGV-----------------------------------------------------
A0A4Q2YKS3      R---WGK-----------------------------------------------------
A0A6N6P3T8      N---WSL-----------------------------------------------------
                                                                            

A0A2A2XVF1      ---------------------------NPAFVAPGAKPTEIQLADKLRG-KVRAVLRRGT
A0A2V5UHJ2      ---------VAGFWKELKNWAKGFMPATPTPSTPDPIPLSTRLAGSYLL-MLEVRPVVST
A0A2V5PST3      AKFFRESRQESAESDTPDAAARGGNLVDRQETDKNKPVVSRGLVGHYMS-FLQVNSIEKT
A0A2V5PXM3      --------------------------------DGAPRPTREKLVTRLSK-MVDAKLRKGT
A0A1V5QB01      ----------------------------------------EEVSRTITR--ISVAPVGKT
A0A7C5LI63      ----------------------------------------DEIRENLVN--LKVSAVSGS
A0A7C5P291      ----------------------------------------DEVRENLTN--LKISPIRGT
A0A139SU05      -----------------------VAIIQRPYLKSQAPGEPLPPLAAMLG-LLSIDPVRNS
A0A139SPN4      -----------------------IAIIQRPYLKSQPPGEPLPPLAAMLG-LLSIDPVRNS
A0A1V6E7N1      -----------------------VKILQRPFLTKLSPGATPPSAGAALG-SMVPSPVRNS
A0A2D9MYT1      GYAGGDAPALSREENRPLATGLFAFPPKPKDGEEPEDLTYEEQLKRLSD-AVSVSPIRLS
A0A258ANJ7      --------------------------------PADSKEARDNAIFMVSS-MIRISLRKDT
A0A290QGD9      --------------------------------LKGGSGDPLTPAEVLFK-NRRVIPRRMS
A0A1D8AS58      --------------------------------KSPGAEVPITAAEVVYL-NRKIVPVRLS
I6AQC1          --------------------------------EKGRFGDPLTPLEVLGE-NRSIVPFRMS
W0ITH7          --------------------------------EKGRFGDPLTPLEVLGQ-NRSIIPFRMS
A0A139TLN4      TGVFGREIEFCSHTFTVEKTPRFDSRSLDAPVIVRKTFIKNAAIALIGG--LTVNKASGK
A0A1G3ZFT0      ILEGKIGERLANQDKSIQLQINQISARAGTKFTLMQYPINDRMVRSMAR-RITIDDPEKL
A0A1Z8ZMT6      ------------------------AKKAEEKKVFAEAPAPEQLAGIISG-WTSSEVRRGT
A0A2E8MCT7      ------------------------AKEPVKKKVFADAPEPEQLSGMISG-WTSSEVRRGL
A0A290Q2Z2      --------------------------KIGRSIGAYAPLATDETYNYLLKKMLRVESPRGS
A0A2A2RGK2      -----------------------DPRFLSAVGISAKDATNDRTAGALSG-MVGVIYRPQT
A0A2A2XXF7      -----------------------DPRFLAAAGISARDASPDRVAAALSS-MSASVYRLNT
A0A2A2R5D6      ---------------------------------GGSNLPMDKAFVLLNN-RVDVNVQRNS
A0A1J4XH17      ------------------------LTDVFLAPYSVSNKSKEAIAEILFH-NRKIVPERSS
A0A3C1VJ32      -------------------------------YNNGETLKTTETMEILKQ-RMGLVPVRNT
A0A2N9NTX7      -------------------------------LEGGAPLKKQQTIDKLKR-MMDPRQVRNT
B9XK55          -------------------------------YNNGQKLKTSQSRAQLKR-MMELHPDRNT
A0A4P5YMI6      -------------------------------YGSPVPLLDTEAYGVLTK-RLDLRQVRNT
A0A2E6T482      --------------------------------EKG--LDLIKAREILKK-TIDVRQYRNT
A0A3C0DQZ7      --------------------------------EKG--LDLIKAREILKK-TIDVRQYRNT
A0A1Z9CBK5      --------------------------------YGGEELDEVRARKHLEK-VIDVSQYRNT
A0A2D6ZI96      --------------------------------YGGEELDEVRARKHLEK-VIDVSQYRNT
A0A358KGZ3      --------------------------------YGGKQLTDVEARKHLEK-VIDVSQYRNT
A0A2E9ZQX4      --------------------------------YGGKQLTDVEARKHLEK-VIDVSQYRNT
A0A3D5JZU0      --------------------------------YGGKQLTDVEARKHLEK-VIDVSQYRNT
A0A2E6HCR0      --------------------------------NGGEPLTELVARKRLEK-VIDVSQYRNT
A0A1Z8WN04      --------------------------------NGGESLSELRARKLLEK-VIDVSQYRNT
A0A2D7L1N4      --------------------------------NGGESLSELRARKLLEK-VIDVSQYRNT
A0A2E2R937      --------------------------------NGGESLSELRARKLLEK-VIDVSQYRNT
A0A520QQY4      --------------------------------NGGESLSELRARKLLEK-VIDVSQYRNT
A0A2D5MR66      --------------------------------NGGEALTELRARKRLEK-IIDVSQYRNT
A0A2E0PDQ1      --------------------------------NGGELLTELRARKRLEK-VIDVSQYRNT
A0A2E2ZZP9      --------------------------------NGGELLTELRARKRLEK-VIDVSQYRNT
A0A7C4LRK7      -------------------------------DKLPVPYRLDETMILLKR-DVDITTYRNT
A0A2A2RGF2      -------------------------------YRLGQ--SKVKAYEVLTK-LIDPRQVRNT
A0A2G4I5Y6      -------------------------------YRLGQ--SKLKAYQVLTK-LIDPRQVRNT
A0A6N6PS97      -------------------------------YRLTSKLSQEDTFQIIKK-TIDLQETRNT
A0A3M1I883      -------------------------------LRDGELLNEQEAYQYLLR-NMEVKQSRNT
A0A1V6JZ45      -------------------------------LKN--AVSEPEAYLLLRR-NLDVRQSRNT
A0A7C7Z746      -------------------------------YNAGRTLTTEQTYQILKS-KIDTSPTRNT
A0A520RRW5      -------------------------------FKTDTPLTTNETFQVLKN-SIDVDQYRNT
A0A356NPK0      -------------------------------FKTDTPLTTNETFQVLKN-SIDVDQYRNT
A0A2D7B5P5      -------------------------------FKTDTPLTTNETFQVLKN-SIDVDQYRNT
A0A3D3XGB5      -------------------------------FKTDTPLTTNETFQVLKN-SIDVDQYRNT
A0A2V6F8A1      -------------------------------YNNGVALSKAETFDVLKG-KIDVRQTRNT
A0A2V5TNH4      -------------------------------YNNNIPLKTPETFDILQG-KIDVRQTRNT
A0A2V5X5Q6      -------------------------------YNNNIPLKTPETFDILHG-KIDVRETRNT
A0A4P5QM05      -----------------------------ELSPPGQTMPLQWVTEILSR-SMVVQEQRNT
A0A4Q3C001      -----------------------------YYSGDGPPLPKQTVLRLLNA-DLVLQEVRNT
B4DB23          -----------------------------EFSPPGQRLPLQQVYIQLRN-SMKLNEVRNT
A0A6B3L938      --------LEKVIPPPLSLKPKYWRDESSREFQSAAETSETDFLELLYS-GISVSNQRGT
A0A2V5URB2      TGQARHKNFAAELWSRATAWLNSLSSQPVTANAPDVYGINSQLIDAYQG-MVEIEPLKRS
A0A2V2DJ66      ----------------------------------------KTEEEILQM-NRRVIPERMS
R7L5A9          ----------------------------------------KSEEELLMD-NRSIIPQRMS
A0A5R8KA81      ----------------------------------------PELVDALES-EIDITIRKGT
A0A5B5WU87      GTFGKEVRFDSLTFIVEKTPRFSEAALNVPVIVRKTSV--RNAAVGLRS-GLTVKKANGK
R7DZW0          GVFGKEIRFDSQAFIVEKTSKFDESSLNVPVIVRRTSV--KNAAMGLGS-GLTVRKASGK
A0A2N8HID1      GVFGKEIRFDSQAFIVEKTPKFDESSLNVPVIVRRTSV--KNAAMGLGS-GLTVRKASGK
A0A2N8HS06      GVFGKEIRFDSQAFIVEKTPKFDESSLNVPVIVRRTSV--KNAAMGLGS-GLTVRKASGK
A0A6N2TNT9      GVFGKEIRFDSQAFIVEKTPKFDESSLNVPVIVRRTSV--KNAAMGLGS-GLTVRKASGK
A0A3R5R2M8      KGEYGQPISLPFATVSIHPTSVMNADWNGQTVIIRHVPSQDTARALLANFSVARPDAKDS
A0A411SUQ6      EGFYGKPLTLPFATISVHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKES
A0A2N8HZF2      EGFYGKPLTLPFAVISIHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKES
A0A354E720      EGFYGKPLTLPFATVSVHPTSLMTDAWNGKTVIVRHSPVLETANALLHGLTITRPDSKES
B2UPB6          EGFYGKPLTLPFATISVHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKES
A0A2V6JLK8      -----------------------------------RPPSREIAYQMLRN-RLDVDEVRNT
A0A2W5Z1A5      -----------------------------------GPLSREQTYAILRG-KLEVDEVRNT
A0A2V6EA09      -----------------------------------RP-SREQTYKLLLS-RLDVEEVRNT
A0A2V6GQI7      -----------------------------------RP-SREQTYKLLLR-RLDVEEVRNT
A0A3C1HEJ2      ---------------------------------IQGILSRAKLVARVSD-LIAPRLRPAT
A0A522ULD9      -----------------------------KFNEDKSPINRSLAFSILSG-ALRVQPYRDT
A0A1V6JU76      --------------------------------EDSRYRDSPDVARALAE-DIRINPIRLS
A0A2A2XXW5      --------------------------------DDERYTKSVDKVTAVTK-DIKIVPIRLS
A0A6N6Q6V0      --------------------------------EDGRYKKALDKISAVNE-DIRIDPIRLT
A0A1Q6UHJ9      ----------------------------------------KTEEELLAE-NRTIAPERMS
A0A2V2BXR0      ----------------------------------------KTEEELLAE-NRTIAPERMS
A0A2D8V0G3      ---------------------------------DEVFKGAENIVNAVRD-CITISPIRLS
A0A348S017      ---------------------------------EGRYAQSQNVINAVRN-DISISPVRLS
A0A3C1UUV7      ---------------------------------EGRYAQSQNVINAVRN-DITISPVRLS
A0A350I3V2      ---------------------------------EGRYAQSQNVINAVRN-DITISPVRLS
A0A520RGV5      ---------------------------------EGRYAQSLDVINAVRN-DITISPVRLS
A0A3D3XF90      ---------------------------------EGRYAQSLDVINAVRN-DITISPVRLS
A0A2D7B522      ---------------------------------EGRYAQSLDVINAVRN-DITISPVRLS
A0A356NIC2      ---------------------------------EGRYAQSLDVINAVRN-DITISPVRLS
A0A2N8HDG3      KGTFHSPIHLPFATVTVYPTSNMTETVPGTTITVRRTPVNAAADQLLANFTVMRPDAKES
A0A146GCJ0      --------------------------------KDGSPYSEIELVDKLAQ-KIDVQLIRGT
A0A2T6D6H8      --------------------------------SNGGKYTDIELADRLAS-KVSAKLRRGT
A0A3D1TI55      -----------------------------QFNDNQEEMDLESTISRLRS-MVETVQVRGT
A0A3E1ET42      ----------------------------------------DEALTKLER-MIETETERGT
A0A2A2YDW8      ----------------------------------------EDALMTLTG-IVQAQNIRGT
A0A352XLN9      ----------------------------------------EDALMTLTG-IVQAQNIRGT
A0A3D0YP62      ----------------------------------------KTVIDVLRQ-IVRTTQRRGT
A0A3D3DV47      ----------------------------------------KTVIDVLRQ-IVRTTQRRGT
A0A2E5XJ49      ----------------------------------------DMALLKVKK-ILKTEQIRNT
A0A2E6SBY8      ----------------------------------------DMALLRVKK-ILKTEQIRNT
A0A2E5QMS4      ----------------------------------------DMALVKLKQ-ILKTEQIRNT
A0A2E7YXQ3      ----------------------------------------DMALVKLKQ-ILKTEQIRNT
A0A2E3H787      ----------------------------------------DMALLKLKS-ILKTEQIRNT
A0A2E7AGN1      ----------------------------------------DMALIKLKS-ILKTEQIRNT
A0A2E7AKY7      ----------------------------------------DMALMKLKS-ILKTEQIRNT
A0A3D4CU34      ----------------------------------------DMALIKLKS-ILKTEQIRNT
A0A2E8M146      ----------------------------------------NMALLKLKS-ILKTEQIRNT
A0A355S8S2      ----------------------------------------NMALLKLKS-ILKTEQIRNT
A0A2D6DVN8      ----------------------------------------NMAVLKLKS-ILKTEQIRNT
A0A3C1W2R2      ----------------------------------------NMAVLKLKS-ILKTEQIRNT
A0A2E3NAY6      ----------------------------------------NMALLKLKS-ILKTEQVRNT
A0A2E3II01      ----------------------------------------NMALLKLKS-ILKTEQIRNT
A0A368B8C5      ----------------------------------------NMALLKLKS-ILKTEQVRNT
A0A3R7RBB5      ----------------------------------------NMALLKLKS-ILKTEQVRNT
A0A2A2QX62      ----------------------------------------ESVRGTLRG-IVSAQNIRGT
A0A4Q3BWH6      ----------------------------------------ESVRGILKG-IVEAQDIRGT
A0A3N5WCF1      ----------------------------------------EAALGILKG-IVGTQNIRGT
A0A4Q3C1K5      ----------------------------------------DTAIKILKG-IVQTQNLRGT
A0A3R8IT45      --------------------------------EKGRFGDPLTPLEVLGQ-NRKIVPLRLS
A0A2A2PYE8      --------------------------------ERAGTDITYVA-EILAK-NRKIIPQRLT
A0A2T6CN73      --------------------------------DTGAPEKPSVA-RLLKL-NRRVIPQRLT
A0A2G4G428      -----------------------KKEVLAPYQSGNIFSGPLSEQEVFSR-QRSIMPQRQT
A0A6N6PCD8      ------------------------EDPAFRPAPGDPPRTDAELAEIMQR-QLQAKLKRGS
A0A139TV24      EEELKKPVHLPFATITVYPTSHMPETIPGTTITVRRVPINAAADQLLANFTVKRPDAKES
A0A2N8HT11      KGKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKES
R7DS70          KGKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKES
A0A2N8HNL6      KGKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKES
A0A6N6PAZ1      --------------TDWLPDWLSHKLGKKSADTDHQPPPPPAALGGMASQWLTVSIRRNT
A0A6I1K459      -----------------------------------NTLTESQVMAAVGG-MLDARLRRFT
A0A139TUL1      AGKFGIPLELPFATVTVRTTSHFSSGSIGRPIFVERLSVKEACAQMLGRLSVTRPDSKES
A0A2N8HCB0      HGKFGVPLKLPSATVKVCPTSYFSSGSMGRTIFVERVSVKEAAAGMLGRLSVTRPDSKES
A0A2N8HP04      HGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGRLSVTRPDSKES
A0A2N8HRJ0      HGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGQLSVTRPDSKES
A0A6N2U9Y7      HGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGQLSVTRPDSKES
A0A366HAG0      ----------------------------------------QAAAGKLIG-NLDAQSSIKS
A0A2U8DZK4      -------------------------KLAAVLEIPGPLPVDFTYDYLIKKRIVSVESPKTS
A0A2T6DFL8      -------------------------KIAALKDSPAAFPSAVTYAILTRK-MLRVESQRAS
A0A1D8AWD4      -------------------------ILGKQLNDGVALPSAITYRYLISK-MLRVEAPRAS
A0A4Q1C9S2      -------------------------ILGKQLNNGAPLPSAITYKYMLDK-MVRPDAPRAS
A0A178IH18      -------------------------RIAALLGASAPYPTDVTYEYLTKK-MLRVEMPRNT
A0A2T6DT99      -------------------------KLAASQGSSVPLPTDVTYLLLVNK-MIRIETPRGS
A0A1G3ZT33      -------------------------VLGKMLNNGEPLPTSITAQYLLRK-MLRVESQRSS
A0A3E1E2T2      -------------------------VLAPALDSPEPLPDAITYHYLLQK-MLRVESQRSS
B1ZMW1          -------------------------RLAPLLGATGPLPSAMTYRYLLNK-MLAVESQRSS
A0A3M1I8A3      -----------------------------------------DIVAALAK-DITVTPIRMT
A0A4V0XS84      -----------------------------------------DLIKVLSE-DLTVAPIRAT
A0A351WE84      -----------------------------QYNDDKSPITKEDALATLSS-SIKIEQDRDT
D5ENH7          ----------------------------------------LTASEILGK-YRKIMPQRMS
A0A0R2XQ77      ----------------------------------------LSPAALLAQ-NRRIMPQRGT
A0A2E9IN28      ----------------------------------------LTPLEILGR-NRSIMPKRMS
A0A6N4WTJ5      ----------------------------------------LSPVEILGK-YRKVMPQRMS
A0A1V5QDZ6      -----------------------------EVNDDGSPLPLERAHAMLSR-SLKVEQFRDT
A0A4Y8P964      -------------------KPSITKHSKNSSEEEETSSIINSYTKRILD-NLRIEPVKNT
A0A3D4HF88      ---------------------------KGDEE--------VTINEVLYE-NRDVVPLRAS
A0A6N6ZHN8      -----------------------------EDELESTLSGAPEVPSILAR-NRSVVPERSS
A0A351MR11      -----------------------RKAVLEPYQSGNIFSGPLTSQEVFGR-QRGIAAQRMT
A0A6G6K641      ------------------------DFVFLPRPAGRDANPLDVVVGRLQG-CVSSGVRGRT
A0A5B5WI95      EGTYGQSIALPFATVSIHPTSLMNEEWDGKPIIINHLTVLETAHGLLKN-FSVTRPDVKE
A0A2N8I9W1      EGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHG-LTVTRPDAKE
A0A4Q5IH27      EGFYGKPLTLPFAVISIHPTSLMTDTWNEKTVIVRHKPVLETANNLLHG-LTVTRPDAKE
A0A2N8IBZ6      EGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHG-LTVTRPDAKE
A0A2N8IJW9      EGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHG-LTVTRPDAKE
R6J100          EGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHG-LTVTRPDAKE
A0A1V6J089      ---------------------------EDKSAITP-----ELALQILQR-SIRVEQDRDT
A0A3C1BZR1      ---------------------------EDKSPVAP-----ELALQILSR-SLRVEQDRDT
A0A7C4KLL2      -----------------------------------GSVTRDEVIARLGT-LTKAELRRGT
A0A1H6KPB7      ----------------------------------------ATAASILRG-MIQVMPVRGK
A0A2E9ISN4      ----------------------------------------TEPERYVEF-LVTSVPGSNG
B9XAX1          ----------------------------------------AKLVNALAG-MIVTKLRPET
A0A5R8KKM9      ---------------------------GR-----------QFAIGRLQG-HLEVNSSARS
A0A139TS01      ----------------------------------------DLAATNLAG-MIKVSPLRAT
A0A3E1EJT7      ---------------------------HAGEP--------PSPASIIYH-NRQIIPQRLS
A0A317ZP96      ---------------------------LTPTE-------------VLGR-NRKIIPRRMS
A0A7C3I5X9      ----------------------------------PRYQKHVDVARAVAD-DISVTPLRMT
A0A2D5WGA5      ---------------------------DPLSD--------VNARKILEK-SIDIRQYRNT
A0A2E7SSH2      ---------------------------WDLND--------QQARKQLEK-VIDVSQYRNT
A0A349GXM8      ----------------------------------------LGGRHRMNP-KIAISQVRGI
A0A4P5YP61      ---------------------------VAGTAAPEKEISIDGIAGTLAA-ITESRMRRGT
A0A6B2LYM4      ---------------------------GLDATL-RGT---RSVGQILYS-NRAISPVRLS
A0A6D1VXB3      ---------------------------NPSEGI-EPTSEINLYAEYLLK-NLQVTPVRNT
I0JYY7          ---------------------------NPSEGI-EPTSEINLYAEYLLK-NLQVTPVRNT
A0A4R7S1J2      ---------------------------KLPSAE-DAL---PQAVGILSG-ALKAAPRVGT
A0A2A2XV69      ---------------------------IAGK---------EQTIFRLRK-MIDVREIRNT
A0A651H7X9      ---------------------------MAPYET-GDASDPVTPIEIIGQ-NRRIMPLRLS
A0A4Y8P842      ---------------------------KKTAPL-PSS---EKLAEIVQN-NLHVLPVRGT
B3DZK9          ---------------------------KKNGPL-PSS---EKLSEIVQN-NLHILPVRGT
A0A5E6MPC4      ---------------------------AKRANL-EEEPYISPVAGLLVG-NLRIEPVRNT
A0A6N6PKP9      ---------------------------IAGIDS-E-----SRLQAIVGG-KISVKIRVGT
A0A6N6Z250      ---------------------------LNGTLD-RE----QTYLYLTRK-MLQVEDRPNT
A0A4V1SB02      ---------------------------SNGQAG-TDID--SVIVDTLNS-KLKVTLRRNT
A0A6N6QEJ2      ---------------------------VPEINI-------QQTYEVLSR-AVEVRQRRNT
A0A3C1VB86      ---------------------------NGSKTV-TR----ENIISQFEK-NVKTSLRRNT
A0A146G2Q9      -----------------------------PSR--------EQAYFRLVR-MINIQEIRNT
A0A2T6D3Y2      -----------------------------PSR--------EQAYFRLVR-MINIQEIRNT
A0A6N6P5E3      -----------------------------NSK--------DIAYLKLRS-MLTVSEVRNT
A0A2D5VY59      -----------------------------RYNL-KQPLTLNEAFNVLKK-SIEVDQYRNT
A0A2D8UZZ4      -----------------------------RYNL-KQPLTLNEAFNVLKK-SIEVDQYRNT
A0A353DV86      -----------------------------RYNL-KQPLTLNEAFNVLKK-SIEVDQYRNT
A0A2E5EPT8      ---------------------------IGEFTP-------QKTKLLLEK-RIDPTQVRNT
A0A6J4HTK1      ---------------------------RPSR---------EQAYNRLRS-KLDVDEVRNT
A0A6N6PHJ5      ----------------------------DGQKF-KT----QESVGILKS-RLNLRPRRNT
A0A6M1RXR2      ----------------------------GGEPL-KM----TEALMLLRS-RMDLSPRRNT
A0A7C3DXS4      ----------------------------GGEPL-KM----QEALMLLRS-RMDLRPRRNT
A0A2V2SDV4      ---------------------------PNGAPL-QS----TDTMKLLQA-RMGLQPVRNT
A0A2V5PK75      ----------------------------GGVKL-KT----PDTIVMLKG-RMDLRPVRNT
A0A1V6DME1      ----------------------------GGERL-KT----QETMTLLRN-RMDLNPVRNT
A0A3D3DIJ3      ----------------------------SGERL-RT----PETIALLKQ-RIDLRTVRGT
A0A6I1K583      ---------------------------LGQSK--------FKAYQVLIK-LIDPRQVRNT
A0A350EWA4      -----------------------------ARKL-EVNLKPEEAYMLLKG-DLSVSQMRNT
A0A5B5WZ91      ------------------------------TD--------ELAATNLAG-MIKVSPRRAT
A0A2N8HD92      ------------------------------TD--------EKAASNLAG-MIKVAPVRAT
A0A2N8HIT2      ------------------------------TD--------EMAASNLAG-MIKVAPVRAT
A0A354EBD3      ------------------------------TD--------EMAATNLFG-MIKVAPVRAT
A0A355VEB2      ------------------------------TD--------EMAATNLFG-MIKVAPVRAT
A0A2N8IMT3      ------------------------------TD--------EMAATNLFG-MIKVAPVRAT
R6K1U5          ------------------------------TD--------EMAATNLFG-MIKVAPVRAT
A0A2N8IWC2      ------------------------------TD--------EMAATNLAD-MIKVAPVRAT
A0A2N8I441      ------------------------------TD--------EMAATNLAD-MIKVAPVRAT
A0A2N8I3A6      ------------------------------TD--------EMAATNLAD-MIKVAPVRAT
A0A410SCC4      ------------------------------TD--------EMAATNLAD-MIKVAPVRAT
A0A3R5VEW0      ------------------------------TD--------EMAATNLAD-MIKVAPVRAT
A0A411SSG2      ------------------------------TD--------EMAATNLAG-MIKVAPVRAT
B2UKW3          ------------------------------TD--------EMAATNLAG-MIKVAPVRAT
A0A7C3HWX0      ---------------------------PENEPI-RPDEARQLTYQLLRR-NMDVRQTRNS
A0A7C4KPD7      -----------------------------RDGL-QVPYRMDETRLLLRR-MVDLNLYRNT
A0A1M6RLZ4      -----------------------------PMQ--------E-VVSIMTK-SLNTNQERGT
A0A354T7G8      -----------------------------PSR--------QAALAKLRA-NLETQSMLRS
A0A2S7U4L6      -----------------------------STD--------E-AILVLKG-GLSARQERGT
A0A512MBZ2      -----------------------------PSR--------QAALGKLQG-NLNAQSMPRS
A0A2E8MEZ0      -----------------------------DMD--------S-AIKTLEN-VVETIPIRGT
A0A6B3LBV6      -----------------------------TDE--------NQAIAKLRD-SVETENRRGT
A0A2E3EC33      -----------------------------TSE--------EDAFXILKK-KVETQXVRGT
A0A2E4GN01      -----------------------------SSE--------DDAFRXLKK-KVETQDVRGT
A0A1Z8XU55      -----------------------------NSD--------EDAYRILKX-KVETQDVRGT
A0A2E1RQR9      -----------------------------NSD--------EDAYRILKK-KVETQDVRGT
A0A2E3ISQ4      -----------------------------PTN--------EDAYQILKR-KVETQDVRGT
A0A2D6W6F4      -----------------------------PSD--------EDAYRILKR-KVETQDVRGT
A0A2D8Z5A8      -----------------------------PSD--------EDAYRILKR-KVETQDVRGT
A0A4Q2YKS3      -----------------------------DRD--------QIVAELKYK-IITTQNIRGT
A0A6N6P3T8      -----------------------------DRE--------TVFNILT-S-IVRTDNIRGT
                                                                            

A0A2A2XVF1      R-LIDIIVE--DKDPV------MARDLAASFVKEFLRENFSQRLSVSRVATDFLQEESQK
A0A2V5UHJ2      S-LVVIKFT--TPDPA------LSARLANAHASSYVRYGIDLRSQTNSEASEFLQEKLTE
A0A2V5PST3      R-LVEIAFV--TPNPA------LSQKLADAHIKAFIRMNLEGRFQLTKEARDFLDIKNAE
A0A2V5PXM3      R-LIDVKVE--HTSPE------MAALIANSL-------------------LNFLRNEEKR
A0A1V5QB01      A-FLAITVE--SLDPV------LGSDMANALADEYLDFKAEERLNTSQATVVSLTQQANR
A0A7C5LI63      D-IILISVD--SPSRE------FARDFANALAQEYLLFRDEERARSAESALLMLTREVNR
A0A7C5P291      Q-IILISVD--SPSRD------FARDFANALAEEYFRFREEQRAASSESALLMLTREINR
A0A139SU05      F-ILRLTVG--HQDPE------AAAILAQRHVDQFLSYLLENISGVNDTAVDFLRERAEQ
A0A139SPN4      F-ILRLTVG--HQDPE------AAAILAQRHVDQFLSYLLDNISGVNDTALDFLHERAEQ
A0A1V6E7N1      F-LISVSVN--HQDPE------AAALIANRYIDQFMQQIMDSTMGKNEYATDFLRKRSDD
A0A2D9MYT1      R-LVDVSVE--SPNRN------EAALIANTVISKFLEQDNNRKRGKLANAVDFLREEATN
A0A258ANJ7      R-LIDFNVT--GADPE------QVAALSNQAVLSLVSELESQKSKTLQGAIQALVAEGQR
A0A290QGD9      L-IIEVQYR--HPDRV------LASDIANMFVDEFIAYNSRVRIDESMKAVDELRARVND
A0A1D8AS58      L-VLQVQFS--HPDKL------MAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERADQ
I6AQC1          L-LVAIEYR--HPDRL------IAAKVANLFLEEFVQFNTRQRVDQTFGILEDLKLRAES
W0ITH7          L-LVAIEYR--HPDRL------IAAKVANLFLEEFVQFNTRQRVDETFGILEDLKLRAES
A0A139TLN4      TNLINISVR--CNNPV------KAENVLHNLVRFYNEASLDEKKKRGMNTDKFIEERLGV
A0A1G3ZFT0      G-LLTLAYQ--DTNPH------LAARVVNEIAKVTQHKNTEKKSLEASKILSFLSKQLPL
A0A1Z8ZMT6      R-LIDISVN--HTDPD------VAQVIANQIIQQFINIREGVNEEGKKSDLQHLLTAAKE
A0A2E8MCT7      R-LIDISVN--HTDPD------VAQVIANQIVKQFINIREGVNEEGKKSDLQHLLAAAKE
A0A290Q2Z2      S-MIEVGVY--SQDAA------LAAAIANEIARVYSDDRIMFATSEQREGLTQLRKELES
A0A2A2RGK2      R-LIDVSIT--SRDPN------LSVKLANAYADEYIRYVFEKRSDAAKSATQFLVEEADR
A0A2A2XXF7      R-LIDLMIT--SADPN------LSVKLANAYCDEYIRYVFERRSDASKSATQFLLEEADR
A0A2A2R5D6      D-ILEIRVK--SDLPK------EASDIANAIMDVYIEMRRADLQTRESRGFKTLDDEIAK
A0A1J4XH17      L-MIMLAYN--HPDPE------IAAKVANMFAEEYINYNMTLNIDGSMKAIFDLKERAKE
A0A3C1VJ32      K-LISITVY--SDDKK------EAADLANSIAEAYRTYRIQTSQQQATTGLEVYQTQYLE
A0A2N9NTX7      S-LVEIWVT--SFNKE------EAAKLANEIAEAYQAHRLEERAELTTGGIKSLEERWKE
B9XK55          S-LIEIKIY--SNDKK------EAAAIANEVAIVYQKYRLDQKLDITGAGIKVFKQQVQE
A0A4P5YMI6      S-LIEIRVF--SEIPA------EAREIAQKIAEVYRDNRLNAKRSMSAGGIKKLQEKLET
A0A2E6T482      S-IIELRAY--DRDKE------LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRMEE
A0A3C0DQZ7      S-IIELRAY--DRDKE------LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRMEE
A0A1Z9CBK5      S-IIELRAY--DRDRG------LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMTT
A0A2D6ZI96      S-IIELRAY--DRDRG------LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMTT
A0A358KGZ3      S-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMEK
A0A2E9ZQX4      S-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMKK
A0A3D5JZU0      S-IIELRAY--DRDKN------LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMEK
A0A2E6HCR0      S-IIELRAY--DGDED------LAREIAQALAEQYKNYRSNLQKRRVEAGINKLKERMEK
A0A1Z8WN04      S-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEK
A0A2D7L1N4      S-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEK
A0A2E2R937      S-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKXRVEAGINXLKERMEK
A0A520QQY4      S-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEK
A0A2D5MR66      S-IIELRAY--DGDEN------LAREIAQALAEEYKNYRSKLQKGRVEAGIGKLKERMEK
A0A2E0PDQ1      S-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERMEK
A0A2E2ZZP9      S-IIELRAY--DGDEN------LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERMEK
A0A7C4LRK7      S-IIEIKVF--SPKPE------EAAEIANEIANAYKEYRQETRMEVARSGVKTLQDEYAE
A0A2A2RGF2      S-IIEINVY--SKDKA------EAAEIANKIAEIYKENREAQRKLQAEKGLKILRDRLAD
A0A2G4I5Y6      S-IIEINVY--SKDKE------EAAEIANKIAEIYKENRESQRKLQAEKGIKILRARLLD
A0A6N6PS97      S-LIEIRAY--SEDPN------EASAIANKVAEIYQRVRLENRKSSTQRGIDALKLEFTE
A0A3M1I883      K-LVEITVY--SPIPE------EAADLANLIAASYKNWRQHSRREHMTNAIAVLQQKLEE
A0A1V6JZ45      S-LIEIRAY--SENRD------EASAIANEVANVYKESRVEEKQRQTSAGISKLRAKLDE
A0A7C7Z746      S-LIEIKVY--SDKPE------EAAELAQLIADEYKDLRKITRTHLIEGALIKLREELTI
A0A520RRW5      S-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLT
A0A356NPK0      S-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLT
A0A2D7B5P5      S-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLX
A0A3D3XGB5      S-LIEIKAY--SKDKE------EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLT
A0A2V6F8A1      S-LIEIRVY--SDAKDK--PAQEAAEIANQIATVYRDTQLGLKQEMSQKGIEVLRKELSQ
A0A2V5TNH4      S-LIEIRVY--SDAKEKEKPAQEAAEIANEIANVYRDTRLELKQEMSRKGIQVLREELQQ
A0A2V5X5Q6      S-LIEIRVY--SDAKEKDNPAQEAAKIANEIANVYRDTRLELKQEMSRKGIKVLKQELEQ
A0A4P5QM05      T-LVDIGVY--HTKPE------LAAVIANTIAVTYRDKRIEELRKNTDQTLKEMKDELKT
A0A4Q3C001      S-FIEIGVY--NTDPQ------TAANIANTIAVVYQNKRLEEQQGNVDRSLAQFRDEVEK
B4DB23          G-LIEVGAK--DTDAQ------RAANIANAIAVVYQEERQHELDKNVARGLEQLKDEVDR
A0A6B3L938      T-LINIEMT--HPDPE------TAKTIANAVMMVYIEGEQARRAGGSSDAFRILKAEADD
A0A2V5URB2      R-LVRISIS--SADPV------LAASVANAHAIAYVRQGLKLGSQANEEARKFLETKLAE
A0A2V2DJ66      L-MIRVTYT--HPNAE------MAARIADLFVNEYITYTRMTRVQTLLDSIEELRTKVAQ
R7L5A9          L-IVTVIFE--HPDNN------MAARIANLFATEFINYTHQKRVQALMGSIDELRTKVSQ
A0A5R8KA81      R-LIEVSVE--DQVPE------RAQKIAGMLIEESIGQNIESRANAGTLANEFLAAESKR
A0A5B5WU87      NNLVNVSIR--CNNPV------KAEVILHSIVHFYNEASLKEKNTRGTKTNKFIGERLAV
R7DZW0          NDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDV
A0A2N8HID1      NDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDV
A0A2N8HS06      NDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDV
A0A6N2TNT9      NDLINISMR--CNNPV------KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDV
A0A3R5R2M8      S-LLEMTLT--ASNPQ------KAEDVLNHLIEVYNQISIDEKKQSALKTRKFIEGRLAE
A0A411SUQ6      S-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKE
A0A2N8HZF2      S-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKAALKTENFIQSRLKE
A0A354E720      S-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLQE
B2UPB6          S-LLEMTLT--SSNPQ------KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKE
A0A2V6JLK8      D-LLQISVY--DGSPQ------LAADIANKIVSVYQDRRVEEEKEILNRAVTAMNEEVGK
A0A2W5Z1A5      N-LLQISVF--DSNPQ------LAADIVNKIIAVYQDKRVEEEKDILNRAVGSMNEEVDK
A0A2V6EA09      D-LLQISVF--DANPQ------EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVAR
A0A2V6GQI7      D-LLQISVF--DANPQ------EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVAR
A0A3C1HEJ2      R-LIDVTVQ--HSDPQ------LTEQIANSLAREFLQRRFEQQISASESATSFYRQKEQE
A0A522ULD9      S-LISIIVR--MEDAA------EAALVANEIAKVYREHRLSEKRSQMMRGMEALEGEIEK
A0A1V6JU76      R-LVDVVVE--HPNAS------KAAGIANALVEEFIEQNLVQKQKRTMDMLFFLRSQANG
A0A2A2XXW5      R-LVEVQVT--HPKGE------QAQRIADTILQVFLQQNLDDKKSKALQGLKILEQEATG
A0A6N6Q6V0      R-LVEVKAR--HPVQS------RARDMADTLLDIFLEDNQTRKSLKAMSGYRALKVEAQA
A0A1Q6UHJ9      L-IIRIAFE--HPDPD------MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKVSQ
A0A2V2BXR0      L-IIRIAFE--HPDPD------MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKVSQ
A0A2D8V0G3      R-LVEVSVE--HPSPL------QAAAIANKLMQNFLTRNLDKKKQRAFESYKWLQNEVNQ
A0A348S017      R-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDG
A0A3C1UUV7      R-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDG
A0A350I3V2      R-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDG
A0A520RGV5      R-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDG
A0A3D3XF90      R-LVEISVQ--HPSPR------VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDG
A0A2D7B522      R-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWXDTEVDG
A0A356NIC2      R-LVEISVQ--HPSPR------VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDG
A0A2N8HDG3      S-ILQMTLT--STNPV------KAADTLNKLIAVYNDHSTAERRTTAVKTKDFIREQRAQ
A0A146GCJ0      R-LVQIVVE--DKNPE------KAQKIAATFVKEFFRENFDQKLALSRVANEFLQDEADK
A0A2T6D6H8      R-LIELTVE--DKNPE------LAQKIAFSIVREFLRENFDQKLALSRVANEFLQEESEK
A0A3D1TI55      T-IIEVQVT--SRDSA------EAAAIANKIAEVFQETRLASVKKKYSDALVQMQEEMDQ
A0A3E1ET42      E-IMTVIVS--SVRRD------EAAAIANEVREAYDAQRQEIEAERIRRLTQTLDAKIKS
A0A2A2YDW8      D-LIEITVL--HPGAE------DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAVLE
A0A352XLN9      D-LIEITVL--HPGAE------DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAVLE
A0A3D0YP62      D-LIEISVR--HRKKE------EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQN
A0A3D3DV47      D-LIEISVR--HRKKE------EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQN
A0A2E5XJ49      D-HIEIRIR--HQKPE------DAQLIAQEIAKSYQLVRNADERARAGEALDALEAEVRS
A0A2E6SBY8      D-HIEIRIR--HQKPE------DAQLVAREIAKSYQLVRNSDERARASEALDALEAEVRS
A0A2E5QMS4      D-HIEIRIR--HQNSE------DARDVAKEIAESYQXGRNADERNRAGEALDALEAEVRS
A0A2E7YXQ3      D-HIEIRIR--HQNSE------DARDVAKEIAESYQLGRNADERNRAGEALDALEAEVRS
A0A2E3H787      D-HIEIRIR--HQKQE------DARDIAKEIAESYQLGRNADERKRAEEALDALESEVRS
A0A2E7AGN1      D-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRS
A0A2E7AKY7      D-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRS
A0A3D4CU34      D-HIEIRIR--HQNRE------DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRS
A0A2E8M146      D-HIEVRIR--HQNRD------DARNIAKAIAESYKEGRNEDERKRAGDALDALESEVRS
A0A355S8S2      D-HIEVRIR--HQNRD------DARNIAKAIAESYKEGRNEDERKRAGDALDALESEVRS
A0A2D6DVN8      D-HIEIRIR--HQNRD------DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEVRS
A0A3C1W2R2      D-HIEIRIR--HQNRD------DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEVRS
A0A2E3NAY6      D-HIEIRIR--HQNRD------DARDIAKAIAESYQEGRNEDERKRAGDALDALEAEVRS
A0A2E3II01      D-HIEIRIR--HQNRD------DARDIAKAIAESYQEGRNEDERKRAGDALDALESEVRS
A0A368B8C5      D-HIEIRIR--HQNRD------DARDIAKAIADSYQEGRNEDERKRAGDALDALESEVRS
A0A3R7RBB5      D-HIEIRIR--HQNRD------DARDIAKAIADSYQEGRNEDERKRAGDALDALESEVRS
A0A2A2QX62      S-LIEIRVR--YNDPK------DAQAIASAVSEAYRERRTALQSEVASQAMDQLGKAVVQ
A0A4Q3BWH6      S-LIEIRVR--YNDPK------DAQKIAKEVAEAYRERRRKLQGDHANQTLDELRKAVLV
A0A3N5WCF1      D-LISIRVR--HTNKV------DARDIAEEVARAYKEYRAEIETRDADRQLQELNKAVRD
A0A4Q3C1K5      D-LIQIRVR--HTSKE------DARNVTDEVAKAYRDYRLEIENRDADKALYELNKAVRD
A0A3R8IT45      L-IVGVEYT--HPDRL------IATKVANLFLEEFITFTSRQRIDQTFTILEDLKLRAET
A0A2A2PYE8      L-VVTVAYQ--HPDRF------VAAKVANLFAEAYLDHNISLRTQESNNAVEGLKGTVEE
A0A2T6CN73      L-MVWIAYK--HPNRF------VAAKVANHFARAYIDYNTQLRISEGVKAVEDLKGPVET
A0A2G4G428      L-VVNVEFT--HPNRE------LARQVTTLFCKAIQKNSEDERLVITNPLVEKYRMDIDS
A0A6N6PCD8      R-LIEISFD--SVNPE------RAAKVARTLVEEYTKGYFEQNAKSATAANDFLRKQAAE
A0A139TV24      S-LLQMTLT--SSNPD------KATDTLNKLIEIYNEHSREERRAIAVKTKEFIRRQLEQ
A0A2N8HT11      S-ILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQ
R7DS70          S-ILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQ
A0A2N8HNL6      S-ILQMTLT--STNPD------KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQ
A0A6N6PAZ1      R-LLDITIT--HPVPE------VAKAFADAVAREYLAEIANARSAGRSNSIDLLEKESKE
A0A6I1K459      R-LIDVTAE--SGDPA------LAQTLAQAVVEEYIKQNSEDRTGVGQNAGQFLMAEEMR
A0A139TUL1      S-LLELTLR--LSHPQ------KAEDVLNYLIEVYNDHSRREKQIASTRAEDFIVKRIEK
A0A2N8HCB0      S-LLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQLAASRAEEFIVKRIGK
A0A2N8HP04      S-LLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGK
A0A2N8HRJ0      S-LLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGK
A0A6N2U9Y7      S-LLELTLR--LSHPQ------KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGK
A0A366HAG0      D-FITLDYY--DEDPD------LAALIANTIADSYKETRLETDNARINKAIEGLNIQIAA
A0A2U8DZK4      S-IVEITID--TRDPA------LSAAIANEIVGVYTEDRINLATAAQKADLAELNNQLAA
A0A2T6DFL8      S-VIEINVD--AEDPQ------LAADIANEVARTYSADRIALATSDQSEGMAQLRQELLK
A0A1D8AWD4      S-IIEIDVY--ARDQR------LAADIANAIARVYAEDRITLATSDQREGLAQLRKELDK
A0A4Q1C9S2      S-IIEINVF--ARDNR------LAAEIANAIARVYAEDRIALATADQREGLAQLRKELVK
A0A178IH18      S-LLEVNVF--SRDAA------LAAAIANEIARAYSEDRIAFATAEQRAGLDQLRRELAG
A0A2T6DT99      S-LIEIEVS--AQDPA------LAAAIANEIGTAYSADRIDFATSQQREGLAQLRKELEK
A0A1G3ZT33      S-IIEIDVY--AQEPA------LAARIANEIARVYSENRINFATAGQREGMTELKKQLAA
A0A3E1E2T2      S-LIEISVY--SEDPT------LGAVIANEIARVYSDDRINLATSDQREGFVKLRGELIA
B1ZMW1          S-LIEINVY--AQEPP------LAAAIANEIARVYSDDRIALATSEQREGLAHLRKELEA
A0A3M1I8A3      R-LVEVSVE--HTDPR------KAKDIVDRLANEFIERNRLLKTGRMMSTLQVLRSQAQQ
A0A4V0XS84      R-LIEIKAN--HTDPQ------KAAKIVNTLVSIFMKQNTDDQSSKSQETFKLLTDEAKS
A0A351WE84      S-LINISVT--QEDRE------LAARIANEMAAVYREQRLDVKRSELRRAIEVLDNEVQK
D5ENH7          L-MVSVTYT--HPDSQ------MAADIANLFADEFINYKLTENIDASMVAVEGLRIRADR
A0A0R2XQ77      L-MIGVGYN--HPDPV------IAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQ
A0A2E9IN28      L-MIHIAYS--HPDPI------VAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRIRADQ
A0A6N4WTJ5      L-MIGVAYT--HPDPV------IAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQ
A0A1V5QDZ6      S-LISIQVY--REDPT------EAARIANSIAQVYHDQRLSMKRRELKRAIEALEGELAK
A0A4Y8P964      R-LVKIKFD--SVNAE------AAAQIANAYAEAFIAFGLDRKLEANQHARQFLAKQLDS
A0A3D4HF88      L-LIAVTYT--HPDAR------IAAHVANLFADEYINYNLRLTIENSMKAVEDLKLRVNQ
A0A6N6ZHN8      R-IVNVAFT--HPNPQ------VAQEVSNLFAEEFIDFNRTKAIEGNLRATEGLRDEAAK
A0A351MR11      M-IVNVEFT--HPDRD------LSRQVCRLFCESIQKNSEDERLTVTNPLVEKARVEIES
A0A6G6K641      R-LIDIRAE--HTDPE------TARKLADGVAEEYLRFTIETRNRSNQMANQMLMEEATR
A0A5B5WI95      SSLLEMTLT--ANNPQ------KAADVLNQLIAVYNQVSIDEKKLAAQKTKKFIEGRLEE
A0A2N8I9W1      SSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKE
A0A4Q5IH27      SSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKE
A0A2N8IBZ6      SSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKE
A0A2N8IJW9      SSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKE
R6J100          SSLLEMSLT--ASNPQ------KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKE
A0A1V6J089      M-LMNISAT--SEDPK------QAAAIANEIANVYRERRLADKRREIQHAIDAMSNEVRK
A0A3C1BZR1      T-LMNISAT--SEDPK------LAAEIANEVANVYRDRRLLAKRREIQRAIDAMSNEVRK
A0A7C4KLL2      R-LIDILAV--HTDPK------LAADIANSLAEQYMAYDIQTVSATTKGAYSYLRDETER
A0A1H6KPB7      D-LVDVKVV--GSDPA------LVKLICDAVTECYKEGREAQENEVLDKAIATIQEELTR
A0A2E9ISN4      T-MIDCLVD--SVAAE------YSKAYLVEMIQGYRSLRMEELMEVNQSALLGLKNEETR
B9XAX1          R-LVDITVT--HPNAE------MAQKLANAVAQEFILESLDQRFSNTKAANELLYAEAGK
A0A5R8KKM9      E-IINITYY--DEDPQ------LAADIANAVAESYRETRIQVDRDLADNSIKEFNIQVAA
A0A139TS01      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVLRE
A0A3E1EJT7      L-MTAIEFR--HPNPK------IAARVANLIAVEYIAYNSRLRVEESLKAVDDLKDRADQ
A0A317ZP96      L-MINIAYS--HPDPI------VAAEVANLFAKEFIDYNLKLNIDSSMKAVEDLRIRADQ
A0A7C3I5X9      R-LVDVGVE--HTSPT------KAAAIANTLATEFIDWMAGQRQERTSKMLYFLRNQASG
A0A2D5WGA5      S-IIELRAY--DRDPN------LAQDIAQALAEEYKNHRTSLQKERVKTGIDTLTNRMEK
A0A2E7SSH2      S-IIELRAY--DGDKQ------LAQEIAQALAEAYEEYRQSLQQKRVQAGIDKLKERMEK
A0A349GXM8      NPMVSVAVQ--SRNKD------YTAAFLSLLIDEHREEWQTVQRQARNSAGGMLEQELAR
A0A4P5YP61      R-LIDVSVE--HPNAA------MAALLANSIFKQYVQLSYEQYVSSGLTASQFLVEEAEK
A0A6B2LYM4      L-VVNIIFT--HPDKE------VAAVVANYFAEEYIDFNRNQQIEGSLRAVDDLRSQADQ
A0A6D1VXB3      R-LVQIKFD--SVNAQ------AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQLDS
I0JYY7          R-LVQIKFD--SVNAQ------AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQLDS
A0A4R7S1J2      R-LLDITAT--HGDPI------VARDLAVATAKGVMKWDLEQRSQSVGVANEFLMQEAER
A0A2A2XV69      E-LIQISVL--DQDRN------EASEIANRIAEEYQRRRIGEQQGTVNRSLIQLKDEVAK
A0A651H7X9      L-VISVQYR--HRDPV------LAARVADLFVEEFINLNTQMRIQESLRAVEDLRDRAEQ
A0A4Y8P842      R-LIRICYD--SPNSF------GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQIEL
B3DZK9          R-LIRICYD--SPNSF------GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQIEL
A0A5E6MPC4      R-LVKIRCE--SPSAF------GAAQLANVYAQSFITFGLDRKLEANRYARKFLAGQLET
A0A6N6PKP9      R-LIDITVE--DENPA------LAQKISQLVVSEFMRASSESGAQNSRGAHEFLRQEADR
A0A6N6Z250      S-VLDIGVW--APDRE------LSADIANEIARVYEQNRIAFANTTQNEALGKLQEQLDL
A0A4V1SB02      R-LIDIVAE--ENSPK------KAQALANEVVNQFFLLQGSDKSGVSKDAFVALKAQEED
A0A6N6QEJ2      S-IIEISAY--DQDAA------LAADIANRIAEAYEQDRDLDRNDRLLRGLTTLSNALSN
A0A3C1VB86      R-LIDITVR--NTDPG------LAARLANSLVKNYLGQDALVQSSVNEEAGVFLRREADR
A0A146G2Q9      E-LIHITVF--STDNK------EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVEK
A0A2T6D3Y2      E-LIHITVY--STDNK------EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVEK
A0A6N6P5E3      D-LIQISVL--DQDRQ------EAADLANTIAVEYQKKRIDEQQGWVARSLVQLEDEVNK
A0A2D5VY59      S-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYAD
A0A2D8UZZ4      S-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYAD
A0A353DV86      S-LIEITAY--SQDKE------EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYAD
A0A2E5EPT8      S-IIALTVY--SEDKK------EAAEIANTIAKVYAETREQNRITQVRKGIAKMREKLGE
A0A6J4HTK1      D-LLQISMY--STDPQ------EAADIANKIVAVYQDKRVDEEKEILNRAVASMNEEVGK
A0A6N6PHJ5      A-LIDVQVF--SENPT------DASDLANAVAETYRQWRLEKGQRLGKGGVKALEDQLKI
A0A6M1RXR2      S-IIEIRVI--SEDPQ------EAADIANAVARSYERYRIEQRKKLSMGGIAVLVDRLEE
A0A7C3DXS4      S-IIEIRVV--SEDAQ------EAADIANAIALSYQQHRIEQRKQLSMGGIAVLVERLEE
A0A2V2SDV4      S-LIEIRVT--TDKPE------EAAKLANEIAQAYCDYRVEHRKQMTMGGVDALEKKFTE
A0A2V5PK75      K-FIEIVVY--SENKD------EAARLANAIAEAYQEHRQEQREKLSQGGIDAMEKRLKE
A0A1V6DME1      S-LITIRVF--SQDAE------EAARIANEIAETYKEYRLAQRRELTMGGIRILEDRFQD
A0A3D3DIJ3      S-LIEIVVY--SEKPE------EAARIANAIADAYKTHRQEQRAQLSRGGIKALEERFAE
A0A6I1K583      S-IIEINVY--SKDKA------EAAEIANKIAEVYKASRDELRLRLVDQGLKTLREKLTE
A0A350EWA4      E-LIEITVF--NENKA------MARNIANEIAKVYREWRMNLSDERFQEGFDAINQQLEK
A0A5B5WZ91      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVLRE
A0A2N8HD92      D-LVDVIVS--GPDPK------LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A2N8HIT2      D-LVDVIVS--GPDPK------LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A354EBD3      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A355VEB2      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A2N8IMT3      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
R6K1U5          D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A2N8IWC2      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A2N8I441      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A2N8I3A6      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A410SCC4      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A3R5VEW0      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A411SSG2      D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
B2UKW3          D-LVDVIVS--GPDPK------LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLRE
A0A7C3HWX0      S-LVEIRVF--SRSPA------EAAEIANAIAESYKGWRLTNRMEETYKGIEVLEIELGH
A0A7C4KPD7      T-IIEIRVE--SQKPE------EAAEIANSIAEAYRDYRQRTRLTMVSKGIETLQDELKS
A0A1M6RLZ4      D-LVEIAFV--HSNRE------DVKMITQAIADSYREMRIEDEEKRRTEASYELEKKIQA
A0A354T7G8      D-FVSIDYY--DQDSQ------LAANIANEIAKSYMEQRNNIETEKKQKALTVLQQQISD
A0A2S7U4L6      D-LIEISLRMVKDNRQ------YVKPATEAIALAYSEMRINQETKRRDKTRVELAKKIQK
A0A512MBZ2      D-FVIIEFY--DQDAA------LAADVANAVASSYMTQRIEIDSSQKREALERMQKQIAE
A0A2E8MEZ0      D-FIEITVT--HANPE------DAKEIAEAVSQAYIERRNSTEEGRAQEALEALNQELQD
A0A6B3LBV6      D-IVEIRVR--DTDAD------LAAQIANSLYRAYAEALDDEVNLINAQSTGDLDAQLDE
A0A2E3EC33      D-LIDIEVY--DTDAQ------LAADIANALANAYQARRQNEEKERADTALEKLDTQIMA
A0A2E4GN01      D-LIDIEVF--DTDAQ------LAADLANALAXAYQXRXQNEEKXRADKALEXLXTXIXA
A0A1Z8XU55      D-LIDIEIY--DTDPK------LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQIKK
A0A2E1RQR9      D-LIDIEIY--DTDPK------LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQIKK
A0A2E3ISQ4      D-LIEIEVY--DTDPN------LAADIANAVAKAYKIRRQRVEKERADTALALLDLQIQQ
A0A2D6W6F4      D-LIDIEVY--DTDPN------LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIKS
A0A2D8Z5A8      D-LIDIEVY--DTDPN------LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIKS
A0A4Q2YKS3      D-LISIKVR--HVNKE------DARDVATEVSEAYRQYRNDLEGQEAEKAMEELSKAVRE
A0A6N6P3T8      D-LITISVR--HSDKD------EARDIAAEVARAYKEYRSETENKEGDLALLELKKAVRA
                                                                            

A0A2A2XVF1      LKKKLEESEIKLQRYKEQNQAVSL--------------EE----RQNITVERLRELSSKA
A0A2V5UHJ2      LKERVQQSEAALNSYRKEKGIISV--------------DD----KSNVIIERLLDLNKGL
A0A2V5PST3      LKARLERAEAELNRFRQTHGVVSI--------------EK----GENIVIDRLVDLNRNL
A0A2V5PXM3      LKVKLEQSERAMQEYKEQTKSVSL--------------ED----RQNVVVEKLKELNQKV
A0A1V5QB01      VHEELKRAEERALEFARQNSVIAI--------------QE----RGNVAARILGTLSSQA
A0A7C5LI63      LSQEVKAAQDRYLTYAKEHNLPVL--------------QD----TAASWKQLYSLQLNSY
A0A7C5P291      LSQELKSANDKLLNYAKEHNMAML--------------ER----QEQVYQWKYWQIMNNL
A0A139SU05      LRLESEAKAQRQQEYMQRHNLISL--------------DN----STSIVDSRLLAVNGSL
A0A139SPN4      LRLESEAKAQKQQEYMEKNNLISL--------------DS----STSIVDNRLLTINGAL
A0A1V6E7N1      LRKESEAAALQVQRFMEVHKLVSL--------------DE----STNLVNARLQTVSTEL
A0A2D9MYT1      LSTAVHTNYMALHNFKLEWDIISL--------------ED----SQNTTLQALLKAQTDY
A0A258ANJ7      LQDKLKKSEIAMHDYKRSNQAISL--------------DE----RKDLVLSKLKELGSEL
A0A290QGD9      QRKKVEELATRLQTYRETHKMVSL--------------DQ----RRDMVTETLKARNIIV
A0A1D8AS58      QKKRVEEMAIILQNYREKNQQVSL--------------DQ----RKDIVTEKLKALNAYV
I6AQC1          QRKTVEDLNRQMQAYREKYNMGSL--------------DK----TKDIQTRKLMEQGSLV
W0ITH7          QKKKVEDLNRQMQAYREKYNMGSL--------------DK----TKDIQTRKLMEQGSLV
A0A139TLN4      INEEMGENDLAIENLKKESNILTDL-------------ST----ALTEEYENSLNDKKDL
A0A1G3ZFT0      AKQDLTRAELALNRYHTTSGKIDT-------------------------KLEIKNLIQEI
A0A1Z8ZMT6      RESELETARRRAGTYTPA------------------------------------------
A0A2E8MCT7      RESELETARRRAGSYTPA------------------------------------------
A0A290Q2Z2      QERTVSLQRDMVEQLRKDLGISGVDLNAR---------------YSDMEIETLRQMQNSL
A0A2A2RGK2      LRKKLRVSEEAMQSFRERERAASI--------------ET----MLSSAQSQVGEVSNNQ
A0A2A2XXF7      LRKKMRVSEEAMQSFRERERAASI--------------EN----MLASAQSQIAEILGVQ
A0A2A2R5D6      QGEVVQRAKDYVEELRKSLNLNMVGGG-----------EN----ETQMIEEEWKRKSALL
A0A1J4XH17      QQKVVENIETQMAEYREKYGTVSL--------------EQ----QADIDHQELTEINKTV
A0A3C1VJ32      ESNRIEMLQANVDNLRRTLDINN--GTASSP-------EP----ELTVEQLRSY--QAQK
A0A2N9NTX7      QEASVGKAQSNVDYLRDKLKISDPNSGAEMP-------GP----LLTTESLHRI--EGLR
B9XK55          QDDLIAKQEAKVDKLRKDLKVTDL-GGESAT-------GP----QQTLEPMNVMHYNTLR
A0A4P5YMI6      HEKNIREKQKVVEAIRKDTGITLI--TPEGA-------GA----YNTLATETLRHLDSLR
A0A2E6T482      INKKITGLQGNVDRMRTELGISDA----AGE-------ES----YSIIEPEIVRRYESEL
A0A3C0DQZ7      INKKITGLQGNVDRMRTELGISDA----AGE-------ES----YSIIEPEIVRRYESEL
A0A1Z9CBK5      INEEIGAMQANVDXLRVQLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A2D6ZI96      INEEIGAMQANVDXLRVQLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A358KGZ3      TNDEITAMQANVDDLRAKLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A2E9ZQX4      TNDEITAMQANVDDLRAKLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A3D5JZU0      TNDEITAMQANVDDLRAKLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A2E6HCR0      TDEEISVMQAKVDDLRVKLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A1Z8WN04      TNNEISLMQAKVDSLRVTLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A2D7L1N4      TNNEISLMQAKVDSLRVTLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A2E2R937      TNNEISLMQAXVDSLRVTLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A520QQY4      TNNEISLMQAKVDSLRVTLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A2D5MR66      TNDEISVMQAKVDALRVKLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A2E0PDQ1      TNEEISLMQAKVDSLRVKLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A2E2ZZP9      TNEEISLMQAKVDSLRVKLGISDA----AGE-------DS----YSIVEPEIVRRYESEL
A0A7C4LRK7      KEKEYQKSMDEVKRLREELQVYDI--DPYSG-------RV----LGTLEQETLRRLEAIQ
A0A2A2RGF2      QDALVRTALTNVNQIHQDKGLNVI---HEVG-------GS----VMSLETDTIRALESQL
A0A2G4I5Y6      QDALVRTALTNVNQIHQDKGLNVI---HDGG-------GT----IMSLETDTIRSLESQL
A0A6N6PS97      RSKTVEKLQQKVDGLRKDLGVSDV-----GD-------SS----QVTLEPETMRMFERDR
A0A3M1I883      QNARVERLQKQLDQLRLELNIPDT-VAGTAG-------AY----SISTERERLSTLLQAL
A0A1V6JZ45      QAEAVAKLQDNVDQLRAELNIPDS--INDAS-------VY----QTSLEREKVSAMAQEL
A0A7C7Z746      IENQIDSQQTAVDQLRDELKITDV--SIEGI-------PS----YAFLEPENVKQMEGAK
A0A520RRW5      QQNKVQTKQKDLDKLREDLNISDI-YSAEGS-------SI----GMTTEPQIVMKLEQER
A0A356NPK0      QQNKVQTKQKDLDKLREDLNISDI-YSAEGS-------SI----GMTTEPQIVMKLEQER
A0A2D7B5P5      QQNKVQTKQKDLDKLREDLNISDI-YSAEGS-------SI----GMTTEPQIVMKLEQER
A0A3D3XGB5      QQNKVQTKQKDLDKLREDLNISDI-YSAEGS-------SI----GMTTEPQIVMKLEQER
A0A2V6F8A1      NDEKIKEAEAKVDELRKEYSISDI--SAEGP-------YA----ISTLEPQTVRSLEEQR
A0A2V5TNH4      NEEKVKAAEAEVDQLGKEYKVSNG--SLEGA---------------TLEPQTVRSLEEQR
A0A2V5X5Q6      NDEKVKAAEIAVDQLRKEYKISDI--QPEGA-------YA----YSTLEPQTVRSLEEQR
A0A4P5QM05      KEDEMARLFQEASRIRQDESISDPDP------------DSSNAALSITAPTGIATGETQL
A0A4Q3C001      QRKVVEDAAVLAAKIRQEDGIVDPDI------------ENPTALISGGD-RSIVSSETAV
B4DB23          RRKEMEDTSAVAMQIRAREGIVDSDP------------DKENSVISGGEGGNVLQRQQQV
A0A6B3L938      VALELESAERSFHVYRAA------------------------------------------
A0A2V5URB2      LKDRVQKSEEALNHFRRAKGIISL--------------ND----KENIVVDRLADLNKRL
A0A2V2DJ66      QETKVKELDRRLVEYREKNGAISL--------------DQ----MDDVDRRELQEMNTIL
R7L5A9          QEAKVKELDKKLVEYREKNGAVSL--------------DT----LDDVDRTELRDINAIL
A0A5R8KA81      LAKALADSELALQNYKDERQAVSL--------------EE----KQNIVTEKLRDLNVRL
A0A5B5WU87      ISEEMRKNDLAVEKLKKETNILTDL-------------ST----ALTEEYENSINDKKDL
R7DZW0          ISEEMKKNDLAIEDLKKETDVLTDL-------------ST----ALTEEYENSLNDKKDL
A0A2N8HID1      ISEEMKKNDLAIEDLKKETDVLTDL-------------ST----ALTEEYENSLNDKKDL
A0A2N8HS06      ISEEMKKNDLAIEDLKKETDVLTDL-------------ST----ALTEEYENSLNDKKDL
A0A6N2TNT9      ISEEMKKNDLAIEDLKKETDVLTDL-------------ST----ALTEEYENSLNDKKDL
A0A3R5R2M8      LEKSLNKADKELTDFKAKSDIVKDT-------------ET----TMSADFSSSQVLEKEI
A0A411SUQ6      LGASLSDVDKKLTEFKTKSDIVKDA-------------DT----TMSADFSTSQALEKEI
A0A2N8HZF2      LGAALSDVDKKITEFKTKSDIVKDT-------------DT----TMSADFSTSQALEKEI
A0A354E720      LGASLSDVDKKLTEFKTKSDIVKDT-------------DT----TMSADFSTSQALEKEI
B2UPB6          LGASLSDVDKKLTEFKTKSDIVKDA-------------DT----TMSADFSTSQALEKEI
A0A2V6JLK8      QQKRVEEAGAEMAKIRDEEHIVDLN-------------PEGTEDSQAPVNSIVVKQEAEV
A0A2W5Z1A5      QQKKVDDAAVEVARIRDTEHIIDLN-------------PEGTEDSKTPLDTVVVKQEAEV
A0A2V6EA09      EQKAVSDAAAEVARIRDQEHIIDLN-------------PEGMEDTQTAVNSIVLKQEEGV
A0A2V6GQI7      EQKAVSDAAAEVARIRDQEHIIDLN-------------PEGMEDSQTAVNSIVLKQEEGV
A0A3C1HEJ2      LLETIKTLESLLQEFKKNHPGIS---------------EE----EQAILSKQIGELNQRI
A0A522ULD9      QQDKVNKAEEDLEHIRKDLGVSSVG-------------------GMQIDKMKLQAMQGDL
A0A1V6JU76      LEVDVAKAEEDIQNYRAQVKFVSL--------------DS----SYNIVAEALSQSQAQY
A0A2A2XXW5      KEVELEALQGKLQKYRKDKGMVSL--------------KD----AQNIDAATMRDLKIAY
A0A6N6Q6V0      QEADLTRAIQNLAEYRVRQGALSL--------------DQ----DVNVVYLGYRQAKEVY
A0A1Q6UHJ9      QEAKVKELDKRLVEYREQYKAISL--------------EN----LDDVDRNELRDINTIL
A0A2V2BXR0      QEAKVKELDKRLVEYREQYKAISL--------------EN----LDDVDRNELRDINTIL
A0A2D8V0G3      LADDVRATRLSVFQFREDNQMPSL--------------EE----SQNTLSQALFLASDGF
A0A348S017      LQEEVKNSRLAVFRFREKNKMPSL--------------EE----SQDTVSKALFAASQSH
A0A3C1UUV7      LQEEVKNSRLAVFRFREKNKMPSL--------------EE----SQDTVSKALFAASQSH
A0A350I3V2      LQEEVKNSRLAVFRFREKNKMPSL--------------EE----SQDTVSKALFAASQSH
A0A520RGV5      LQEEVKNSRLAVFRFREKNKMPSL--------------EE----SQDTVSKALFAASQSH
A0A3D3XF90      LQEEVKNSRLAVFRFREKNKMPSL--------------EE----SQDTVSKALFAASQSH
A0A2D7B522      LQEEVKNSRLAVFRFREKNKMPSL--------------EE----SQDTVSKALFAASQSH
A0A356NIC2      LQEEVKNSRLAVFRFREKNKMPSL--------------EE----SQDTVSKALFAASQSH
A0A2N8HDG3      VGADLKQVDQKMDDIKIKNDIIADT-------------EA----SISADFNAAQTLDNSI
A0A146GCJ0      LKVKLEASERKLQAYREDNKAVSL--------------EE----RQNIIVEKLRELNSKV
A0A2T6D6H8      LKAKLETSERKLQAYREQNKAVSL--------------EE----RQNIIVEKLRELNTKV
A0A3D1TI55      QKFKVRELEDNVEDLRLQNQIVFG--------------AT----GAELSKERLDQLQLEL
A0A3E1ET42      SENDLEAARIVMNEVARKHGIV---DNSYQG-------GQGFTAVVTTKPEEYADSLRSQ
A0A2A2YDW8      HSDVVEEKRKQRDNLQRRA--PSV-VRDFLT-------GN----AGNGYQSMQANVESQV
A0A352XLN9      HSDVVEEKRKQRDNLQRRA--PSV-VRDFLT-------GN----AGNGYQSMQANVESQV
A0A3D0YP62      KSDRVAELRKRLMDIAEKVGVIWV-ESERGG-------ET----IG-GELELRQLAERQL
A0A3D3DV47      KSDRVAELRKRLMDIAEKVGVIWV-ESERGG-------ET----IG-GELELRQLAERQL
A0A2E5XJ49      QEDLVEDKRRHFHTIVKAVGVPYI-EGVFPS-------GR----MGQSEEEILKMAVMQQ
A0A2E6SBY8      QEXLVEDKRRHFHAIVKAVGVPYI-EGVFPS-------GR----MGQSEEEILKMAVMQQ
A0A2E5QMS4      QEDLVEDKRRHFHSIVKAVGIPYI-EGVYSS-------GR----MGQSEEYILKSAEMQQ
A0A2E7YXQ3      QEDLVEDKRRHFHSIVKAVGIPYI-EGIYSS-------GR----MGQSEEYILKSAEMQQ
A0A2E3H787      QEDLVEDRRRHFHAIVKAVGIPYI-EGIXTS-------GR----MGQSEENILKTAEMQQ
A0A2E7AGN1      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILKTAEMQQ
A0A2E7AKY7      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILKTAEMQQ
A0A3D4CU34      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILKTAEMQQ
A0A2E8M146      QEDLVEDKRRHFHAIVKAVGIPYI-EGVLTS-------GR----MGQSEEAILKSAEMQQ
A0A355S8S2      QEDLVEDKRRHFHAIVKAVGIPYI-EGVLTS-------GR----MGQSEEAILKSAEMQQ
A0A2D6DVN8      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILRTAEMQQ
A0A3C1W2R2      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILRTAEMQQ
A0A2E3NAY6      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILRSAEMQQ
A0A2E3II01      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILRTAEMQQ
A0A368B8C5      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILRTAEMQQ
A0A3R7RBB5      QEDLVEDKRRHFHSIVRAVGIPYI-EGVLTS-------GR----MGQSEETILRTAEMQQ
A0A2A2QX62      QKDLVEDKRKLLSQIIRQEGIIYQGDSSVFQ-------GT----SGFDKADEAETAAREY
A0A4Q3BWH6      QEDLVEDKRKLLSQIIRTENIIYWGDPSVSQ-------GA----RGFTKADDAENAAKVY
A0A3N5WCF1      QEDKVEERRKVLATIVRNKGIIYRGQDAFY--------ES----GGVDEDQGARNALQIY
A0A4Q3C1K5      QEDKVEERRKVLATIVRTKGIIYKGQDSFY--------GQ----SGVDEDQEARDAMQTY
A0A3R8IT45      QKKKVEELQFQMQAYREKYGL-TL--------------DP----KKDILTKKLVEQGSVL
A0A2A2PYE8      QQKRVERMARELQEYKEKNNMVSL--------------DQ----RKDIVSESLKAINAEK
A0A2T6CN73      QRKLVERLASELQRYKEQHKMVSL--------------DQ----RKDIVSESLKAINLEV
A0A2G4G428      VEDKIRKLYDKRNELIKGQKLLSI--------------AK----DTNTLTAERAALVRAR
A0A6N6PCD8      LKERLAKSEQTLQEYREKHGTVF---------------ND----KQDVTLDYLKQLNIKL
A0A139TV24      IGEELKRLDSERDDIKFENDIIADT-------------QA----SLSADFSTAQTLDNSI
A0A2N8HT11      IGADLKEVDQKMDDIKIKNDIIADT-------------EA----SISADFNAAQTLDNSI
R7DS70          IGADLKEVDQKMDDIKIKNDIIADT-------------EA----SISADFNAAQTLDNSI
A0A2N8HNL6      IGADLKEVDQKMDDIKIKNDIIADT-------------EA----SISADFNAAQTLDNSI
A0A6N6PAZ1      ARSSIQAARGALSLYART------------------------------------------
A0A6I1K459      IKERLLKAERSVQQYLATNNISL---------------QQ----GQDILTEEFRTLSENC
A0A139TUL1      LGGQLGGVDKQVIDYKRHSRIVKDM-------------ST----TLEATFSKLQEIGTEL
A0A2N8HCB0      LGGQLGGVDKQVIDYKRNSRIVKDM-------------DT----TLDATFNRVQEIGTEL
A0A2N8HP04      LGGQLGGVDKQVIDYKRNSRIVKDM-------------DT----TLDATFNRVQEIGTEL
A0A2N8HRJ0      LGGQLGGVDKQVIDYKRNSRIVKDM-------------DT----TLDATFNRVQEIGTEL
A0A6N2U9Y7      LGGQLGGVDKQVIDYKRNSRIVKDM-------------DT----TLDATFNRVQEIGTEL
A0A366HAG0      KELQAKQSMERMIQLKKDLDLVTLPTSMDAKGAQ----DD----VMTPESAMLLDTQRDV
A0A2U8DZK4      QEKIVIAQRDTVERLRAELSISGIDLTN----------PR----NNSMEIERLRQMQSTL
A0A2T6DFL8      QEQAVTRQRDAVEKLRKELNISGVDL-N----------AR----YSDMEIETLRQMQNTL
A0A1D8AWD4      QELAVTTQRDHVEKLRKELDIAGVDL-S----------QR----YSDMDIETLRQMQNSL
A0A4Q1C9S2      QEQAVTDQRDHVEKLRKELDIAGVDL-S----------QR----YTDMDIETLRQMQNSL
A0A178IH18      QERAVATQRDLVEKLRAQLNISGVNLVT----------PQ----GGDIEIETLRQMQNTL
A0A2T6DT99      QEKVVTSQRDLVEKLRKDLNISGVDL-S----------AR----YSDMEVETLRQMQNSL
A0A1G3ZT33      QEEVVSKQRDLVEKLRRDLNISGVDL-N----------AR----YSDMEIERLRQMQNSL
A0A3E1E2T2      QEQVVMLQRDTVERIRKDLNISGVDL-N----------AR----YSDMEIETLRQMQNSL
B1ZMW1          QEQVVSAQRDTVERLRKDLNISGVDL-N----------AR----YSDMEIETLRQMQNSL
A0A3M1I8A3      MEREVTELEEAVQQYREKQNFVSF--------------DA----GSNPVAQSLSQVQARY
A0A4V0XS84      MKVKVDRDEEAVHKFKEGHQVVSF--------------DE----TENVVLLALKQRQLDL
A0A351WE84      QQEKVDQAESELERIRQEVGVSFL--------------GQ----GFRADKVRLQQLEADR
D5ENH7          QKERVEELELELAEYREEHNAVSL--------------DS----QENIAREQLGSLNQIK
A0A0R2XQ77      QKERVEELELKMAEYREDNNAVSL--------------DS----QENIAGTQLSTLNTIK
A0A2E9IN28      QKERVEELELKLAEYREENNAVSL--------------QS----DENIAGAQLARLNEIK
A0A6N4WTJ5      QKERVEELELKLAEYREDNNAVSL--------------DT----SENIASAQLASLNEMK
A0A1V5QDZ6      QQEKVEKSEEELERIRKDLGVSVL--------------SQ----GVRADKLRLSQMEADR
A0A4Y8P964      MRKKLALAEERLANFTEQTGIVKFP-------------GV----DRSPAEQELNRVSEAM
A0A3D4HF88      QRSEVEALETRLAEYKERTGSISV--------------EE----REDIDLQEIMQLNQVL
A0A6N6ZHN8      QSERIKDIERRLADFKQKNGTISV--------------DE----RQNIAREQLTSLNNQK
A0A351MR11      LEERLNRLYLDKNELVGRERMLAI--------------VK----DTNTLGSERGALVKDR
A0A6G6K641      LKEKVSRSQLALQEFRERTGLVSL--------------EK----DQDIVVTRFKQLNERL
A0A5B5WI95      LEKSLNKAGKELTDFKTKNDIAGNA-------------ET----TISADFSSAQALEKEI
A0A2N8I9W1      LGAALSDVDKKITEFKTKSDIVKDT-------------DT----TMSADFSTSQALEKEI
A0A4Q5IH27      LGAALSDVDKKITEFKTKSDIVKDT-------------DT----TMSADFSTSQALEKEI
A0A2N8IBZ6      LGAALSDVDKKITEFKTKSDIVKDT-------------DT----TMSADFSTSQALEKEI
A0A2N8IJW9      LGAALSDVDKKITEFKTKSDIVKDT-------------DT----TMSADFSTSQALEKEI
R6J100          LGAALSDVDKKITEFKTKSDIVKDT-------------DT----TMSADFSTSQALEKEI
A0A1V6J089      QQERVEEAEAELERIRQERGIALIGRGLMSIRVESTR---------------LNALENER
A0A3C1BZR1      QQERVEEAESELERIRQERGISLIGRGNMSIRVEATR---------------LNMLEGER
A0A7C4KLL2      LKKKLEESERNLQKYREEAGIVSL--------------QQ----SQDVLAPQLRELAAKV
A0A1H6KPB7      RENELLAKTDTLRKYMTTSDYIGLLSDTGNTI------PT----TVNNEEAVLTERRNKL
A0A2E9ISN4      VLEDLEQAKQDLETFERENQILFE--------------KE----RADMDIAFVNQLLARL
B9XAX1          LKQKVEMSERNLQAYKESNKTVSL--------------ED----RQNIIVEKLKGLNQKY
A0A5R8KKM9      KEQLAQQARNKMFAVKKDLGIIELPGDNRATGQ-----DV----IDTVESATLIDRERDI
A0A139TS01      QEDIVNDKMMALKKLIVENDYLPSTMYRSGDNRSVMT-GA----MEDED---FRNSKAQL
A0A3E1EJT7      QRKRVDEIANSLLAFRQRGNLISL--------------VQ----SKDIVTEKLKALNMMG
A0A317ZP96      QKDRVEELEFKLADYREQKNAVSL--------------DS----QENIAREQLGSLNTMK
A0A7C3I5X9      LEGEVSQAETDLHNYRMRTKYVS---LEKGDSIIAEA---------------LSQSQTRY
A0A2D5WGA5      INIEITGMQGRVDRLRTDLGISDAAGEESYSIIEPEI---------------VRRYESEL
A0A2E7SSH2      TNEEISSMQSNVDALRAKLGISDAAGEDSYSIVEPEI---------------VRRYESEL
A0A349GXM8      LDQKIRTAEDDLIEYQRLHDIARVEARGTMESRHLSALME----RRNQLTTELMLLEAQY
A0A4P5YP61      LKKKMLSSEKALQTYREKVGSAAISLDDKKDIVGQK----------------LKEMSKKV
A0A6B2LYM4      QLAKIKEMEMRLADFKEKYDTLSVDRSQDIDNQQ------------------LISLNTRL
A0A6D1VXB3      MRKKLALAEEKLATFTEQTGIVKFPGVDRSPAEQE-----------------LNRVSEAV
I0JYY7          MRKKLALAEEKLATFTEQTGIVKFPGVDRSPAEQE-----------------LNRVSEAV
A0A4R7S1J2      LRKKVELSEQALQKYRVENNAVSLE--------------E----NQNLVVSQLQDISSKL
A0A2A2XV69      QSRRVDELRAEAQRIRIENEIQDLNPDSVVDPMQAAN-EV------------LLSVEQQV
A0A651H7X9      QRKVVEDLELRLQAFREDANMISLD--------------Q----RRDIVTEKLKMLNMML
A0A4Y8P842      MKKKVTESEAKLARFMEKTGIVKLPGINSSPTEKE-----------------LAQVGDAL
B3DZK9          MKKKVTESEAKLARFMEKTGIVKLPGVNSSPTEKE-----------------LAQVSDAL
A0A5E6MPC4      LRKKVAQSEERLADFMAETGIVR-----------------------------VSQMDKSP
A0A6N6PKP9      LKLTLAKSEQALQRYKEQNQAVSLE--------------E----KQNIVVERLKDLNTKV
A0A6N6Z250      QDARVQEQRDKVEALRQELGLAGYELDRRDAAQPEVE-A-------------LRQLERTL
A0A4V1SB02      LRKKMAESDNALADYRQQHKAVSLD--------------E----KSNVLADRVKDLNNQV
A0A6N6QEJ2      LEEQVRVAQTNVDHLRMFLKVPDAA----------ET-PS----LVSLNTQTMAKLELSR
A0A3C1VB86      LKKKLEASDQALQDYRKQVGSVSLEQS-------------------------QDVITPQL
A0A146G2Q9      QQAIVTKLQETMTRIRQETGIQDLNPDTADGGTQAEN-SI------------LLQVEQQV
A0A2T6D3Y2      QQAVVTKLQDTMTKIRQETGIQDLNPDTADGGTQSEN-SI------------LLQVEQQV
A0A6N6P5E3      QRKKTEDLRDEMTRIRLEAKINDLNPESMEDPRMAEE-NI------------LVADEATV
A0A2D5VY59      QNEKVRLKQADLDQLREELNISDIYSAEGSSIGMTTE-PQ----I-------VLRLEQER
A0A2D8UZZ4      QNEKVRLKQADLDQLREELNISDIYSAEGSSIGMTTE-PX----I-------VLRLEQER
A0A353DV86      QNEKVRLKQADLDQLREELNISDIYSAEGSSIGMTTE-PQ----I-------VLRLEQER
A0A2E5EPT8      ASNSVVQAQADVQRVREELKFDVIM-ETPGKVALALD-SE----R-------VRALEMLN
A0A6J4HTK1      QQKKVDESAAEVARIREAEGIIDLNPEGTEDAQTPVN-TI------------VMEQEKML
A0A6N6PHJ5      EDEKIAKVKDELDKIRVENKISDVDTAGTAPMMLSES-EE------------FRRYLSSR
A0A6M1RXR2      HQKRIDETQRELDRLRRELQISDVDAAGTGPSLLLES-ET------------VRRMEALR
A0A7C3DXS4      HQRRIDETQKELDRLRRELEISDVDAAGTGPSLLLEA-ET------------VRRLEALR
A0A2V2SDV4      QQGKVSEAQSNVDVLRFKLQISDPVVTENTPGTLMTG-DT------------LRRFESLR
A0A2V5PK75      QEEKVAKKAEEVEKLREELQVPDSMSLEAAPVQLLSA-ET------------IHKVESLR
A0A1V6DME1      QEKKVQAAQREVDELRAKLEISDADAAGTSPTTLLEA-EV------------LRRLKAQQ
A0A3D3DIJ3      QEAKVKAAQERVDNLRKELNISDAMASGDGPSPLMTA-ET------------LRKIESLR
A0A6I1K583      HHGFVEVAKSNVNQILKDKGII----LTMDTPGMIGT-LD----IDT-----MRAMEQEN
A0A350EWA4      AESDLKESEAEVNRLRASLEITDIDEASSRNEQFF-------------DMQTIQQFRNKH
A0A5B5WZ91      QEDIVNDKMMALKKLIAENDYLPSTMYRSGDNR-VMT-GA----MEDED---FRNSKAQL
A0A2N8HD92      QEDTVNEKMMALKKLIAESSYLPTT-WRNGENRNTLT-AG----MEEED---FRNAKSQA
A0A2N8HIT2      QEDTVNEKMMSLKKLIAESSYLPTT-WRNGENRSTLT-AG----MEEED---FRNAKSQA
A0A354EBD3      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A355VEB2      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A2N8IMT3      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
R6K1U5          QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A2N8IWC2      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A2N8I441      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A2N8I3A6      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A410SCC4      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A3R5VEW0      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A411SSG2      QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
B2UKW3          QEDAVNEKMMALKKLIAESSYLPTS-WRNGEHRSTLT-AG----MEEEE---FRNAKAQA
A0A7C3HWX0      QSNRVAELRRKLDDTRAKLSIPE----GAGERVSYSA-SL----ERE----MVNSLAAQL
A0A7C4KPD7      KEQEYSVKESNVVQLRKSLEINDID-PYSGRVYGTLD-SE----TIRRLDAVHVDAQARY
A0A1M6RLZ4      QEDLVADHRNRLATMSQKTGI-----PYAGDKNSIGA-GS----NPAELNFRENERLYQE
A0A354T7G8      QEELRRLAQVRSQEARRKAGIVGDW-IAGGGSSLNPG-GE----MRSEKDSMVISREQAL
A0A2S7U4L6      YEDIVEDYRTRLLEFSAKTGIYSLD-RSSGGATDVVR-RD----LQQENMLYDEAVKARD
A0A512MBZ2      QESLRDQARAKMLEAKKKAGIVGDW-IAGGGPSITPG-VS----LATSKDGMVASREQAM
A0A2E8MEZ0      QGDLVQDYRKALTVLIQQYGIPY---FDGRD-----S-GQ----VGQAEELMYRRAQEKL
A0A6B3LBV6      QSEKVSEARIKMHNAMRELKVID---VGKG---FYYS-DE----VVTPEDRIIQTGQERL
A0A2E3EC33      QMTRLEKARDMMINLMEELNIVD---LSLGEPTWLRG-SQ----PNTGIASLVMTAKQKE
A0A2E4GN01      QMTXXEXSRDMMIGLMXELNIVX---LSLGEPTWLRG-SQ----PXTGXASLVMTAKQKE
A0A1Z8XU55      QEGRLEAARNNMIELMEELNIVD---LSLGEPVWLRG-SQ----PNTGTASLVLAAKQRE
A0A2E1RQR9      QEGRXEAARNNMIELMEELNIVD---LSLGEPVWLRG-SQ----PNTGTASLVLAAKQRE
A0A2E3ISQ4      QEKRLEDARSVMIKLMEDLNIVD---LSLGEPVWLRG-SQ----PNTGTASLVMAAKQRE
A0A2D6W6F4      QEGRLEKARNNMIELMEELNIVD---LSLGEPVWLRG-SQ----PNTGTASLVMAAKQRE
A0A2D8Z5A8      QEGRLEKARNNMIELMEELNIVD---LSLGEPVWLRG-SQ----PNTGTASLVMAAKQRE
A0A4Q2YKS3      QEDIVAERRKALSNIVREKEII-----YRGSESIFGN-TG----VFEDDSARSAADAFAK
A0A6N6P3T8      QEDIVEERRKVLANIVRAKGII-----YYGQDSYYRN-AN----TEDDNGAKSAQETFTQ
                                                                            

A0A2A2XVF1      TEAKSERLRLESDIEQVRKVPANNTDELLRIGSVATIP----------------------
A0A2V5UHJ2      TAAEGDRIAWEAQVRAARG----RNADEVPSVRNSAVI----------------------
A0A2V5PST3      TTARAQRLEAESLNSVVQN----KSTQYLSQVLTQGMI----------------------
A0A2V5PXM3      TEAKSLRILHETSYNQALQFSNNPAALLFLPAVANDPT----------------------
A0A1V5QB01      AQFRTQKMFLEAQQPLLSR----ASDEAVLAALGPAGSGI--------------------
A0A7C5LI63      VKLRHALELAKAKETALEK-SDTSAFIALVNQPPAAPATETTATPPTTPVPAPG------
A0A7C5P291      GKATVELAEAKTRKQMLDSGTDTATLLALLTPAATQPA---VVSPPAAEEPAENQPLTAG
A0A139SU05      TQARLRLLEVESLAKQVDDYQEAGANLLEITYIGNYNT----------------------
A0A139SPN4      TAARLRLLEVESIAKQVADYQESGDNLLEITYIGSYGT----------------------
A0A1V6E7N1      TRVRLARLELESQVKQIETYQAEGRNLFEISSIATYDQ----------------------
A0A2D9MYT1      DAAHSRAVEAQASADEAQRVFTETGEFGTIPDVAADAE----------------------
A0A258ANJ7      NQQSKERLTLETQLQACKEGTLPRDELLSLPSIASHPK----------------------
A0A290QGD9      TQTNARFKDAEVRWKQIQELRAAGRDLTELSFIAIQPI----------------------
A0A1D8AS58      TQTTSRLNEAEVRWRQVQERKATPALLLELPFIASQSL----------------------
I6AQC1          TQSGARLSEATVRWQQVDERLKNNGDLLELPFIASNPL----------------------
W0ITH7          TQSGARLSEATVRWQQVEDRIKANGDLLELPFIANNQL----------------------
A0A139TLN4      RELTLEIKSIEYLKEYLEK----EAEFDSRLVPINSKI----------------------
A0A1G3ZFT0      MVIEKQLINLRMTKHEMFYQ----------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      IALSVDAIGRKTRYERFKS----IPAEDRINLINSELI----------------------
A0A2A2RGK2      SLIQRRIEQIDSDLAVIRANTGEPEELLTLPSVAAEPK----------------------
A0A2A2XXF7      NEIQKRIQQIESDLAVVRTNTGSVEELLFLPSVAAEPK----------------------
A0A2A2R5D6      DDVRAEYLGRQVRYERLNR----LSTNEFLDAIVAMGI----------------------
A0A1J4XH17      TDARRDFDIAQSRKNLVDQYIKSGGKLWDLSFINSIPQ----------------------
A0A3C1VJ32      LESEQAYNVSLVQLQDLQTIQQT-NQSKLRDVLPGVVS----------------------
A0A2N9NTX7      IESSAELVKMETLLSKLEELQRT-NPAALIQTIPITAP----------------------
B9XK55          IDAETQYIKEEKLLSQLKQLKSD-E---LKQAIPTAAP----------------------
A0A4P5YMI6      NTAHLEFIEKDTRLAALRKIPRN----EIKEVIVTVYP----------------------
A0A2E6T482      ITAKGIHTTQATLLEGLKAQSRE----ELRASILTAHP----------------------
A0A3C0DQZ7      ITAKGIHTTQATLLEGLKAQSRE----ELRASILTAHP----------------------
A0A1Z9CBK5      ITAKGLYTQQATLLQGLQEQSVE----ELRESIMTANP----------------------
A0A2D6ZI96      ITAKGLYTQQATLLQGLQEQSVE----ELRESIMTANP----------------------
A0A358KGZ3      ITAKGLYTQQATLLQGLQEQSLE----ELRESIMTANP----------------------
A0A2E9ZQX4      ITAKGLYTQQATLLQGLQEQGLE----ELRESIMTANP----------------------
A0A3D5JZU0      ITAKGLYTQQATLLQGLQEQSLE----ELRESIMTANP----------------------
A0A2E6HCR0      ITAKGLYTQQATLLKGLKEQSFE----NLRESILTAYP----------------------
A0A1Z8WN04      ITAKSLYTQQATLLQGLKEQGDE----ELRNSILTAYP----------------------
A0A2D7L1N4      ITAKSLYTQQATLLQGLKEQGDE----ELRNSILTAYP----------------------
A0A2E2R937      ITAKSLYTQQATLLQGLKEQGXE----XLRNSILTAYP----------------------
A0A520QQY4      ITAKSLYTQQATLLQGLKEQGDE----ELRNSILTAYP----------------------
A0A2D5MR66      ITAKSLYTQQATLLQGLQEQSSE----ELRNSILTAYP----------------------
A0A2E0PDQ1      ITAKSLYTQQATLLQGLQDQDSE----ELRNSILTAYP----------------------
A0A2E2ZZP9      ITAKSLYTQQATLLQGLQDQGSE----ELRNSILTAYP----------------------
A0A7C4LRK7      IEAHADFVQMEKLYSSLTNLSRA----EFKRAIQTANP----------------------
A0A2A2RGF2      IEIRGLFTKKQTSVVELKKLKPE----QLRNVLGPPVV----------------------
A0A2G4I5Y6      TDIRGIYIKKQTSFVELKKLKPE----QLKNALGPPVV----------------------
A0A6N6PS97      VNAKQMFAQTKTLHDELSGMTRP----ELRRVIPVSAP----------------------
A0A3M1I883      QQARSDLVYWKSKLQELERIRDK-GLQDLRDAILTVMP----------------------
A0A1V6JZ45      TRAHSEYVYFLTKLEDLKKLDRT----SMREAVLVTMP----------------------
A0A7C7Z746      TRAQLEYEFAKARLNLLINKTPE----DLEVVLLTIQA----------------------
A0A520RRW5      TVAEANLIRYETLFKELTSLTLE----ELRNTLLTAMP----------------------
A0A356NPK0      TVAEANLIRYETLFKELTSLTLE----ELRNTLLTAMP----------------------
A0A2D7B5P5      TVAEANLIRYETLFKELTSLTLE----ELRNTLLTAMP----------------------
A0A3D3XGB5      TVAEANLIRYETLFKELTSLTLE----ELRNTLLTAMP----------------------
A0A2V6F8A1      IRAEAEFSGLAGMLNGLLQLRADKGDAELRKSILTAMN----------------------
A0A2V5TNH4      IRVEAEFSGLAGLLNGLLKLREEKGNTELRKSILTAIN----------------------
A0A2V5X5Q6      IRVEADYSGLAGLLNGLLKLREEHGDSELRKSILTAIN----------------------
A0A4P5QM05      AETRALVDRLRSQLMRVEK----LKPEELMEAARILGI----------------------
A0A4Q3C001      NEARNKTEELRTKLRQIES----LKADELLEVLRTLNI----------------------
B4DB23          NEQQIKVVELERQLEMINS----LSPEQLQDALKTLGI----------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      TEAEAERIGLEAQARLIKR-----RDYDSLPAVISNSL----------------------
A0A2V2DJ66      TTDKRTYDAAAIQWSLLQEYKRDGRDLCTLPFIADLPI----------------------
R7L5A9          TNDKRIFDAASTQWTLMQEYKRDGKDLCTLPFISEFQQ----------------------
A0A5R8KA81      TQSKTDRIRLENDREQVKTAGNDLYKLLSIPSIANQRA----------------------
A0A5B5WU87      RELALEIKSIEYLKQYLEE----EAEHDAKLVPINSKI----------------------
R7DZW0          RELELEIKSIEYLKDYLEQ----EAEHDARLVPINSKI----------------------
A0A2N8HID1      RELELEIKSIEYLKDYLEQ----EAEHDARLVPINSKI----------------------
A0A2N8HS06      RELELEIKSIEYLKDYLEQ----EAEHDARLVPINSKI----------------------
A0A6N2TNT9      RELELEIKSIEYLKDYLEQ----EAEHDARLVPINSKI----------------------
A0A3R5R2M8      FELETQIKLSSVLADNLKE----AGRNGGLISVDTGLT----------------------
A0A411SUQ6      FDLETQIKLASTLADNLKE----SERKHGLISVETGLP----------------------
A0A2N8HZF2      FDLETQIKLAAILADNLKE----TERKQGLISVETGLP----------------------
A0A354E720      FDLETQIKLASTLADNLKE----SERKQGLISVETGLP----------------------
B2UPB6          FDLETQIKLASTLADNLKE----SERKHGLISVETGLP----------------------
A0A2V6JLK8      NDAETKVTTLSSKLAQIEN----LKGDDLMRMLPTLDV----------------------
A0A2W5Z1A5      NDVEAKVATLQSQLSQIEH----LKGEDLMRMFAALNI----------------------
A0A2V6EA09      NEAEMTIEALGSRLEQIRK----LKGEELMRMLATLNI----------------------
A0A2V6GQI7      NEAEMTIEALGSRLEQIRK----LKGEELMRMLATLNI----------------------
A0A3C1HEJ2      AASEFNAQSLDRDLSRMTG----LGQNVPLLVTMPVVS----------------------
A0A522ULD9      IAARVDMLVRKSRLDQIQN----LDGENLLSASQFIVG----------------------
A0A1V6JU76      AMAKAQAQTTQTIVEELDRHIQAGNPLETFPKIAADGK----------------------
A0A2A2XXW5      ETLRSTADVAKQIAQQAQEWVAAGKDITDFAPLAKDEQ----------------------
A0A6N6Q6V0      EAQRARADAAEKLAEEAKGWRKSGRDLADFPEVAKDQV----------------------
A0A1Q6UHJ9      TSDKRAYDAASTQWNLVQEFKRDGKDLADLPFIAELPQ----------------------
A0A2V2BXR0      TSDKRAYDAASTQWNLVQEFKRDGKDLADLPFIAELPQ----------------------
A0A2D8V0G3      QKASDEAAQAVKVVETVDNLIAEAEADSRTLDLSVLPY----------------------
A0A348S017      QLANDEAEQAQKAIDEVDKMIREAGESGQLLDLSQIPF----------------------
A0A3C1UUV7      QLANDEAEQAQKAIDEVDKMIREAGESGQLLDLSQIPF----------------------
A0A350I3V2      QLANDEAEQAQKAIDEVDKMIREAGESGQLLDLSQIPF----------------------
A0A520RGV5      QLANDEAEQAQKAIDEVDKMIREAGESGQLLDLSQIPF----------------------
A0A3D3XF90      QLANDEAEQAQKAIDEVDKMIREAGESGQLLDLSQIPF----------------------
A0A2D7B522      QLANDEAEQAQKAIDEVDKMIREAGESGQLLDLSQIPF----------------------
A0A356NIC2      QLANDEAEQAQKAIDEVDKMIREAGESGQLLDLSQIPF----------------------
A0A2N8HDG3      FELQTQMKLADGLKESLNA----LGQKAGLISLDTGIA----------------------
A0A146GCJ0      TEAKSKRLQLEADIDQLKR----VEKGNLDALLAINSV----------------------
A0A2T6D6H8      TEAKSKRLQLEADIEQLKR----VEKANVDELLSINSV----------------------
A0A3D1TI55      ERARLDLWTAEAQLQKVES----LEGKQLEDAIPFLVN----------------------
A0A3E1ET42      GVLEQQVIRLRSQLESLMK----LEGDQLIANAASLDV----------------------
A0A2A2YDW8      EAAKTTLAELDSMIASIDR----LSADEVIRYAANLEV----------------------
A0A352XLN9      EAAKTTLAELDSMIASIDR----LSADEVIRYAANLEV----------------------
A0A3D0YP62      YEAERERDQLKFQIDKLLA----VADEDLPGLAA--DL----------------------
A0A3D3DV47      YEAERERDQLKFQIDKLLA----VADEDLPGLAA--DL----------------------
A0A2E5XJ49      FEHEKSKRQLENQINQLVN----LKNEELMNFAEGLKL----------------------
A0A2E6SBY8      FEHEKAKRQLENQINQLVS----LKNEELMNFAEGLKL----------------------
A0A2E5QMS4      FGAEERKAELENQIQQLLT----LRDDELIDFAEGLKL----------------------
A0A2E7YXQ3      FGAEERKAELENQIQQLLT----LRDDELIDFAEGLKL----------------------
A0A2E3H787      FAAEXKKXXLENQIERLLT----LKDAELIDFAEGLQL----------------------
A0A2E7AGN1      FTAEEKKGQLENQIEQLLT----LRDEELIDFAEGLQL----------------------
A0A2E7AKY7      FTAEEKKGQLENQIEQLLT----LRDEELIDFAEGLQL----------------------
A0A3D4CU34      FTAEEKKGQLENQIEQLLT----LRDEELIDFAEGLQL----------------------
A0A2E8M146      FTAEEKKGQLENQIEQLLT----LQDEELIDFAEGLQL----------------------
A0A355S8S2      FTAEEKKGQLENQIEQLLT----LQDEELIDFAEGLQL----------------------
A0A2D6DVN8      FTAEEKKGQLENQIAQLLT----LRDEELIDFAEGLQL----------------------
A0A3C1W2R2      FTAEEKKGQLENQIAQLLT----LRDEELIDFAEGLQL----------------------
A0A2E3NAY6      FTAEEKKGQLENQIAQLLT----LRDEELIDFAEGLQL----------------------
A0A2E3II01      FTAEEKKGQLENQIAQLLT----LRDEELVDFAEGLQL----------------------
A0A368B8C5      FTAEEKKGQLENQIAQLLT----LRDDELVDFAEGLQL----------------------
A0A3R7RBB5      FTAEEKKGQLENQIAQLLT----LRDDELVDFAEGLQL----------------------
A0A2A2QX62      DRLDREKIQLESQIETLLK----YDGAQLLAHASGLSL----------------------
A0A4Q3BWH6      VETEQEKIQLESQIETLLK----YDGPQLMNYASGLSL----------------------
A0A3N5WCF1      HDIEQEKLQLESQISSLLK----YDSDQLMVYAGGLNL----------------------
A0A4Q3C1K5      SQLQQEKMQLASQINSLLK----YDSDQLMVYAAGLDL----------------------
A0A3R8IT45      TQTQSRLGEAEVRKNQVEARIKAGGDLTELPFIAANHL----------------------
A0A2A2PYE8      TRAQIAMNAAEGRINQIKEVRQRSGDLTELPFIASQPQ----------------------
A0A2T6CN73      ARASIALNAAENRRNQVAELKARGGNLTELPFIATQAT----------------------
A0A2G4G428      EDTRKAIDEMEIIWRLIGE----YKQTGKDLYDVAQVR----------------------
A0A6N6PCD8      EEARSNRIKIESDLPILRK-AQTLPPEELLAIQSVSGL----------------------
A0A139TV24      FELQTQIMLANDLENNLKA----VSKKAELISLDTGIA----------------------
A0A2N8HT11      FELQTQMKLADGLKENLDA----LGHKAGLISLDTGIA----------------------
R7DS70          FELQTQMKLADGLKENLDA----LGHKAGLISLDTGIA----------------------
A0A2N8HNL6      FELQTQMKLADGLKENLDA----LGHKAGLISLDTGIA----------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      TAAKTERLVMETDYEMTKRVGSKVSELLTLVSIARTPE----------------------
A0A139TUL1      FSTRTELIQVKVLAGLLAE-----GGRERDMIPANIGI----------------------
A0A2N8HCB0      FSTRTELIQVKVLARLLAD-----RSRQQDMIPANIGI----------------------
A0A2N8HP04      FSTRTELIQVKVLARLLAD-----RSRQQDMIPANIGI----------------------
A0A2N8HRJ0      FSTRTELIQVKVLARLLAD-----RSRQQDMIPANIGI----------------------
A0A6N2U9Y7      FSTRTELIQVKVLARLLAD-----RSRQQDMIPANIGI----------------------
A0A366HAG0      ATLQKQVRDLKAQHDQMMT----LEGDELIRLAGEMKV----------------------
A0A2U8DZK4      VALTVDANSLKTRYESFRD----IPPDKRLSLVNAQLI----------------------
A0A2T6DFL8      IALSVDAIGRKTRWERFKS----IPAGERQSLVNSELI----------------------
A0A1D8AWD4      IALRVDAIGRKTRWERFRN----IPAADRRNLVNSELI----------------------
A0A4Q1C9S2      IALRVDAIGRKTRWERFRG----IPTADRRNLVNSELI----------------------
A0A178IH18      VALRVDAIGRRARYENFKK----IPEADRANLVNSELI----------------------
A0A2T6DT99      IALSVDAIGRKTRYERFKS----IPPEERLNLVNSELI----------------------
A0A1G3ZT33      IALRVDAIGRRTRWERFKN----IPAGERVTLANSELI----------------------
A0A3E1E2T2      IALSVDAIGRKTRWERFKD----IPFEERVSLVNSELI----------------------
B1ZMW1          IALSVDAIGRRTRWERFKS----IAPADRLSLVNSELI----------------------
A0A3M1I8A3      ADAKATAEIMQATIRELDAHLKAGRPAETFPSVANDSR----------------------
A0A4V0XS84      EKAVSDSISKTQLANELGN----LVRAGLSAEGAQMAM----------------------
A0A351WE84      IASRVDMLVRKARLNQLES----LEGTELMNASSYVVM----------------------
D5ENH7          LESKNNYDQFETKWKLIDS----YKLEGKNLWELSFIS----------------------
A0A0R2XQ77      LENKNVYDNLETRMGLVET----FRREGRNLWELSFIA----------------------
A0A2E9IN28      LSNKNLYDQLETKWNLIES----YRRQGKELWELSFIS----------------------
A0A6N4WTJ5      LSNKNVYDNLETRWNLIES----YRREGKDLWELSFIA----------------------
A0A1V5QDZ6      IAARVDMLVRKAQLDQLVN----LSGEELMNASSYIVS----------------------
A0A4Y8P964      SKARFEMIRREVYLEKAKS----AMEAGKLAAIPDSPF----------------------
A0A3D4HF88      TTTKQVRDQSKHRWEQIQSFKAEGKPLQDLPFIAEMPL----------------------
A0A6N6ZHN8      IEAQQIFDRLSTRWNQVQQ----VQESGGSLLDLNFIA----------------------
A0A351MR11      EELRRQIDELAIIWEQIEQ----FKKEGKDLVLIPMVK----------------------
A0A6G6K641      NEARSRRMQLEVDMAGALK--GQSNAEDLLKVPSIAQN----------------------
A0A5B5WI95      FDLETQIKLAAVLADNLKK----TVRNDGLISVDTGLA----------------------
A0A2N8I9W1      FDLETQIKLAAILADNLKE----TERKQGLISVETGLP----------------------
A0A4Q5IH27      FDLETQIKLAAILADNLKE----TERKQGLISVETGLP----------------------
A0A2N8IBZ6      FDLETQIKLAAILADNLKE----TERKQGLISVETGLP----------------------
A0A2N8IJW9      FDLETQIKLAAILADNLKE----TERKQGLISVETGLP----------------------
R6J100          FDLETQIKLAAILADNLKE----TERKQGLISVETGLP----------------------
A0A1V6J089      SAARVDMLVRKARMDQLED----LEGDKLMDAAAYIVQ----------------------
A0A3C1BZR1      SGARVEMLVRKARMDQLEG----LEGDRLMDAAAYIVQ----------------------
A0A7C4KLL2      AQARSDTARLQRQYQRLMAQASNVSDLLLLPQIAAVPE----------------------
A0A1H6KPB7      SALDDEITQLKTHINKLKS----LKDSELMDYVRQTDL----------------------
A0A2E9ISN4      KSVRLERVLLENQYEQLSDADILTVNEALAATRETEGR----------------------
B9XAX1          TSAKADRIQMEADLKLIQS----LTNQPEAILTLPSIL----------------------
A0A5R8KKM9      YKLTNEIQSLRAQISQLQT----LDGDALIRQAGELRV----------------------
A0A139TS01      MKFEKDEQELAAYVAEVQR----LPDDKLMDYVTNSDL----------------------
A0A3E1EJT7      TQTNAHLKEAEVKWNQVQE----WTKAGRSLSELPFIT----------------------
A0A317ZP96      LNNKNILDNLETKWNLIEN----YKREGKDLWELSFIA----------------------
A0A7C3I5X9      VEAKARAQMAQTTVDELDR----HIQEQKPLETFPLIA----------------------
A0A2D5WGA5      ITAKGVHTTQSTLLEGLKA----QSDEELRASILTAHP----------------------
A0A2E7SSH2      ITAKGLYTQQATLLQGLQG----QSPDELRESIMTAHP----------------------
A0A349GXM8      PALDGANAAVISDVARLTRATGEIKPSESSRDEEEAPV----------------------
A0A4P5YP61      TEAKSVRISLESDLAQIQQ----LGTNIGALLGIASVA----------------------
A0A6B2LYM4      EQDKQLYDEASTVMAQINE----ARDSGDPLWELGFIA----------------------
A0A6D1VXB3      SKARFEMIRREVYLEKAKA---------------AMDA----------------------
I0JYY7          SKARFEMIRREVYLEKAKA---------------AMDA----------------------
A0A4R7S1J2      SQQTNDRVRLETDYAALLQ----MKSRPDEAVNLQIVA----------------------
A0A2A2XV69      STERLRVSTLRAKYEQISK----LSDDQIMRSISTLDV----------------------
A0A651H7X9      TEAAARRNEAAVRWNLVQQ----YREEGRPLTEISFIA----------------------
A0A4Y8P842      SKARFEMIKKEVFYERAKN---------------GLDS----------------------
B3DZK9          AKARFEMIRKEVFYERAKN---------------GLDM----------------------
A0A5E6MPC4      AEQELGRLSEAIFRARLDL----LRREVRLERAKEAFA----------------------
A0A6N6PKP9      TAAKAERLRIEADRAQLDR----LQGEPPERLLTLPSI----------------------
A0A6N6Z250      VNLRVEALARKTRWEQFAS----VAPEDRLAVVNDELV----------------------
A0A4V1SB02      GTATNQRTAIESDLAALKQ----IPTENVEELL---------------------------
A0A6N6QEJ2      TEYRTQAATLEQLMEKVNS----KKGDELRHFLSSARP----------------------
A0A3C1VB86      QDLNERLTQSKASLVQAQG----AYQDSLKMSTNTEDL----------------------
A0A146G2Q9      SQESLRVAALRAKYDQVSK----MTDEQIMRSLTTLEI----------------------
A0A2T6D3Y2      SQESLRVAALRAKYDQVSK----MTDEQIMRSLTTLEI----------------------
A0A6N6P5E3      NDMRLKVASLQSKAQQIGL----MTDDQIMRSLKTFEM----------------------
A0A2D5VY59      TVAEAKLIRFQTLFNELEA----MTLDQLKNTILTAMP----------------------
A0A2D8UZZ4      TVAEAKLXRFQTLFNELEA----MTLDQLKNTILTAMP----------------------
A0A353DV86      TVAEAKLIRFQTLFNELEA----MTLDQLKNTILTAMP----------------------
A0A2E5EPT8      IEMNAGLTSKKTQLEQLKS----LSPKVLGNALMTVLP----------------------
A0A6J4HTK1      NEAETKVATLSTQLQGIEN----LKGEDLMRMMPTLNI----------------------
A0A6N6PHJ5      FEKDQAYKKQKEVFEKLSA----IDIVALRDVLPGFQ-----------------------
A0A6M1RXR2      IEAKSQYEAEAKLLEQLKS----VPRDQLPQVLSAAMR----------------------
A0A7C3DXS4      IEAKSQYEAEAKLLEQLKS----VPREELPQVLSAAMR----------------------
A0A2V2SDV4      IEGLRELVSQQTLLDKLLA----FSPKDVVNVLPTVI-----------------------
A0A2V5PK75      IENEADFVKQSTLLNKLKS----LKYQELTQVLPTTV-----------------------
A0A1V6DME1      IEGEAAYVREATLLQELKT----TAPEDLKSVLPTAV-----------------------
A0A3D3DIJ3      IESQAEYVRQATRLDRLKNLGKELGPEGLAQAITTDA-----------------------
A0A6I1K583      IQLATTYRRKQTRFDELKK----LPADQLRNALNYVAP----------------------
A0A350EWA4      DLEKLEYEKMMKRLHGMEA----LTSIDQLKVALPTSF----------------------
A0A5B5WZ91      MKFEKDEQELAAYVAEIQR----LPDDKLMDYVTNSDL----------------------
A0A2N8HD92      MAFEKDEKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A2N8HIT2      MQFEKDEKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A354EBD3      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A355VEB2      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A2N8IMT3      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
R6K1U5          MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A2N8IWC2      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A2N8I441      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A2N8I3A6      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A410SCC4      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A3R5VEW0      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A411SSG2      MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
B2UKW3          MDFERREKELASYVQELQR----LPDDKLLDYVISSDL----------------------
A0A7C3HWX0      TYAQGEYVLYKSQFDRLRS----LSTNDLRKAILTTFQ----------------------
A0A7C4KPD7      V-------ELNAQYSRLTN----MNRVELKRALVTVQP----------------------
A0A1M6RLZ4      ALRDRD--SLKSIVQRLGD----LDNEALISAMAGLNL----------------------
A0A354T7G8      MLADQDTLTLQAEIDEIGK----LSIEELIARASGLKL----------------------
A0A2S7U4L6      --------ELERQVKDLVG----LDDETLISHVSGLNR----------------------
A0A512MBZ2      LQSDLEVQNLTSELEQLDK----LSPDELVARASGLRL----------------------
A0A2E8MEZ0      DTLEQTRDQIQIQIRKLID----TPNEDLIRTAAGLEL----------------------
A0A6B3LBV6      ATLEYEISGMKSQLEGLQG----LEGTDLIRKAAMLGI----------------------
A0A2E3EC33      FQAEGAIQNLRTTIKSLTD----LEGEELIKSAVDLGI----------------------
A0A2E4GN01      FXAEXAIQXLXTTIXSLTD----LKGEELIKSAVDLGI----------------------
A0A1Z8XU55      FAAEEAIQNLRSTISSLTQ----LEGEELIKSAVDLGV----------------------
A0A2E1RQR9      FAAEEAIQNLRSTISSLTK----LEGEELIKSAVDLGV----------------------
A0A2E3ISQ4      FAAEEAIQNLRSTIKSLTQ----LEGAELIKSAVDLGV----------------------
A0A2D6W6F4      FAAEEAIQNLRSTIKSLTQ----LEGAELIKSAVDLGV----------------------
A0A2D8Z5A8      FAAEEAIQNLRSTIKSLTQ----LEGAXLIKSAVDLGV----------------------
A0A4Q2YKS3      LEQQKI--ELESQIKSLLN----YRTEQLMVYASGLDL----------------------
A0A6N6P3T8      LETEKM--QLESMIQSLLK----YSSDQLMVYASGLAL----------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ---------------------------ARTGEVAIAGLQLAG------------------
A0A7C5P291      AEVTITVDQDNSLTRTVKVDENGNIDFPPLGRVQAGGRTPAGLRDHLQERLQKEFYLTSP
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------QV----------------------------------AEARRQ
A0A2V5UHJ2      ------------------------------------------------------GSLKAE
A0A2V5PST3      ------------------------------------------------------PTLRST
A0A2V5PXM3      ---------------V--------------------------------------TDIRGN
A0A1V5QB01      ---------------PGVGLMSIAAMGVETNAPAPAVGGLEGLVEYGVVQQRGWQEQRRV
A0A7C5LI63      ----------------QNQAAPVPEKTTVGDGASVYGAVLQAAPVMNDTIVKNLMELERR
A0A7C5P291      VRVTLGTATAPVLTITDNTGAAAPPPAAAPAANALSSPPPTLLRMMGDEHGQKLFEYENQ
A0A139SU05      ---------------V--------------------------------------APLRGQ
A0A139SPN4      ---------------V--------------------------------------APLRTQ
A0A1V6E7N1      ---------------I--------------------------------------PALNAQ
A0A2D9MYT1      ---------------V--------------------------------------KKMRGD
A0A258ANJ7      ---------------V--------------------------------------SGILSQ
A0A290QGD9      ---------------I--------------------------------------GELKKQ
A0A1D8AS58      ---------------I--------------------------------------VQLVQQ
I6AQC1          ---------------V--------------------------------------SQLASQ
W0ITH7          ---------------V--------------------------------------AQLASQ
A0A139TLN4      ---------------A--DMGI--------------------------------RDQIGV
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------LEAEKE
A0A2E8MCT7      ------------------------------------------------------LEAEKE
A0A290Q2Z2      ---------------Q--DPNI--------------------------------QNLLQA
A0A2A2RGK2      ---------------V--------------------------------------AQYSES
A0A2A2XXF7      ---------------V--------------------------------------AQYSES
A0A2A2R5D6      ---------------E--DANL--------------------------------TSLRAK
A0A1J4XH17      ---------------V--------------------------------------EQLLSD
A0A3C1VJ32      ---------------D--AE-L--------------------------------GSLLAQ
A0A2N9NTX7      ---------------D--SY-L--------------------------------NSLMEQ
B9XK55          ---------------D--AI-L--------------------------------IQLLQD
A0A4P5YMI6      ---------------D--EL-L--------------------------------ATLLQK
A0A2E6T482      ---------------D--AQ-L--------------------------------DALIRE
A0A3C0DQZ7      ---------------D--AQ-L--------------------------------DALIRE
A0A1Z9CBK5      ---------------D--AQ-L--------------------------------DALIRE
A0A2D6ZI96      ---------------D--AQ-L--------------------------------DALIRE
A0A358KGZ3      ---------------D--AQ-L--------------------------------DALIRE
A0A2E9ZQX4      ---------------D--AQ-L--------------------------------DALIRE
A0A3D5JZU0      ---------------D--AQ-L--------------------------------DALIRE
A0A2E6HCR0      ---------------D--AQ-L--------------------------------DALVRE
A0A1Z8WN04      ---------------D--AQ-L--------------------------------DALVRE
A0A2D7L1N4      ---------------D--AQ-L--------------------------------DALVRE
A0A2E2R937      ---------------D--AQ-L--------------------------------DALVRE
A0A520QQY4      ---------------D--AQ-L--------------------------------DALVRE
A0A2D5MR66      ---------------D--AQ-L--------------------------------DALVRE
A0A2E0PDQ1      ---------------D--AQ-L--------------------------------DALVRE
A0A2E2ZZP9      ---------------D--AQ-L--------------------------------DALFRE
A0A7C4LRK7      ---------------D--QH-L--------------------------------AVLMEE
A0A2A2RGF2      ---------------N--DEIL--------------------------------ARRLEE
A0A2G4I5Y6      ---------------N--DEIL--------------------------------SRRLEE
A0A6N6PS97      ---------------D--EA-L--------------------------------NTHLRD
A0A3M1I883      ---------------S--EALL--------------------------------PKRIDD
A0A1V6JZ45      ---------------T--EARL--------------------------------GELLGA
A0A7C7Z746      ---------------D--PN-L--------------------------------ETLLAE
A0A520RRW5      ---------------G--NLRL--------------------------------TSLLNE
A0A356NPK0      ---------------G--NLRL--------------------------------TSLLNE
A0A2D7B5P5      ---------------G--NLRL--------------------------------TSLLNE
A0A3D3XGB5      ---------------G--NLRL--------------------------------TSLLNE
A0A2V6F8A1      ---------------D--EL-L--------------------------------SKLMMD
A0A2V5TNH4      ---------------D--EL-L--------------------------------SKLMMD
A0A2V5X5Q6      ---------------D--EL-L--------------------------------SKLMTD
A0A4P5QM05      ---------------T--DSTVE-------------------------------KTLPLL
A0A4Q3C001      ---------------D--EPTVR-------------------------------ENLPLL
B4DB23          ---------------D--DTTVS-------------------------------RNLPLL
A0A6B3L938      ------------------------------------------------------LALNQE
A0A2V5URB2      ---------------I--------------------------------------QSLRAQ
A0A2V2DJ66      ---------------I--------------------------------------SKLVSD
R7L5A9          ---------------I--------------------------------------AKLLTD
A0A5R8KA81      ---------------V--------------------------------------AELRSQ
A0A5B5WU87      ---------------A--DMGI--------------------------------RDQIGV
R7DZW0          ---------------A--DMGI--------------------------------RDQISV
A0A2N8HID1      ---------------A--DMGI--------------------------------RDQISV
A0A2N8HS06      ---------------A--DMGI--------------------------------RDQISV
A0A6N2TNT9      ---------------A--DMGI--------------------------------RDQISV
A0A3R5R2M8      ---------------D--NGL---------------------------------SRQIEN
A0A411SUQ6      ---------------D--SGI---------------------------------ARQIEH
A0A2N8HZF2      ---------------D--SGI---------------------------------ARQIEH
A0A354E720      ---------------D--SGI---------------------------------ARQIEH
B2UPB6          ---------------D--SGI---------------------------------ARQIEH
A0A2V6JLK8      ---------------Q--DPTVQ-------------------------------KILPNY
A0A2W5Z1A5      ---------------Q--DPTTL-------------------------------KILPNY
A0A2V6EA09      ---------------Q--DPTIQ-------------------------------KILPNY
A0A2V6GQI7      ---------------Q--DPTIQ-------------------------------KILPNY
A0A3C1HEJ2      ---------------A--DPTV--------------------------------SAAMIA
A0A522ULD9      ---------------D-----------------------------------VSLNSLRQQ
A0A1V6JU76      ---------------V--------------------------------------NSLQLQ
A0A2A2XXW5      ---------------V--------------------------------------AYLRKQ
A0A6N6Q6V0      ---------------V--------------------------------------NQLKVT
A0A1Q6UHJ9      ---------------I--------------------------------------SKLLTD
A0A2V2BXR0      ---------------I--------------------------------------SKLLTD
A0A2D8V0G3      ---------------IQNSPII--------------------------------QQLRVS
A0A348S017      ---------------VASSEII--------------------------------KTIRAN
A0A3C1UUV7      ---------------VASSEII--------------------------------KTIRAN
A0A350I3V2      ---------------VASSEII--------------------------------KTIRAN
A0A520RGV5      ---------------VASSEII--------------------------------KTIRAN
A0A3D3XF90      ---------------VASSEII--------------------------------KTIRAN
A0A2D7B522      ---------------VASSEII--------------------------------KTIRAN
A0A356NIC2      ---------------VASSEII--------------------------------KTIRAN
A0A2N8HDG3      ---------------D--SGV---------------------------------SRQIEA
A0A146GCJ0      ---------------SNLPQV---------------------------------ALIREQ
A0A2T6D6H8      ---------------SQLPHV---------------------------------AVIREQ
A0A3D1TI55      ---------------D--PSY---------------------------------NTLNQQ
A0A3E1ET42      ---------------Q--NDTI--------------------------------KALYPE
A0A2A2YDW8      ---------------A--GQDL--------------------------------KSLFPE
A0A352XLN9      ---------------A--GQDL--------------------------------KSLFPE
A0A3D0YP62      ---------------P--DVGF--------------------------------REAYNK
A0A3D3DV47      ---------------P--DVGF--------------------------------REAYNK
A0A2E5XJ49      ---------------P--GSAV--------------------------------PELHRA
A0A2E6SBY8      ---------------P--GSAV--------------------------------PELHRA
A0A2E5QMS4      ---------------P--GSQV--------------------------------PVLRAR
A0A2E7YXQ3      ---------------P--GSQV--------------------------------PVLRAR
A0A2E3H787      ---------------P--GSQV--------------------------------PVLRGR
A0A2E7AGN1      ---------------P--GSQV--------------------------------PVLRSR
A0A2E7AKY7      ---------------P--GSQV--------------------------------PVLRSR
A0A3D4CU34      ---------------P--GSQV--------------------------------PVLRSR
A0A2E8M146      ---------------P--GSQV--------------------------------PVLRGR
A0A355S8S2      ---------------P--GSQV--------------------------------PVLRGR
A0A2D6DVN8      ---------------P--GSQV--------------------------------PVLRAR
A0A3C1W2R2      ---------------P--GSQV--------------------------------PVLRAR
A0A2E3NAY6      ---------------P--GSQV--------------------------------PVLRAR
A0A2E3II01      ---------------P--GSQV--------------------------------PVLRAR
A0A368B8C5      ---------------P--GSQV--------------------------------PVLRAR
A0A3R7RBB5      ---------------P--GSQV--------------------------------PVLRAR
A0A2A2QX62      ---------------P--DNVI--------------------------------PVLLPQ
A0A4Q3BWH6      ---------------P--DNII--------------------------------PVLLPQ
A0A3N5WCF1      ---------------P--DNII--------------------------------RTLYPQ
A0A4Q3C1K5      ---------------P--DNLI--------------------------------RNLYPL
A0A3R8IT45      ---------------V--------------------------------------AQLSQL
A0A2A2PYE8      ---------------V--------------------------------------VQLGQL
A0A2T6CN73      ---------------I--------------------------------------VELLKQ
A0A2G4G428      ---------------S--DERV--------------------------------ASFGSK
A0A6N6PCD8      ---------------P--DV----------------------------------QEALKL
A0A139TV24      ---------------D--SGVSRQIEAYN-------------------------TAYLEY
A0A2N8HT11      ---------------D--SGVSRQIEAYN-------------------------AAYLEY
R7DS70          ---------------D--SGVSRQIEAYN-------------------------AAYLEY
A0A2N8HNL6      ---------------D--SGVSRQIEAYN-------------------------AAYLEY
A0A6N6PAZ1      ------------------------------------------------------LEVHKT
A0A6I1K459      ---------------V--------------------------------------QSLKEK
A0A139TUL1      ---------------Q--DAGI--------------------------------AKQIEL
A0A2N8HCB0      ---------------Q--DAGI--------------------------------AKQIEL
A0A2N8HP04      ---------------Q--DAGI--------------------------------AKQIEL
A0A2N8HRJ0      ---------------Q--DAGI--------------------------------AKQIEL
A0A6N2U9Y7      ---------------Q--DAGI--------------------------------AKQIEL
A0A366HAG0      ---------------E--NETIR-------------------------------RMGPTY
A0A2U8DZK4      ---------------E--DPGT--------------------------------QRLQQI
A0A2T6DFL8      ---------------P--DQNI--------------------------------QNLLQA
A0A1D8AWD4      ---------------Q--DTNI--------------------------------QNLLQA
A0A4Q1C9S2      ---------------Q--DTNI--------------------------------QSLLQA
A0A178IH18      ---------------T--DTNI--------------------------------QNLLQA
A0A2T6DT99      ---------------Q--DPNI--------------------------------QNLLQA
A0A1G3ZT33      ---------------Q--DTNI--------------------------------QNLLQA
A0A3E1E2T2      ---------------P--DINI--------------------------------QNLLQA
B1ZMW1          ---------------Q--DTNI--------------------------------QNLLQA
A0A3M1I8A3      ---------------V--------------------------------------IELQKR
A0A4V0XS84      ---------------L--QQYGGRLTGI--------------------------QELKKS
A0A351WE84      ---------------D--QSI---------------------------------ASIRQQ
D5ENH7          ---------------E--QPRV--------------------------------ASLLQN
A0A0R2XQ77      ---------------E--ESRV--------------------------------AGLLDR
A0A2E9IN28      ---------------E--QPRV--------------------------------SSLLQR
A0A6N4WTJ5      ---------------E--QPRV--------------------------------SNLLEQ
A0A1V5QDZ6      ---------------D--PAL---------------------------------QAIRAQ
A0A4Y8P964      ---------------T--------------------------------------VDLKKN
A0A3D4HF88      ---------------V--------------------------------------QDLQSQ
A0A6N6ZHN8      ---------------TSSNI----------------------------------PSLLQR
A0A351MR11      ---------------S--DDRV--------------------------------AALYNR
A0A6G6K641      ---------------A--DV----------------------------------RLAQER
A0A5B5WI95      ---------------D--NGISRQIEGYN-------------------------EAFLEY
A0A2N8I9W1      ---------------D--SGIARQIEHYN-------------------------EAYLEY
A0A4Q5IH27      ---------------D--SGIARQIEHYN-------------------------EAYLEY
A0A2N8IBZ6      ---------------D--SGIARQIEHYN-------------------------EAYLEY
A0A2N8IJW9      ---------------D--SGIARQIEHYN-------------------------EAYLEY
R6J100          ---------------D--SGIARQIEHYN-------------------------EAYLEY
A0A1V6J089      ---------------D--PT-------LL-------------------------SIRQQY
A0A3C1BZR1      ---------------D--PT-------LM-------------------------GIRQQL
A0A7C4KLL2      ---------------V--------------------------------------QALRSA
A0A1H6KPB7      ---------------L--AETTPGSLSVR-------------------------ELYTRS
A0A2E9ISN4      ---------------S--QVTPEGAPAVDPGAETPPEAAKNYGAYDHLNTGIQWQETQVR
B9XAX1          ---------------Q--DP-------AV-------------------------METRRR
A0A5R8KKM9      ---------------E--NET------IR-------------------------TIGPAY
A0A139TS01      ---------------L--NAEILAADSLR-------------------------KTYQEY
A0A3E1EJT7      ---------------S--QA-------KV-------------------------GQLLVQ
A0A317ZP96      ---------------E--QE-------RV-------------------------ASLLER
A0A7C3I5X9      ---------------S--DS-------QV-------------------------RSLQSQ
A0A2D5WGA5      ---------------D----------AQL-------------------------DALIRE
A0A2E7SSH2      ---------------D----------AQL-------------------------DALIRE
A0A349GXM8      ---------------PGGETKSAKEDAAQ-------------------------QTDETI
A0A4P5YP61      ---------------N--DP-------TV-------------------------RDIKSN
A0A6B2LYM4      ---------------N--NA-------EV-------------------------SDLLNK
A0A6D1VXB3      ---------------G--KLAAIPDSPFT-------------------------VDLKKI
I0JYY7          ---------------G--KLAAIPDSPFT-------------------------VDLKKI
A0A4R7S1J2      ---------------N--HP-------TL-------------------------NGISTA
A0A2A2XV69      ---------------Q--DPT------IT-------------------------QMLPQF
A0A651H7X9      ---------------N--NP-------IV-------------------------NDLRAR
A0A4Y8P842      ---------------G--KSVTIPDNQYT-------------------------MDLKKN
B3DZK9          ---------------G--KSLTIPDNQYT-------------------------MDIKKN
A0A5E6MPC4      ---------------G--GKAGVPENPYT-------------------------VELKKL
A0A6N6PKP9      ---------------A--GAA------VV-------------------------VEVQRK
A0A6N6Z250      ---------------T--DQ-------NI-------------------------QQLAQA
A0A4V1SB02      ---------------------------KL-------------------------NSLSAL
A0A6N6QEJ2      ---------------T--QE--------L-------------------------TALIAS
A0A3C1VB86      ---------------L--AYPQIAIEPDM-------------------------VQISTD
A0A146G2Q9      ---------------E--DPT------IT-------------------------QLYPQF
A0A2T6D3Y2      ---------------E--DPT------IT-------------------------QLYPQF
A0A6N6P5E3      ---------------D--DAT------IS-------------------------QILPQY
A0A2D5VY59      ---------------G--NL-------RL-------------------------THLLNE
A0A2D8UZZ4      ---------------G--NL-------RL-------------------------THLLNE
A0A353DV86      ---------------G--NL-------RL-------------------------THLLNE
A0A2E5EPT8      ---------------N--EI-------NL-------------------------PRLYEQ
A0A6J4HTK1      ---------------Q--DPT------IQ-------------------------KILPNY
A0A6N6PHJ5      ---------------P--DS-------EL-------------------------SSLIGE
A0A6M1RXR2      ---------------D--DP-------QL-------------------------TELLQS
A0A7C3DXS4      ---------------D--DP-------QL-------------------------TELAQS
A0A2V2SDV4      ---------------P--DA-------TL-------------------------TSWLEQ
A0A2V5PK75      ---------------A--DS-------LL-------------------------SSLLEQ
A0A1V6DME1      ---------------A--DP-------QL-------------------------AELLQQ
A0A3D3DIJ3      ---------------P--DT-------LL-------------------------TSLLDQ
A0A6I1K583      ---------------D--ELLTKRLDELS-------------------------LAEKEF
A0A350EWA4      ---------------P--DSALIVN--FA-------------------------GMFQSE
A0A5B5WZ91      ---------------L--NAEILAADSLR-------------------------KTYQEY
A0A2N8HD92      ---------------L--NAESVGAKALR-------------------------ETYAEF
A0A2N8HIT2      ---------------L--NAESVGAKALR-------------------------ETYAEF
A0A354EBD3      ---------------L--NAETVGADALR-------------------------KTYAEF
A0A355VEB2      ---------------L--NAETVGADALR-------------------------KTYAEF
A0A2N8IMT3      ---------------L--NAETVGADALR-------------------------KTYAEF
R6K1U5          ---------------L--NAETVGADALR-------------------------KTYAEF
A0A2N8IWC2      ---------------L--NAETVGADALR-------------------------KTYAEF
A0A2N8I441      ---------------L--NAETVGADALR-------------------------KTYAEF
A0A2N8I3A6      ---------------L--NAETVGADALR-------------------------KTYAEF
A0A410SCC4      ---------------L--NAETVGADALR-------------------------KTYAEF
A0A3R5VEW0      ---------------L--NAETVGADALR-------------------------KTYAEF
A0A411SSG2      ---------------L--NAETVGADALR-------------------------KTYAEF
B2UKW3          ---------------L--NAETVGADALR-------------------------KTYAEF
A0A7C3HWX0      ---------------A--EE-V-----LP-------------------------KLLHDL
A0A7C4KPD7      ---------------D-----T-----IL-------------------------MGLLED
A0A1M6RLZ4      ---------------P--EIKV-----VQ-------------------------NLNEMY
A0A354T7G8      ---------------D--NP-S-----LA-------------------------SNTTEY
A0A2S7U4L6      ---------------P--ESAV-----LA-------------------------LTFQQY
A0A512MBZ2      ---------------D--NP-N-----LT-------------------------SMTAEY
A0A2E8MEZ0      ---------------P--EN-Q-----VT-------------------------SYYTGY
A0A6B3LBV6      ---------------E--DQ-T-----IQ-------------------------RYYPMF
A0A2E3EC33      ---------------K--NE-T-----LS-------------------------SGWSSY
A0A2E4GN01      ---------------K--ND-I-----LS-------------------------NGWSSY
A0A1Z8XU55      ---------------K--NE-T-----LT-------------------------SGWTEY
A0A2E1RQR9      ---------------K--NE-T-----LT-------------------------SGWTEY
A0A2E3ISQ4      ---------------K--NE-T-----LN-------------------------SGWSEY
A0A2D6W6F4      ---------------K--NE-T-----LN-------------------------SGWSEY
A0A2D8Z5A8      ---------------K--NE-T-----LN-------------------------SGWSEY
A0A4Q2YKS3      ---------------P--EN-I-----VK-------------------------TLYPQY
A0A6N6P3T8      ---------------P--DN-V-----VQ-------------------------TLYPKY
                                                                            

A0A2A2XVF1      LSDSNMEIAAMQDR---------YGERHPKFIAALAKAESLKKSL----RESAGKAGDIL
A0A2V5UHJ2      LGKFEAEYASLAKE---------FKAGYPPLDNVKTRLEETRRHL----NSEIDKEVKGI
A0A2V5PST3      LLTLEAEKIKQSTV---------FKPDHPRMIELNQQIKEATQSL----NTEINNVVRGI
A0A2V5PXM3      VGRLESDLANLRQR---------YKEKHPKYIQTASQLVEWKNTL----TNAVLNVPQVV
A0A1V5QB01      KSLLEARLAEYRTK---------FRDAHPLVQQTMRELKEVQDAL----NIELQFALRQY
A0A7C5LI63      RTKLEARVSELLTI---------CKPKHPAVQAVQKELNEVKDNI----QYQVRLARDIQ
A0A7C5P291      RRQLLARLTELRKI---------YRPKHPALADTERQLQELGEKI----DAEIQFIREKV
A0A139SU05      MTTLLQEQARLAER---------YLERHPRMIEVTNAIIITQEHL----DLAVQGAIADL
A0A139SPN4      LSTLLQEQARLAER---------YLERHPRMIETTNAIITTQEHL----DFAVQGAIADL
A0A1V6E7N1      IAELTRTQTVLGER---------YLERHPLMIELANKLRVAQEQL----RTQVSLAIADL
A0A2D9MYT1      LALALAELASLRER---------YLEKHPKIIEKRSSIEALQESL----KNAENRIFDSI
A0A258ANJ7      IASQKSALAVLAER---------YKPKHPKYEAVQVVIHNQEQQL----TTILDDAFHLL
A0A290QGD9      QAEQKVVVAQLSER---------YRAKHPRMIDATRMLSQIDAEL----AKATAEAASIV
A0A1D8AS58      VAAQKIVLAQMRER---------YRDKHPRMIEAHNSLTQTEKEL----GRAIDSMAATV
I6AQC1          IAMQTITIKQLRER---------YKEKHPKMIEASNALTQAQLEL----QKAVKIAAELV
W0ITH7          VAMQTITVKQLRER---------YKEKHPRMIEANNALTQAQLEL----QKALKIAAELT
A0A139TLN4      FNDTLLKKTSLKVN---------AGDNNPIVRELEANLASLKDAL----KRSVNNYYTSL
A0A1G3ZFT0      -----------------------YTKSHPSMINLKRRIAMLHEEK---------------
A0A1Z8ZMT6      MAVAEKAIQDLSIR---------YGLKHPKIISGTDQINLKTKIL-------LSAMKDVL
A0A2E8MCT7      MAVAEKAVQDLSIR---------YGPKHPKIISATDHIDLKTKIL-------LSAMMDVL
A0A290Q2Z2      YLIADQNVTKFRAR---------LGAAHPELIGATDNRAKIKEQL----DAQLRGYESAL
A0A2A2RGK2      LNARQRDLTIVAQR---------YRSKHPTYVAIKTQIDLTKADL----KRVLKDAVTLL
A0A2A2XXF7      LNARQRELTLISQR---------YRAKHPAYISVKTQIDLTKADL----RRVLNDAVNLL
A0A2A2R5D6      KYAAESDLEQMRKSG--------LEGNHPRIKSREAELAKIDEQI----NANAAGKRRAL
A0A1J4XH17      LATKNIEISSLEKR---------YGAKHPKMIEATRAKEQTEIEL----KSALDSSINKV
A0A3C1VJ32      YHEAQRKIAALKVD---------YSPANLDVTRVQTLIDTLDGQI----IDRVAGIMVTL
A0A2N9NTX7      VTVADQRLVMVQKD---------YGPENDETKKARESVSDLKQKI----KDRVDGIMLGL
B9XK55          LIGAETKLVTLLAD---------YGDKHPEVLRTQKLVNELNAKI----DDRVKGIMVGM
A0A4P5YMI6      QTLTIQELAAKSKD---------LGAQHPEVIRVNSLLEKITAQV----ADRVDGILRGK
A0A2E6T482      LHTGEQTVANQSID---------LGEQHPRIKGLKKVVATLEGQI----DDRIKGVLAGL
A0A3C0DQZ7      LHTGEQTVANQSID---------LGEQHPRIKGLKKVVATLEGQI----DDRIKGVLAGL
A0A1Z9CBK5      YQTGQTTLANKSID---------LGEGHPTIKSLKAALESLDQQI----DNRIKGILAGL
A0A2D6ZI96      YQTGQTTLANKSID---------LGEGHPTIKSLKAALESLDQQI----DNRIKGILAGL
A0A358KGZ3      YQTGQTTLANKSID---------LGEGHPTIKSLKAAMESLNQQI----DNRIKGILAGL
A0A2E9ZQX4      YQTGQTTLANKSID---------LGEGHPTIKSLKAAMESLNQQI----DNRIKGILAGL
A0A3D5JZU0      YQTGQTTLANKSID---------LGEGHPTIKSLKAAMESLNQQI----DNRIKGILAGL
A0A2E6HCR0      YQTGQTTLANKSID---------LGEGHPTIKSLRAALQSFDSQI----QNRIQGILAGL
A0A1Z8WN04      YQTGQNSLANKSID---------LGEGHPTIKSLRAVLSTFEGQI----QNRIKGILAGL
A0A2D7L1N4      YQTGQNSLANKSID---------LGEGHPTIKSLRAVLSTFEGQI----QNRIKGILAGL
A0A2E2R937      YQTGQNSLANKSID---------LGEGHPTIKSLRAVLSTFEGQI----QNRIKGILAGL
A0A520QQY4      YQTGQNSLANKSID---------LGEGHPTIKSLRAVLSTFEGQI----QNRIKGILAGL
A0A2D5MR66      YQTGQTTLANKSID---------LGEGHPTIKSLRAALQSFEAQI----ENRIQGILAGL
A0A2E0PDQ1      YQTGQTTLANKSID---------LGDGHPTIKSLRAALQSFEAQI----ENRIQGILAGL
A0A2E2ZZP9      YQTGQTTLANKSID---------LGDGHPTIKSLRAALQSFEAQI----ENRIQGILAGL
A0A7C4LRK7      LARAEHKRSLLEPD---------YSADHPEMLRVNKLIETLERQV----NDRLDGIIKGL
A0A2A2RGF2      HSAAEKEFVSKGKD---------LGPNHPDYVRMQALIVKLNQQV----EDRVSGIMLNL
A0A2G4I5Y6      YSAAEKEFVSKGKE---------LGPNHPDYVRMQAVIVKLSQQV----DDRVNGIMLSL
A0A6N6PS97      LAKIEQQLAQSRKD---------YSDEHPEIQKLTAVAAKLNQQI----EERIEGVLRGV
A0A3M1I883      LDVVEQNLSKLLKD---------YTPENPEVQRYMALKDTLQKQI----TNRLNGILEGM
A0A1V6JZ45      LSLAQQEVARLRED---------FSNDYPEMKRKLALVEQIDQQV----EARLTGILTGL
A0A7C7Z746      KYQAQQELTSLEVF---------YGPENTDVQNANALLDKVNQQI----RDHVRKMIQGY
A0A520RRW5      FDRGHQQLSQMKAI---------HGPDHPQMQASNSLLLTLNDQI----KKEITGVLRGL
A0A356NPK0      FDRGHQQLSQMKAI---------HGPDHPQMQASNSLLLTLNDQI----KKEITGVLRGL
A0A2D7B5P5      FDRGHQQLSQMKAI---------HGPDHPQMQASNSLLLTLNDQI----KKEITGVLRGL
A0A3D3XGB5      FDRGHQQLSQMKAI---------HGPDHPQMQASNSLLLTLNDQI----KKEITGVLRGL
A0A2V6F8A1      LATTEANLAKLKET---------LGPQHPDFKGVAAMQAHLDEEI----NRRINGILGGL
A0A2V5TNH4      LSTTEANLAKLKET---------LGPENSDFKAMAAVQANLDTNI----NQRIEGMLAGL
A0A2V5X5Q6      LSTTEANLAKLNAG---------LGPRNPEFIAMAAMQANLDTNI----NQRINGILGGL
A0A4P5QM05      QDAKAEEAKFFSAG---------LGENHPRMKSLRAQREVYAKIL----SDQLDSIKRSL
A0A4Q3C001      QQAAAEEAKLLASG---------LGEAHPKIASLRQMSAVYRQNL----DNALEAIRRAQ
B4DB23          QDAAAEHARLTNLG---------LGVNHPRIKALDAQMATYQKIL----GDQLNTIKITQ
A0A6B3L938      LNQFRTELSALRQR---------YLPKHPRRIEAEAVYEDLYNRF----RREIDTASRTT
A0A2V5URB2      VVQLESEHAKLAAQ---------FLPGYPRLAQVKAQLQETRSKL----AQQIRSVVEGI
A0A2V2DJ66      RSQYQVSVSTLEKR---------YKEKHPRMIEARKALDQVDKEL----AAALDSAYEKV
R7L5A9          RSTQQVFIASLEKR---------YKEKHPSMIEARKTLDQIEKEL----ALAVDAAYAKV
A0A5R8KA81      ISLAESEMANLSQR---------YRPKHPRFIQMQDRLKDLQRSQ----LENIALAAEGM
A0A5B5WU87      FNDTLLKKTSLKVN---------AGDNNPIVRELEANLSSLKDAL----KRSVNNYYTSL
R7DZW0          FNDTLLKRTSLKVN---------AGDNNPIIRELEANLNSLKDAL----KRSVNNYYTSL
A0A2N8HID1      FNDTLLKRTSLKVN---------AGDNNPIIRELEANLNSLKDAL----KRSVNNYYTSL
A0A2N8HS06      FNDTLLKRTSLKVN---------AGDNNPIIRELEANLNSLKDAL----KRSVNNYYTSL
A0A6N2TNT9      FNDTLLKRTSLKVN---------AGDNNPIIRELEANLNSLKDAL----KRSVNNYYTSL
A0A3R5R2M8      YNEAWLEYRKIAGS---------AGSRNPIAAGLRDRMESTRAAA----NKALANYRNNL
A0A411SUQ6      YNEAYLEYQKIAGS---------AGSQNPIAVSLRDRMNSTRAAA----NKALSNYRSNL
A0A2N8HZF2      YNEAYLEYQKIAGS---------AGSQNPIAVSLRERMNSTRAAA----NKALSNYRSNL
A0A354E720      YNEAYLEYQKIAGS---------AGSQNPITVSLKDRMNSTRAAA----NKALSNYRSNL
B2UPB6          YNEAYLEYQKIAGS---------AGSQNPIAVSLRDRMNSTRAAA----NKALSNYRSNL
A0A2V6JLK8      QDTVAQEALLLNSG---------LGEDHPKVKSVRAARQVYTRQL----EQQVGIIRQGL
A0A2W5Z1A5      QDAVAQEASLLNSG---------LGENHPKVKALRAQKQVFARQL----QEQVGIVRSAL
A0A2V6EA09      QEAVAQDAFFLNSG---------LGENHPKVKALRATKAVYAKQL----EEQMASIRSAL
A0A2V6GQI7      QETVAQDAFFLNSG---------LGENHPKVKALRATKAVYAKQL----EEQMASIRSAL
A0A3C1HEJ2      VLTQENAMDLVKRD---------LKPKHPDYIKAQTQLAAAQSQL----TNAVLKVVGAY
A0A522ULD9      VTDTQVSLKLMLEN---------LGENHPDVKRLRAGLEELRQRL----ADGLAGMKKGL
A0A1V6JU76      LSGQENELAGLLKR---------YKDKHPAVIQARSKIEETHRSV----QGAAQQVAEIL
A0A2A2XXW5      VNDNSSKLAGLRTK---------YRERHPRVIQPATQLQADTQKL----RDESERALQGI
A0A6N6Q6V0      LSQTASQFAGVTNR---------YGPKHPTYTTLASTLANARESL----DAQVQRVLKSL
A0A1Q6UHJ9      KSSQQVFVASAEKR---------YKEKHPRMIEARKALDQINKEL----ASAIESAEQKV
A0A2V2BXR0      KSSQQVFVASAEKR---------YKEKHPRMIEARKALDQINKEL----ASAIESAEQKV
A0A2D8V0G3      LAAAEAELASLEVK---------YLEKWPAVIVAKEQIRKLTDEI----QQQAGQELKIL
A0A348S017      LVMAKTDLAALQVK---------YLEKWPAVIEAKERIVKLTEEI----QKVAQDEIDLL
A0A3C1UUV7      LVMAKTDLAALQVK---------YLEKWPAVIEAKERIVKLTEEI----QKVAQDEIDLL
A0A350I3V2      LVMAKTDLAALQVK---------YLEKWPAVIEAKERIVKLTEEI----QKVAQDEIDLL
A0A520RGV5      LVMAKTDLAALQVK---------YLEKWPAVIEAKERIVKLTEEI----QKVAQDEIDLL
A0A3D3XF90      LVMAKTDLAALQVK---------YLEKWPAVIEAKERIVKLTEEI----QKVAQDEIDLL
A0A2D7B522      LVMAKTDLAALQVK---------YLEKWPAVIEAKERIVKLTEEI----QKVAQDEIDLL
A0A356NIC2      LVMAKTDLAALQVK---------YLEKWPAVIEAKERIVKLTEEI----QKVAQDEIDLL
A0A2N8HDG3      YNTAYLEYQKVAGS---------AGGQNPIVVTLTKKMDATRSAA----ARSLDNLRNNQ
A0A146GCJ0      LLNAEGDLAGLKER---------YLPKHPKYIAASMRIANLRQSL----ATEATQASETL
A0A2T6D6H8      LVSAEAELAALKDR---------YLPKHPKYIAGVTRIANLKQAL----DSEVKQAGETL
A0A3D1TI55      LVEAEIAYRAAEEN---------YGPKHPEMVKFQTTIDELRRAK----EQKLVAIKEGL
A0A3E1ET42      YQKSVIEESRLLNSG--------FGKNHPKIRGLRESINTTRKTL----ETAVSGFKDSL
A0A2A2YDW8      YQEQVRMLSGMQVQG--------LGPRHPNVLAQESTVDSLFKQL----QASVVSFKDSL
A0A352XLN9      YQEQVRMLSGMQVQG--------LGPRHPNVLAQESTVDSLFKQL----QASVVSFKDSL
A0A3D0YP62      FEDAKAELQTAKASG--------LGNKHPDIVMRTTRIEELKKGL----EKRAVNVRQSL
A0A3D3DV47      FEDAKAELQTAKASG--------LGNKHPDIVMRTTRIEELKKGL----EKRAVNVRQSL
A0A2E5XJ49      WMAGKRSIATMEASG--------LGRKHPNIRMALIAQDKLEEDL----RSAVVTLKDLL
A0A2E6SBY8      WMAGKRSIATMEASG--------LGRKHPNIRMALIAQDKLEEDL----RAAVVTLKDLL
A0A2E5QMS4      IQESKLNMAAMEASG--------LGRKHPSMEMSLIAQNKMQEDL----GGAVVVLRELL
A0A2E7YXQ3      IQESKLNMAAMEASG--------LGRKHPSMEMSLIAQNKMQEDL----GGAVVVLRELL
A0A2E3H787      LQESKVNIAAXEASG--------LGRKHPQVEMGLIAQAKIEEDL----KAAVVVLRELL
A0A2E7AGN1      FQESKVNIAALQASG--------LGRKHPSVEMALIAQEKLQEDL----KASVVVLRELL
A0A2E7AKY7      FQESKVNIAALQASG--------LGRKHPSVEMALIAQEKLQEDL----KASVVVLRELL
A0A3D4CU34      FQESKVNIAALQASG--------LGRKHPSVEMALIAQEKLQEDL----KASVVVLRELL
A0A2E8M146      YQESRVNIAALEASG--------LGRKHPSVEMAYIAQSKLQEDL----KSSVVVLRELL
A0A355S8S2      YQESRVNIAALEASG--------LGRKHPSVEMAYIAQSKLQEDL----KSSVVVLRELL
A0A2D6DVN8      YQEGKVNIAALEASG--------LGRKHPSVEMAYIAQEKLSEDL----KSSVVVLRELL
A0A3C1W2R2      YQEGKVNIAALEASG--------LGRKHPSVEMAYIAQEKLSEDL----KSSVVVLRELL
A0A2E3NAY6      YQESKVNIAALEASG--------XGRKHPSVEMAYIAQEKLKEDL----KSSVVVLREXL
A0A2E3II01      YQESKVNIAALEASG--------LGRKHPSVEMAYISQKKLSEDL----KSSVVVLRELL
A0A368B8C5      YQESKVNIAALEASG--------LGRKHPSVEMAYISQEKLSEDL----KSSVVVLRELL
A0A3R7RBB5      YQESKVNIAALEASG--------LGRKHPSVEMAYISQEKLSEDL----KSSVVVLRELL
A0A2A2QX62      FQSAKREYDSAMSSG--------LGERHPKMVSLATNLVAMEKQL----DEAVANLRETL
A0A4Q3BWH6      YQEQKRTYEAMKSQG--------RGERHPMMVSQATTLEGMERDL----TEAVANLRETL
A0A3N5WCF1      YQEAKRQLDGLKISG--------LGDRHPTILVAVDQIENMKRQL----DEGVVNLRATL
A0A4Q3C1K5      YLEAERTLESLKIKG--------LGDRHPTILAAKDQIAGMKKQL----DEGVVNLRATL
A0A3R8IT45      VSMRKIEVKQLRDR---------YKDKHPKMIEANNALAQAELEL----KRAVDSAAASV
A0A2A2PYE8      LAERKIAIATLRER---------YRDKHPKMIEALNSFQQTEREL----KRAVENVSAQV
A0A2T6CN73      LAAQKVQLEQLGAR---------YRAKFPKMIEAQNSYDQIKREL----DRAIASACAQV
A0A2G4G428      ISDLRVAVRTMEEK---------YTDEHPTLIQARAQLKQTEAEL----QNAIVTSVNRI
A0A6N6PCD8      ITTKESEFSQIKKR---------YLELHPKYIQTQSELRGLRETL----DRAARKGASIA
A0A139TV24      QKIAGS-----------------AGSQNPIVVSLTKKMDATRAAA----FRSLSNLRDNL
A0A2N8HT11      QKVAGS-----------------AGGQNPIVVTLTKRMDATRSAA----SRSLDNLRNNL
R7DS70          QKVAGS-----------------AGGQNPIVVTLTKRMDATRSAA----SRSLDNLRNNL
A0A2N8HNL6      QKVAGS-----------------AGGQNPIVVTLTKRMDATRSAA----SRSLDNLRNNL
A0A6N6PAZ1      LDIKENELAALQRR---------YLPKHPKMITASAELTQLKEQFIREFEDARQAASDKP
A0A6I1K459      IQAQETSLANLKLR---------YREKHPAMIQAHTELNSLRQQF----EDEVLKAPVRL
A0A139TUL1      FNDNFLQYKKLSAS---------AGKQNPMVSSLAENMKEMRESI----VRSISNYCDVL
A0A2N8HCB0      FNDNFLQHKKLFAS---------AGRQNPMVSSLAENMKEMRESI----GRSIANYCNAL
A0A2N8HP04      FNDNFLQHKKLFAS---------AGRQNPMVSSLAENMKEMRESI----GRSIANYCNAL
A0A2N8HRJ0      FNDNFLQHKKLFAS---------AGRQNPMVSSLAENMKEMRESI----GRSIANYCNAL
A0A6N2U9Y7      FNDNFLQHKKLFAS---------AGRQNPMVSSLAENMKEMRESI----GRSIANYCNAL
A0A366HAG0      QELLLKQQSLATAG---------LGRKHPTMRGIAGSLEQTRALL----LEAAQDYRKNL
A0A2U8DZK4      YLEAEQNVTKLSAR---------LGEAHPEMIVARENLSKIKTQL----EAQLTGYEFTL
A0A2T6DFL8      YLVADQKVTQLQGR---------LGEAHPDLIAAVDNRAKIKEQL----DAQLRGYENSL
A0A1D8AWD4      YLISDQTVTRLMAR---------LGAAHPDLIAAIDNSAKIQQQL----DSQLRGYESSL
A0A4Q1C9S2      YLVAEQNVTRLMGR---------LGSAHPDLIAAVENGAKIQQQL----DSQLRGYESSL
A0A178IH18      YLVADQNVTRLRSR---------LGEAHPELITATDNRAKIREQL----DAQLRGYENGL
A0A2T6DT99      YLVADQNVAKLKTR---------LGEAHPELIAAMENRAKIREQL----DGQLRGYENAL
A0A1G3ZT33      WLVADQTVARLKSR---------LGEAHPDLIAAVDNRAKISEQL----DALLTGYEKSL
A0A3E1E2T2      YLLADQNVTKLKAR---------LGEAHPDLISAIDNRAKIKEQL----DAQLRGYENAL
B1ZMW1          YLVADQNVTRLQSR---------LGEAHPDLIAAVDNRAKIREQL----DGQLRGYESAL
A0A3M1I8A3      LTGYRTDLGAMLQR---------YGEKHPAVVTLRSQIAETEKEL----QQTVKDVIETL
A0A4V0XS84      LTEKESQLANLTQR---------YRDEHPTIVRLRDEVRSLRSAF----ERESQALGDGV
A0A351WE84      LIDTEVALKLMLEN---------MGVNHPDVKRLQAGVDELKKKL----NESLVGLKIGL
D5ENH7          ISATKIEIASLSKR---------YREKHPMMIQQLQTLQESEVEL----GEAVQNSVDKV
A0A0R2XQ77      ISGVKIGISSSSKR---------YREKHPVMIEQLQILQESEVEL----VTAVKDSINKL
A0A2E9IN28      ISGTRISISSLSKR---------YREKHPAMIQLLQTLQESEQEL----AIAVKNSVDKI
A0A6N4WTJ5      ISGTKIQISSLSKR---------YRDKHPVMIQQLQTLQESEAEL----VFAVQNSVNKI
A0A1V5QDZ6      LIDSEVTLKLMLEN---------YGAKHPEVLRVQAGVDELRKKL----ENALNGMKTGL
A0A4Y8P964      LLKEQAKYHELEDI---------YKEEYPKMSRIKAEIEGLNKEI----NEEKEATIEKL
A0A3D4HF88      LSELKVSQSSAAKR---------YREGHPRMISINQSIDETQSEL----TAAVNSAVQKV
A0A6N6ZHN8      LSEAKIGLAGLQER---------FRDKHPKMIAARQTLQETQQEL----QKAATEAAGRL
A0A351MR11      VSELQVTIETLEKK---------YTESHPTLRISREQLDVTKREL----KTAIEMSVNRL
A0A6G6K641      WAQEEANLRAISAR---------YREKHPRHIDQVARVEAAKREL----PAAAMRAAATM
A0A5B5WI95      QKIAGS-----------------AGSQNPIAVGLRERMDSTLSAA----NKALANYRSNQ
A0A2N8I9W1      QKIAGS-----------------AGSQNPITVSLRDRMNSTRAAA----NKALSNYRSNL
A0A4Q5IH27      QKIAGS-----------------AGSQNPITVSLRDRMNSTRAAA----NKALSNYRSNL
A0A2N8IBZ6      QKIAGS-----------------AGSQNPITVSLRDRMNSTRAAA----NKALSNYRSNL
A0A2N8IJW9      QKIAGS-----------------AGSQNPITVSLRDRMNSTRAAA----NKALSHYRSNL
R6J100          QKIAGS-----------------AGSQNPITVSLRDRMNSTRAAA----NKALSNYRSNL
A0A1V6J089      IDSQVSLQLMLKNGV--------VGENHPDVLRLRGAQDELRRQL----DSALAGLKAGV
A0A3C1BZR1      IDSQVSLQLMLKNGV--------MGENHPDVLRLKGAVEELRRQL----ASALEGLKAGI
A0A7C4KLL2      LSKSEQDFKILSLR---------YKDKHPKYIDAAVQIEAMKRDLHLAATNALARLLEAI
A0A1H6KPB7      QTEESTLSKMHMDG---------YGEKHPALLSMVQEHENTKQKL----TEGLVGLKDAL
A0A2E9ISN4      LDELQNEYKQLAAV---------FKDTHPRMIDLKGEITKAQSSL----AHQNELALKRF
B9XAX1          VVEQEAQVATLLLR---------YKPNYPKMLQAQRQLDDLKDAL----RSLASKAPKLV
A0A5R8KKM9      QGLLMRQESVAGSG---------LGPKHPTMISLGKEIETARTLL----LDAANDYRNNL
A0A139TS01      MEKDKERENLKAQN---------LGPKHPKMVALQETANILKEKL----NKELVGLRSSL
A0A3E1EJT7      VTTQKLSVTQLRDR---------YKDKHPRLIEAVNALNQTEQEL----QASLATAAESI
A0A317ZP96      ISGARISISSLSKR---------YREKHPVMIQQIQTLQEAEMEL----ESAVKNAVDKI
A0A7C3I5X9      LATLENELAGLLKR---------YKDKYPAVIQARSRIDDTRQAI----ERAAKAVAEVI
A0A2D5WGA5      LHTGQQTLANQSID---------LGEQHPRIKGLKKVVSTLEGQI----DDRIQGVLAGL
A0A2E7SSH2      FQTGQTTLANKSID---------LGEGHPTIKSLKAALDSLNQQI----DNRISGILAGL
A0A349GXM8      QGFQNLRVRLMRLEADQAELLKVLKDDHPRLKAVRDEIKSIQDQL----ASMAEVQMRNL
A0A4P5YP61      LSKFESEFATIKQR---------YLPKHPKYMGTLSALTEWRNAL----TNAVMKIPQTI
A0A6B2LYM4      LTVNKIQIATLSKK---------FRAMHPTMIAAQEQLDQTQSEL----DKAVNTAASRF
A0A6D1VXB3      LLKEQAKYRELEDI---------YKEEYPKMSRLRTEIEGLNKEI----SEEKEATIEKL
I0JYY7          LLKEQAKYRELEDI---------YKEEYPKMSRLRTEIEGLNKEI----SEEKEATIEKL
A0A4R7S1J2      LAARRSEFAALQSR---------YKSKHPKYTAAQSDIANLEARF----REALPQVSVSL
A0A2A2XV69      QEVASEEARLLNSG---------LGVNHPTVKSMRAKKEVMATQL----VTQIASLRASM
A0A651H7X9      LAAKEIEMAQLRDR---------YRDLHPTMIEARNSIQQTRTEL----NQAVEQAAARV
A0A4Y8P842      LLKEQAKYRELEEI---------YKEDYPKMVRLKAGIEGLNQQL----TDEKQAVVEKL
B3DZK9          LLKEQAKYRELEEI---------YKEDYPKMVRLKAGIDGLNQQL----AEEKQAVVEKL
A0A5E6MPC4      LLKEEAKYREMEEI---------YKPEYPRMVQVHAEIQGLQDEL----NQEKEASVADL
A0A6N6PKP9      IGEKEAELATLSRR---------YKPEYPKYLEATGSLAELKVSL----GEAILKAASLL
A0A6N6Z250      YLVQQQEVERLRSQ---------LGEKHPELASRVAKLRVLREQL----DDLLAGYEKAL
A0A4V1SB02      PDVLRARTAVMEKEAAFATVLERYKSKHPKYGEAQAQLSEAKSKL----RTAVANAGDAL
A0A6N6QEJ2      LNLAKQKQRQLSPD---------LGPEHPEVKRVIGLISEINDQL----DKEVQGMVDAL
A0A3C1VB86      LARLENDFAVIRQR---------YREAHPKYILAASSLAGLKGQL----AANALKARARI
A0A146G2Q9      QEAASEEARMLNAG---------LGANHPNVKALRAKKEVMQRQL----AEQTAILRKTL
A0A2T6D3Y2      QEAASEEARMLNAG---------LGVNHPNVKSLRAKKEVMQRQL----AEQTAILRKTL
A0A6N6P5E3      EACVSEEARMLNSG---------LGPNHPSIKSLDAKKRVYAQQL----KNQIAVLRQSL
A0A2D5VY59      YDTTRQALARLSAI---------HGPEHPERKSLYTLLEEIETQV----TSEITGVLRGL
A0A2D8UZZ4      YDTTRQALARLSAI---------HGPEHPERKSLYTLLEEIETQV----TSEITGVLRGL
A0A353DV86      YDTTRQALARLSAI---------HGPEHPERKSLYTLLEEIETQV----TSEITGVLRGL
A0A2E5EPT8      LATAQQELVAKGKE---------LGPKNPEIERMTKVILEIQLQI----EGRVKGIMSGL
A0A6J4HTK1      QDAVAQEALMLNSG---------LAENHPKVRALRATKEVFTRQL----EEQVKIIRSAL
A0A6N6PHJ5      LNAADQKYVSQIND---------LGPSHPQIQAVNDLRELLNKKI----DARVGGILKGL
A0A6M1RXR2      LNLAEQALIQLRRD---------YADEHPTVVTVRKQIEDLKRKI----TNRVDGLLLGL
A0A7C3DXS4      LNLAEQTLIQLRRD---------YADEHPTVVTVKRQIEDLKRKI----NNRVDGLIRGL
A0A2V2SDV4      RNMLQQRFIALTNI---------LGERHADVVTVQSQLDDLNAKI----AAKATGILQGV
A0A2V5PK75      KNMTEQALVIRQKE---------YGDKHVEVIKLQRQLDDLQDKI----AKRVEGIITSL
A0A1V6DME1      LNLVEQERIRLARD---------LTDDHPAVVTVTRQIKDIETKI----AQRADGIIRGL
A0A3D3DIJ3      LTMAEQRLIALEAD---------YGPENTEVLKCKGLAEDLHKKI----KSRVEGIMLGL
A0A6I1K583      ISK--------SKD---------LGPLNPEYARMKDVIAKIETQI----EARVVGLMKGL
A0A350EWA4      ADAERQLAGLLGQ----------FGRDHPTVMSAQAELDKARETI----KSRVEAMLIGQ
A0A5B5WZ91      MEKDKERETLKSQN---------LGPKHPKMVALQETANILKEKL----SKELVGLRSSL
A0A2N8HD92      SEKLKEKENLKAQN---------IGPKHPKMLALVETERILSDKL----NKELIGLRSSL
A0A2N8HIT2      SDKLKEKENLKAQN---------IGARHPKMLALLETERILGEKL----NKELIGLRSSL
A0A354EBD3      SDKLKEKENLKSQN---------IGPKHPKMLALLETERILGDKL----NKELIGLRSSL
A0A355VEB2      SDKLKEKENLKSQN---------IGPKHPKMLALLETERILGDKL----NKELIGLRSSL
A0A2N8IMT3      SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
R6K1U5          SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
A0A2N8IWC2      SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
A0A2N8I441      SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
A0A2N8I3A6      SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
A0A410SCC4      SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
A0A3R5VEW0      SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
A0A411SSG2      SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
B2UKW3          SDKLKEKENLKSQN---------IGARHPKMLALLETERILGDKL----NKELIGLRSSL
A0A7C3HWX0      TTSEQMLARLL-QD---------YSPEHPEVKSARAVRDQIEQQV----TERIEGMMLGL
A0A7C4KPD7      LNKTEQQLALTAQD---------YGEAHPEYKRLVELLTTQERLV----DERLTGILEGL
A0A1M6RLZ4      LDASRERGSLIAAG---------LGANHPRVKMSRTRVEALRKQL----DEKVTEVRDVL
A0A354T7G8      NKLIVQREGLMNAG---------MGRRHPNVESLSSQIDKLKTFI----EAEARAHVQGL
A0A2S7U4L6      QDAKRERAGVIAQG---------LGENHPQVKHHDSQISILRETL----DAKVRRVRDLL
A0A512MBZ2      QKLQITREGLSQQG---------LGRKHPLVQTADKQLAKSKELI----LAETQSYIEGL
A0A2E8MEZ0      RAADEQVSAMIASG---------LGPNHPEVKAMRLRADGALENA----GKEVMSLKEVL
A0A6B3LBV6      NDLLLEEQQALESG---------LGANHPTVRAIRTQLDSLRGLL----MEAVSDVRGAL
A0A2E3EC33      QALELSRAALVESG---------VGNKHPKIINIDSQLALRMKQL----LDAVDVHKKAL
A0A2E4GN01      QTLELSRAALVESG---------VGKKHPKILNIDKQLKLRMMQL----LDAVEVHKKAL
A0A1Z8XU55      QSLELNRAALVDSG---------VGIKHPKILNIDSQLNLRMKQL----LGAVETHKKAL
A0A2E1RQR9      QSLELXRAALVDSG---------VGXKHPKILNXXSQLNLRMKQL----LGAVETHKKAL
A0A2E3ISQ4      QTLELSRAALIDSG---------VGVKHPKIVNIDSQLKLRMNQL----LDAVETHKKAL
A0A2D6W6F4      QTLELSRAALIDSG---------VGVKHPKIVNIDSQLNLRMNQL----LDAVETHKKAL
A0A2D8Z5A8      QTLELSRAAXIDSG---------VGVKHPKIVNIDSQLNLRMNQL----LDAVETHKKAL
A0A4Q2YKS3      LEMQNNLDAAKTQG---------FGDRHPTVLELSGRVANMKKQL----DEGVVNLRDVL
A0A6N6P3T8      LEQKTQFQGLKRQG---------LGLQHPTMLANAQMIESMKKQL----DEGVVSLRDTL
                                                                            

A0A2A2XVF1      NRQ------------YEAACQTE----SKLTVALKEQEVAALDLN-KMAIPFNVLQREVE
A0A2V5UHJ2      EAG------------FAAARNKE----SELRVAMEDQKKATLNLK-DSAVQYAILAREVD
A0A2V5PST3      REN------------YVAARAKE----QALEVETGKQQQAALNLK-EVGVQYAVLQEEVN
A0A2V5PXM3      RSL------------YESARTAE----AALETALREQESAALELS-SQALHYSSLSREVD
A0A1V5QB01      YAQ------------LEALSIRE----QASKRVEQEWEEEALEVS-RKQQEYQNIQRNFG
A0A7C5LI63      RSE------------VAFLEQQL----AETEKNLRLADNEVQQKT-RELMGGTILSEDLE
A0A7C5P291      NAD------------YQLAKQRY----EQIKSTADQVEAEALGDS-QRMLEIKSMRANVD
A0A139SU05      KTS------------LIEVKKTI----AQLENEYAENEKEALSLR-NMRVDFESLQNEAA
A0A139SPN4      HAS------------LTEVNKTI----SQLETEYTAAEQEALNLR-NMRVDFESLQNEAL
A0A1V6E7N1      KSR------------LAKTADSE----RTFEQEKQLQETEFFKLR-DLRGEYNSLKNQAD
A0A2D9MYT1      MNK------------AKLAKATD----VQLAGVLTIRKSEQQSMN-QKSIEYNNLSRTAT
A0A258ANJ7      QSS------------WEHARELE----HRLQEQLKKQESEALDLE-QLAVQYNVLKREME
A0A290QGD9      EGD------------YQSALRNA----DEARSGLVEQETQSLGID-RAGVEYESLDRELK
A0A1D8AS58      EAD------------FQTARRND----EDARANLARQEKESLDLD-RDAVEYSNLERDLA
I6AQC1          KSE------------YEAALNSN----KEARAILAQIEKESFEID-KAAVDYQMIERDFL
W0ITH7          KSE------------YQTAFNAD----KEARGALAQIERDSLNMD-KIGVDYQMLEQDFL
A0A139TLN4      LVK------------KKNVEEQH----EGTRAHIRAVSGKERAVN--------QIAREQR
A0A1G3ZFT0      ---------------------------KELLNEVKKLPLMDQMML--------NLLRDVK
A0A1Z8ZMT6      SSD------------LETDYWRG----FQDQIDDIENEENFKDLRNAMKLRASLLTNSVE
A0A2E8MCT7      SND------------LETDYWRG----FQDQIDDIKNEENFRELRNAMKLRASLLTNSVE
A0A290Q2Z2      EIA------------YKEADARV----AELKNQLAQAKVDQILSARDRMRPFEEAARKLE
A0A2A2RGK2      ANS------------RNRLEVQS----TEMKTAREAAEKRLLEVT-HKSIEYNDIKREQE
A0A2A2XXF7      ESA------------RNRLEVQA----NETKIAREKAEGRLIEVT-AKSIEYNDIKREQE
A0A2A2R5D6      EID------------VQVTKARV----TQLEKEVGVLTDQVRMQKTTELAKFREAKKEQD
A0A1J4XH17      YAN------------YDHARDFL----IQSEKRLAQKEKGIINLS-KIKVEYSTLSRDFE
A0A3C1VJ32      QSQ------------VNSKKASL----DSLVQQVEEAKQKDHDNA-TKNQPYYDEKRKLD
A0A2N9NTX7      QAK------------VASVRESL----DQMKKEVDEATKTDISKA-SESAPYWKAKRELE
B9XK55          DAR------------VASLLAVV----KNSEDKVNEAKSNDLVLA-ESSRPYFIEKSQLD
A0A4P5YMI6      EAD------------LAAARARD----EELTRAVEEAKVKNREAA-EKMRDYLTAVRDVE
A0A2E6T482      ELR------------VKSSKAQV----EELQRDVDEAKQRESDMR-EKGREYFDAKRELA
A0A3C0DQZ7      ELR------------VKSSKAQV----EELQRDVDEAKQRESDMR-EKGREYFDAKRELA
A0A1Z9CBK5      ELR------------VQSSLAQV----XELQKAVDDAKAKEAKVQ-EEGREYFDAKRKLS
A0A2D6ZI96      ELR------------VQSSLAQV----XELQKAVDDAKAKEAKVQ-EEGREYFDAKRKLS
A0A358KGZ3      ELR------------VNSSLAQV----RELQKSVDDAKAKEAKVQ-EEGREYFDAKRKLS
A0A2E9ZQX4      ELR------------VNSSLAQV----RELQKSVDDAKAKEAKVQ-EEGREYFDAKRKLS
A0A3D5JZU0      ELR------------VNSSLAQV----RELQKSVDDAKAKEAKVQ-EEGREYFDAKRKLS
A0A2E6HCR0      ELR------------VSSSLAQV----NELQMAVDDAKSKEAKVQ-EEGREYFDAKRRLS
A0A1Z8WN04      ELR------------VKSSLAQV----NELQKAVDSAKSKEAKVQ-EEGREYFDAKRKLS
A0A2D7L1N4      ELR------------VKSSLAQV----NELQKAVDSAKSKEAKVQ-EEGREYFDAKRKLS
A0A2E2R937      ELR------------VKSSLAQV----NELQKAVDSAKSKEAKVQ-EEGREYFDAKRKLS
A0A520QQY4      ELR------------VKSSLAQV----NELQKAVDSAKSKEAKVQ-EEGREYFDAKRKLS
A0A2D5MR66      DLR------------VKSSLAQV----KELQKAVDNAKSKEAKIQ-EEGREYFDAKRKLS
A0A2E0PDQ1      ELR------------VKSSLAQV----NELQKAVDNAKTKEAKIQ-EEGREYFDAKRKLS
A0A2E2ZZP9      ELR------------VKSSLAQV----NELQKAVDNAKTKEAKIQ-EEGREYFDAKRKLS
A0A7C4LRK7      ETR------------VISYKARA----QELTAKVEDAKKKERLAA-EKMQPYLAAKDKFE
A0A2A2RGF2      ETD------------LKAQAAAL----ALTETKLEEAKVRNRTAA-EKNRTYQMALTDLE
A0A2G4I5Y6      ETD------------LKAQAAAL----ELTETKLEEAKVRNRTAA-EKNRTYQMARDDLD
A0A6N6PS97      QVT------------MNRSKSVL----DELEKAVADAKKQDGIKM-ENYRPYFAAKRDLE
A0A3M1I883      RAQ------------VASFKARY----DEISNQVAQAERAVAEEA-ARFSQYFDLKRQWE
A0A1V6JZ45      ENQ------------VISLKARR----DELQKAVDDGKKLVVEEA-KRSREYWSSKRELE
A0A7C7Z746      ASM------------AAIALDHS----EALQIRLDEVKKEERKAT-TKYRPYSRAKEKLD
A0A520RRW5      QTQ------------VNAARNQL----TELTSAVESAKASDAEKT-AEYRPYFTAKRDLE
A0A356NPK0      QTQ------------VNAARNQL----TELTSAVESAKASDAEKT-AEYRPYFTAKRDLE
A0A2D7B5P5      QTQ------------VNAARNQL----TELTSAVESAKASDAEKT-AEYRPYFTAKRDLE
A0A3D3XGB5      QTQ------------VNAARNQL----TELTSAVESAKASDAEKT-AEYRPYFTAKRDLE
A0A2V6F8A1      KVR------------VDAFKANL----DTLAKSVDDARKKDADMT-EKYRPYFEAKRRLD
A0A2V5TNH4      KLK------------VDAFRLHL----DSLAGAVDHARTNDAFMT-EQYRPYFKAKRRLD
A0A2V5X5Q6      KLK------------VDAFKLNL----DTLASAVDHARTNDAFMT-EQYRPYFKAKRKLD
A0A4P5QM05      NTR------------LGIEEATL----KTFETNVDKTHKVQIDEK-TRMSRYVEKKSAYL
A0A4Q3C001      ATN------------LKVSEDTL----AALEQKLEQTRSAQIIDK-NSSSRYTEAKTKYL
B4DB23          ANR------------LRLEKDKL----SGLQEMSKASRTDDIKEK-ASLVEYVDAKNKYI
A0A6B3L938      EERDFWGLKRDEMRELDIEVRTA----QTPSARAAAKDRWLSLVQSSLSARASILESRIL
A0A2V5URB2      NSA------------YLAAAGKE----RALKLQMDKQKSDALALK-DASVEYAILARETN
A0A2V2DJ66      RST------------YLTMKNNY----EMSQQRLNKKREEILQLG-RKAIVYKALERERK
R7L5A9          QAS------------YETARQNY----EQSQKRLAEKKEEILSLG-KKAIIYKSLERERM
A0A5R8KA81      ENA------------YNSALATE----QKVAQGLAEQERLALDLG-KIAIEYNALARDVE
A0A5B5WU87      LVK------------KKNIQDQH----EKTREHIRNVSSRERDVN--------YIDREQR
R7DZW0          LVK------------KKNVQDQH----EQTREHIRNVSSRERAVN--------HIEREQR
A0A2N8HID1      LVK------------KKNVQDQH----EQTREHIRNVSSRERAVN--------HIEREQR
A0A2N8HS06      LVK------------KKNVQDQH----EQTREHIRNVSSRERAVN--------HIEREQR
A0A6N2TNT9      LVK------------KRNVQDQH----EQTREHIRNVSSRERAVN--------HIEREQR
A0A3R5R2M8      DIK------------LKELNAKR----DSLAERMARTATREQELT--------PLVREHK
A0A411SUQ6      DLK------------LNQLINKR----NSLTERLTETAIKEQEII--------PLIREHK
A0A2N8HZF2      NLK------------LNQLISKR----NSLTERLTETAIREQEII--------PLVREHK
A0A354E720      DLK------------LNQLIDKR----NSLTERLTETAIKEQEII--------PLIREHK
B2UPB6          DLK------------LNQLINKR----NSLTERLTETAIKEQEII--------PLIREHK
A0A2V6JLK8      ERN------------LKTAQGTR----DELRKRLEQINAKQLQTK-NLSANYARAKNAYI
A0A2W5Z1A5      EKN------------LKTAEKTR----DELRARLNEINEKQLSTK-NLSANYTRAKNNYI
A0A2V6EA09      EKN------------LKTAQTTR----ERMDKRLAEINTRQLATK-TLSANYVRAKNAYI
A0A2V6GQI7      EKN------------LKTAQTTR----ERMDKRLSEINTRQLATK-TLSANYVRAKNAYI
A0A3C1HEJ2      ATK------------LSAAKAEE----QELKAGLSGLESRRRDLD-AAAGEYGIIQNKLK
A0A522ULD9      EAD------------YQVAKAKY----NVLEQELTTVKKTDIDAEREKYLPYNKAERKLD
A0A1V6JU76      RSE------------ARLAKASE----QILAANVKEWEDQQMEWN-KAKMQYDVLMRKAQ
A0A2A2XXW5      FQM------------AELEKSRE----VEALRKYTESVERVFALD-EAKISYDIMEQQLK
A0A6N6Q6V0      EAT------------ATIEKNTE----AQAKGKFAEAEKEVTRLS-ELKVKYDVLSRQKE
A0A1Q6UHJ9      QAA------------YEAARQNY----EQSQKRLLEKKEQILDLG-RKAIVYKSIEREKQ
A0A2V2BXR0      QAA------------YEAARQNY----EQSQKRLLEKKEQILDLG-RKAIVYKSIEREKQ
A0A2D8V0G3      REQ------------ARFANERA----DRARVTYDEAQVAMNRLN-ELKVEYDNLVMEKE
A0A348S017      REQ------------ARYQQARA----VRALDSLNARQADMNRLN-QLKVEYDNLVMQKM
A0A3C1UUV7      REQ------------ARYQQARA----VRALDSLNARQADMNRLN-QLKVEYDNLVMQKM
A0A350I3V2      REQ------------ARYQQARA----VRALDSLNARQADMNRLN-QLKVEYDNLVMQKM
A0A520RGV5      REQ------------ARYQQARA----VRALDSLNARQADMNRLN-QLKVEYDNLVMQKM
A0A3D3XF90      REQ------------ARYQQARA----VRALDSLNARQADMNRLN-QLKVEYDNLVMQKM
A0A2D7B522      REQ------------ARYQQARA----VRALDSLNARQADMNRLN-QLKVEYDNLVMQKM
A0A356NIC2      REQ------------ARYQQARA----VRALDSLNARQADMNRLN-QLKVEYDNLVMQKM
A0A2N8HDG3      KLQ------------LQELTKKR----ENIGKRLTATSGKARELT--------PLDREHR
A0A146GCJ0      SRL------------YEAAKDSE----VKLEAALQEQEAKALELN-KVAIPYNVLQRDVE
A0A2T6D6H8      SRL------------YEASRESE----MKLETALQEQEERALELD-KVAIPYNVLQRDVE
A0A3D1TI55      ASR------------YDVAQRRV----ENLEQEMDLLRNQDLERHREAFLPFERALRDRD
A0A3E1ET42      KVQ------------ISQAEQTL----AKGQELTDTKKLSTVEDR-AKQSEYATEKTKFE
A0A2A2YDW8      KIK------------RETKNVEL----VELNNRLVEVKDMSKENI-IAMTQIQNVHDEFT
A0A352XLN9      KIK------------RETKNVEL----VELNNRLVEVKDMSKENI-IAMTQIQNVHDEFT
A0A3D0YP62      THK------------LGIIEGRV----NKMREVRDKKQDEGTDRA-RAFQEFNIARKDYE
A0A3D3DV47      THQ------------LGIIEGRV----NKMREVRDKKQDEGTDRA-RAFQEFNIARKDYE
A0A2E5XJ49      RTQ------------LELVDGQL----EKLRQVVEESRFDAVDKA-LQSQDYVEAKQDYE
A0A2E6SBY8      RTQ------------LELVDGQL----ENLRKVVEESRFDAVDKA-LQSQDYVEAKQDYE
A0A2E5QMS4      KTQ------------LRLVNGQL----AKIKERVEERRFDAVDKA-LQSQDYVEAKQDYE
A0A2E7YXQ3      KTQ------------LRLVNGQL----AKIKERVEERRFDAVDKA-LQSQDYVEAKQDYE
A0A2E3H787      KTQ------------LSLVXGXL----EKIKDRVEDRRFDAVXKA-XQSQDYVEAKQDYE
A0A2E7AGN1      KTQ------------LDLVNGQL----VKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A2E7AKY7      KTQ------------LDLVNGQL----VKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A3D4CU34      KTQ------------LDLVNGQL----VKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A2E8M146      KTQ------------LSLVNGQL----VKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A355S8S2      KTQ------------LSLVNGQL----VKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A2D6DVN8      KTQ------------LNLVNGQL----DKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A3C1W2R2      KTQ------------LNLVNGQL----DKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A2E3NAY6      XTQ------------LNLVDGQL----EKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A2E3II01      KTQ------------LNLVNGQL----EKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A368B8C5      KTQ------------LNLVDGQL----EKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A3R7RBB5      KTQ------------LNLVDGQL----EKIKDRVEDRRFDAVDKA-LQSQDYVEAKQDYE
A0A2A2QX62      KVK------------LELSKEQL----ARLKSRKESTNEDAIGKG-IANQTFIDAKNEFE
A0A4Q3BWH6      KAK------------LSLSQEQL----ARLKTRMDTKEDDAVKQG-IANQTFVDAKNDFE
A0A3N5WCF1      QAQ------------LDLAVNRL----KSVEVMKDESRDEAIKRG-LDAQDYVDAKREFE
A0A4Q3C1K5      QAQ------------LDMATDRL----KNVENLKDDTREDAIKRG-LDNQDYVDAKRDFE
A0A3R8IT45      ISE------------YETAKNAD----TEARAILEQIKTESLSTD-KEGVAYQMLERDFM
A0A2A2PYE8      ESD------------FQAASRTF----KNLEEDLAKRTEDSLQLD-RAALEYNDREREYR
A0A2T6CN73      ESD------------YQSALNTY----RQNQEELKRRTQDSLAVD-HAALDYENMQRELK
A0A2G4G428      QVA------------IQNAHANY----AAIISNLDKKDDEIARLT-VANNELERVDKEIK
A0A6N6PCD8      LNA------------YQGAKEAE----AKLKTALQEQQKGGVELS-RIAIQYDELRRQVD
A0A139TV24      NLR------------LQELTRKR----EDITRRLAATSGKARKLT--------PLNREHG
A0A2N8HT11      ELK------------LQELTRKR----QDIAKRLTATSGKARELT--------PLDREHR
R7DS70          ELK------------LQELTRKR----QDIAKRLTATSGKARELT--------PLDREHR
A0A2N8HNL6      ELK------------LQELTRKR----QDIAKRLTATSGKARELT--------PLDREHR
A0A6N6PAZ1      YWD------------LAG---------KDLPDRQAHPEDYLHAARQLLLARIGVLESETQ
A0A6I1K459      SQQ------------LKAAQERE----RGLEQVLKEQEKKLNQMQ-SQRFELDRLQGDLS
A0A139TUL1      RVR------------MGELERER----DELNRGLSDMASKDEGLV--------PLLREQK
A0A2N8HCB0      EVR------------MSELEKER----DELNRLLSDMASKDEGLV--------PLLREQK
A0A2N8HP04      EVR------------MGELEKER----NELNRLLSDMASKDEGLV--------PLLREQK
A0A2N8HRJ0      EVR------------MGELEKER----NELNRLLSDMASKDEGLV--------PLLREQK
A0A6N2U9Y7      EVR------------MGELEKER----NELNRLLSDMASKDEGLV--------PLLREQK
A0A366HAG0      GVR------------ITTVERQL----EEAEKHNKDTRAKSLDSQ-AGHHEYLAAKREWE
A0A2U8DZK4      KSK------------AEEAEARV----TELKKQLEEAKASQIENASKRMRPFEEAMQKLD
A0A2T6DFL8      EIA------------YKEAEARV----AELKSQLAQAKVDQILSARDRMRPFEEAAQKLE
A0A1D8AWD4      EMA------------FKEAEARV----TELERQLAQAKVDQILSARERMRPFEEATGKLD
A0A4Q1C9S2      EMA------------YKEAEARV----TELERQLAQAKVDQILSARERMRPFEEATTKLE
A0A178IH18      EIS------------CKEAEARV----AELEKQLEEARARQITSSTDRMRPFEEAVRKLD
A0A2T6DT99      EIA------------YKEADARV----AELKNQLGQAKVDQILSARERMRPFEEALQKLE
A0A1G3ZT33      EIS------------CKEAEARV----TELESQLAQARVDQILSARERMRPFEEAATRLD
A0A3E1E2T2      EIA------------YKEAEARV----TELKRQLSQAKVDQILSARDRMRPFEEAAQKLE
B1ZMW1          EIA------------YQEADSRV----AELKNQLAQAKVAQILSARERMRPFEEAAQKLE
A0A3M1I8A3      RKS------------AELRQIEL----ANLEENLRYWEQKQQEWN-KAKTTYDVLQRKAD
A0A4V0XS84      RAD------------ARIAQSIE----AAFRKALAEQEQKLLTMN-KLKIQHDSLNRELQ
A0A351WE84      NAD------------YEVAKAKF----DALEAELQAAKHSDIEDEKKKFLPFDRAERNVI
D5ENH7          YAS------------YIEAKSNF----ELASQRLAEKESELIGLS-KVRVEYNSLLRELE
A0A0R2XQ77      SSA------------FAESKNNF----ELASQRLAEKEAELIELS-KTRVEYSSLEREMD
A0A2E9IN28      YAS------------YSEAKSNF----ELASQRLAEKEQELIDLS-KTRIEYNSLLRDLS
A0A6N4WTJ5      GAA------------YAESKSNF----ELASQRLAEKEAELIELS-KTRVEYSSLLRELD
A0A1V5QDZ6      RAN------------YEVALQRY----EVLEKELEATRASDIDSERDRFLPFDKAEREVL
A0A4Y8P964      EAD------------YEAAKKHY----ESLEEEWKEAMVKVKKEG-RLLSQYALLKREAD
A0A3D4HF88      HAA------------YVISDTNY----NHAKAEISRKEKDLIGLA-KTKVEFNAIKTDLE
A0A6N6ZHN8      KKD------------YENAKDNL----ESAKQRLATMEQEIIELD-RLRPEYNALVNDLQ
A0A351MR11      AGL------------RSSSQQRL----IAAERSLSGKEAEIARLQ-GANIELERIEKEIR
A0A6G6K641      KEQ------------YETAKETE----SRIEKEFQDQEKDTYTLG-KTQVEYDGLKRDVE
A0A5B5WI95      NLK------------LEELKKKR----ETLSERLTKTATKEQEFT--------PLIREHK
A0A2N8I9W1      NLK------------LNQLISKR----DSLTERLTETASREQEII--------PLIREHK
A0A4Q5IH27      NLK------------LNQLISKR----DSLTERLTETASREQEII--------PLIREHK
A0A2N8IBZ6      NLK------------LNQLISKR----DSLTERLTETASREQEII--------PLVREHK
A0A2N8IJW9      NLK------------LNQLISKR----DSLTERLTETASREQEII--------PLVREHK
R6J100          NLK------------LNQLISKR----DSLTERLTETASREQEII--------PLVREHK
A0A1V6J089      KAD------------YEVARQKY----EALDSELASIKATDIESESENYLPFDRAERNVA
A0A3C1BZR1      KAD------------YEVARQKY----EALDEELSLIKTSDIESEGENYLPFDRAERNVS
A0A7C4KLL2      KVD------------IEDAKINQ----EGLEKELKQLEADALRVS-QHAIQYSLLSRELE
A0A1H6KPB7      EQT------------LSLKEEGR----KSIKRAFDEVTEIVRNKT-QSDILVMSAIRDYR
A0A2E9ISN4      EAH------------YEALKLQE----AGIESVLNNWRSEQFLSV-ANQSEYKQLSSKVA
B9XAX1          QSA------------YDGALARE----NNLEAALKEVQMESLDLD-RKGIEYNVLMREVQ
A0A5R8KKM9      AFR------------ITTGERQL----AEAQKTYQEQRSKSLEAD-TNNQEYLHAKEEWE
A0A139TS01      RSK------------LEMVTASR----VKWAKIVAQKEEDLRKHV-MKMPVYEQTSREYD
A0A3E1EJT7      KAE------------YENAVQTD----EGARKALADQETKSLEID-KYAVEYDNLNRDFR
A0A317ZP96      YAG------------YIEAQKNY----EIATKRLVEKEKELIELS-RTRVEYNSLLRDLE
A0A7C3I5X9      RAD------------ARLAKASE----ASAAATVAEWENRQMEWN-RAKMEYDVLARKAE
A0A2D5WGA5      ELR------------VKSSKAQV----EQLQRDVEEAKRRESDVR-EKGREYFDAKRELA
A0A2E7SSH2      ELR------------VNSSLAQV----QELQKSVDDAKAKEAKVQ-EEGREYFDAKRKLS
A0A349GXM8      RDR------------HRALSIQL----NAIETAEYKWQAKNLTAS-QRQAEYSRLRSEVG
A0A4P5YP61      EIS------------YRGAKSSE----ETFEAALKEQEALELVLN-KQKLEFDTLSREVE
A0A6B2LYM4      EKD------------FERTEANL----RNSEDRLALNQQKLIELD-RIRPEYNALARDLA
A0A6D1VXB3      EAD------------YEAAKRHY----ESLEEEWKEAMVKVKKEG-RLLSQYALLKREAD
I0JYY7          EAD------------YEAAKRHY----ESLEEEWKEAMVKVKKEG-RLLSQYALLKREAD
A0A4R7S1J2      EAS------------LLASLESAKVNEKKLQEALAEQEKKSFELD-ALSIEYNVRKREME
A0A2A2XV69      EAN------------IRIGEDSI----TQLEQRLRESQAKQQTSK-TRASGYYEAKNNYI
A0A651H7X9      HSE------------FQTAERSV----AEARAALSNQESEALNLG-RLAVSYDSLANEAQ
A0A4Y8P842      EAE------------YEAAKKNF----ESLEEEWKRTLSKLRDEN-TLLAKYAMLKREAD
B3DZK9          EAE------------YEAAKKNF----ESLEEEWKKTLLKLKDEN-SLLAKYAMLKREAD
A0A5E6MPC4      DAE------------YEAAKRNY----AGIEQEFQKAMEKVRGET-KALSRYTILKREAD
A0A6N6PKP9      GTA------------FESTKANE----EKLEAALRGQEGIALELS-QMAIPYKSLERDVE
A0A6N6Z250      KIG------------YLEAQARV----TALEDELARARQEQIDTAGEKYRVFDDAVKDLR
A0A4V1SB02      RQQ------------YRSLTETE----EKLTEQLKKAEADALDFD-KIAYPYNALKRDAE
A0A6N6QEJ2      SAQ------------LEIARGNV----RELEKLYDSAIEKTAQEN-KSFAPYAKAKRDLE
A0A3C1VB86      QES------------LRIAYQNVLTAKQGLETQMHEVETNAMKLS-DSAVRFNVLTRELR
A0A146G2Q9      ETN------------LAIAEQGL----KSLQDKLDKVRSDWQTSK-TSSIGYYEAKNNWL
A0A2T6D3Y2      ETN------------LTIAEQGL----TSLQEKLTKVRADWQTSK-TSSIGYYEAKNNWL
A0A6N6P5E3      TAN------------LEIAQKSL----QAMEQKLSEAKTGQQDAK-TNSLHYQQAKNSYL
A0A2D5VY59      QSQ------------VNAAQNEL----NELTAAVENAKANDALKT-AKYRPYFTAKRDLE
A0A2D8UZZ4      QSQ------------VNAAQNEL----NELTAAVENAKANDALKT-AKYRPYFTAKRDLE
A0A353DV86      QSQ------------VNAAQNEL----NELTAAVENAKANDALKT-AKYRPYFTAKRDLE
A0A2E5EPT8      EAE------------AKALQSGY----DNRMTQLDKAREQNRTAA-ENGQRYMDVQKKLE
A0A6J4HTK1      EKN------------LATAGTTV----TELRRRLDDVNQKQLSAK-NTSANYTRAKNNYI
A0A6N6PHJ5      ETQ------------VSTAKSEL----DSIGKAVEDARLIDQDKL-TKTRPYFDKKRELE
A0A6M1RXR2      EVR------------VASLKERL----DSIVAEFEEARRKDIEKV-EKSRPYFEKKRELE
A0A7C3DXS4      EVR------------VASLKERL----DSIVAEFEDARRKDIEKV-EKSRPYFEKKRELE
A0A2V2SDV4      QTR------------VAAVKDSL----AKLEHEVDQAMTNDLVKA-VQSQPYFEAKRKVE
A0A2V5PK75      EAR------------VAAVQTNL----ALLQAQVDKATANDIGNS-KRWRPYFDKKRELD
A0A1V6DME1      EKR------------VASMKAYL----DSLTRNVEEAMRVDIEKA-EKSRPYFEAKQRLE
A0A3D3DIJ3      DTR------------VISLSNSL----VNLQQEVGRATTNDVTQA-NLTRPYFEAKRALE
A0A6I1K583      ETD------------LLADKATL----AERTQKLEEVKKQSREIA-ESRRVYQLAGQELE
A0A350EWA4      KND------------ALALSNNL----VELERTIAAKEAEFRQKS-SNIMPYISAKEEYL
A0A5B5WZ91      KSK------------LEMVAASR----MKWEKIVAQKEEDLRHHV-MKMPVYEQTSREYD
A0A2N8HD92      KSK------------LEMVSASR----KHWEETVALKEKALQDHV-LKVPMYEQASRDYD
A0A2N8HIT2      KSK------------LEMVSASR----KHWEATVAQKEEALQKHV-LQVPMYEQASRDYD
A0A354EBD3      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A355VEB2      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A2N8IMT3      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
R6K1U5          KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A2N8IWC2      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A2N8I441      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A2N8I3A6      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A410SCC4      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A3R5VEW0      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A411SSG2      KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
B2UKW3          KSK------------LEMVAASR----KHWEATVAQKEEDLQKHV-LQVPMYEQASRDYD
A0A7C3HWX0      ESR------------VKSLQERY----EALLKRVEEGKARVAEEA-TQQREYYALKSDLE
A0A7C4KPD7      RAL------------VEKSQAGV----VELAKHLDEAKKKDREAG-AKLMEYYSAKEELE
A0A1M6RLZ4      KDK------------LDLENQRV----QRLSKSKDSAKGERLATA-YDYTLFNALVQEYE
A0A354T7G8      QNR------------LDGAKRKR----DSFQTYNDDAKKELQDMQ-SLYNEYKTAKDEVT
A0A2S7U4L6      KVL------------LEQAGAKI----ARLQISKDASQSDAKNTA-EDYTRFQSYQDEYK
A0A512MBZ2      KNR------------FDAAKMRR----ETLQTYSKEADKEQISKG-ATYNDYKIAMDDVT
A0A2E8MEZ0      ETR------------LNLVDKQV----EKMKQMVREKKDGTVDLS-MRQHQYNSAKEEYE
A0A6B3LBV6      EIQ------------ITQLEKRL----AEAEESEDEKVEEYIAGA-LDNAEYEHYREEYR
A0A2E3EC33      ETQ------------LSMAEQQF----QNSKETKERTEKASLKER-KDNVRYIEAKKEYE
A0A2E4GN01      QTQ------------LSMAEQQF----QNSKETKERTEKASLKER-KDNVRYIEAKKEYE
A0A1Z8XU55      STQ------------LTMAEQQF----ENSRESKERTEKMSLQER-KQNVRYIEAKKEYE
A0A2E1RQR9      STQ------------LTMAEQQF----ENSRESKERTEKMSLQER-KQNVRYIEAKKEYE
A0A2E3ISQ4      TTQ------------LSMAEQQY----ENSKESKERTEKMSLQER-KQNVQYIEAKKEYE
A0A2D6W6F4      TTQ------------LAMAEQQY----ENSKESKERTEKMSLQER-KQNVRYIEAKKEYE
A0A2D8Z5A8      TTQ------------LAMAEQQY----ENSKESKERTEKMSLQER-KQNVRYIEAKKEYE
A0A4Q2YKS3      RAR------------LEMATAQL----AQVEILKGEKKGEAVRQG-IDTQDYVDAKREFE
A0A6N6P3T8      QAK------------LELAEARF----KRAQANKNDKRGEAIKHG-LDAQDYVDAKRTFE
                                                                            

A0A2A2XVF1      SDRVLYESVIKRMKETAVTG-AVDQAPYTLIEE-----PLVASLPSKPNRTRTLAMALIM
A0A2V5UHJ2      TNKQLYDGVLQRLKEIGVAA-EVRTSN-IYVMG--K--ALPPGSPSYPDKRRSMLLGVLL
A0A2V5PST3      VNKNLYDSILKRLNETTISN-DIAVSN-MQITQ--S--AERPEFPNSPNIPIDLTMYAAM
A0A2V5PXM3      SDRALYEAVLNRIKETALTK-EIKPGK-VRVIQ--H--AEVPELPAKPEKLRVILLGLLA
A0A1V5QB01      RLQSLYDLAFNRLKEIDISV-GIEPES-VQIME--R--ARPASSPVTPRKLQSIFIAALI
A0A7C5LI63      RLRSQHRALLNQITTLDVRQ-GFRYRN-ISVLE--P--AIVEPQPVYPKKTKGLMVAAFL
A0A7C5P291      RVQTLYNTLLGKLMQIDVTQ-SFNTRS-ISVLE--P--ALIEQDPVFPKKTKGLLLAAVF
A0A139SU05      VARANYMQILDRLNQTTTTK-YLEKVP-IRLLD--R--AQVSGRPYTPNFPKIVRMCVMM
A0A139SPN4      VARSNYMQILDRLNQTTTTK-YLEKVP-IRLLD--R--AQVASHPYTPNFPKIIRVCVMM
A0A1V6E7N1      VAQKNYIDILDRLNQTTTTK-SLEKLP-LQPLD--R--AVPAGAPFTPDLARIIRTSSLL
A0A2D9MYT1      QSETMYNLALQRXKETELQE-KDIVQN-MHVID--L--ATAQMHAIKPKKLLTAFLGIIG
A0A258ANJ7      SDQAVYESVLTRIKQVDVSK-GMETPP-IWVHQ--L--AMVPGDPVSPNAKKVVGSSTAG
A0A290QGD9      IEEQVLQHLMGRMRETTMSS-TLDTQN-ARV--IDRAFPSQPEQYVKPVILLNLGLGLVG
A0A1D8AS58      INEHLLNTLLSRMRETSMSS-TIETQS-ARV--VDRASPALKP--ASPNVLLNLALGFLG
I6AQC1          VNSSILDNTIKRIRELDITS-TIEGQN-IQISPISRAVPAREDQYVEPRIVLNLAGGFVL
W0ITH7          INREILDRTIGRIREIDLTS-TIEGQN-VQIRPISRAVPAREDEYVEPRIVLNLAGGFIL
A0A139TLN4      VRESLYIFLLNKREENSLAL-AATEDN-ARIVD--A--VRGGDGPLAPNVPKILLVGFLV
A0A1G3ZFT0      MKNALNTILLSKIQEMKIIQ-AGLLSD-VRILS--Y--AKIPDSAVPIERAKLYGGSIII
A0A1Z8ZMT6      TKNELYNTLLSRVGVLKTDAEGVEAEV-IKHED-----APRAWAPFSPNRKKIMIKNTLL
A0A2E8MCT7      TKNELYNTLLSRVGVLKTDAEGVEAEV-IKHED-----APRAWAPFSPNRKKIMVKTTML
A0A290Q2Z2      DETRLLSTLKVTLRQREIDF-QVPKRS-IEILN--Y--AEPARRAAKPSWPLNIAFAVLF
A0A2A2RGK2      TDQALYNSVISRLKEVDVSK-QLTESP-VRIHE-----TAVGAGPIRPSATKKWIQSLLG
A0A2A2XXF7      TDQALYNSVLSRLKEVDITK-QLTESP-VRIHE-----PAVGAAPIRPSATKTWIQNLLG
A0A2A2R5D6      RQQLLYDQFVIRKKQSVVDK-QITNDP-ATIIS--K--AEPNDMPFRPNLTINLIASGVA
A0A1J4XH17      VNQGLYQSMVLRLNTEMAQI-DLKKPS-ARIID--F--AVAPGHPAKPKKVIILALGLMG
A0A3C1VJ32      QLLDSHKLLYTKIVIDTIDA-QIPKTTMVEVID--R--AEPGKAPVKPNKTLNITLGLIF
A0A2N9NTX7      EQEHFRAILDLKIISEKVDL-SLPKTTMVEIVD--R--AVAPLFASSPNKTLNIALGVIV
B9XK55          HLKKFREILEFRAAQEQVDR-ALPKTTMVQIVD--T--AEEIDKPVRPNKALNIALGIII
A0A4P5YMI6      QLERMRDSLKFKIQQEDIDM-DMPKTSMVEITD--A--AELPVKATRPNIPLNIALGVIV
A0A2E6T482      NTTRIRDTILLRIMQEEVDL-ELPTESTVEIID--D--ADXPDKAIKPNIPLNISLGVVV
A0A3C0DQZ7      NTTRIRDTILLRIMQEEVDL-ELPTESTVEIID--D--ADVPDKAIKPNIPLNISLGVVV
A0A1Z9CBK5      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADTPLNPVRPNKPLNIALGVIV
A0A2D6ZI96      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADTPLNPVRPNKPLNIALGVIV
A0A358KGZ3      NTTRMRDTILFRIMQEEVDL-DLPKTSSVEIID--K--ADTPLRAVRPNVPLNISLGVIV
A0A2E9ZQX4      NTTRMRDTILFRIMQEEVDL-DLPKTSSVEIID--K--ADTPLRAVRPNVPLNISLGVIV
A0A3D5JZU0      NTTRMRDTILFRIMQEEVDL-DLPKTSSVEIID--K--ADTPLRAVRPNVPLNISLGVIV
A0A2E6HCR0      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADNPIRPVRPNIPLNIALGVIV
A0A1Z8WN04      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADNPIRPVRPNIALNISLGVIV
A0A2D7L1N4      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADNPIRPVRPNIALNISLGVIV
A0A2E2R937      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADNPIRPVRPNIALNISLGVIV
A0A520QQY4      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADNPIRPVRPNIALNISLGVIV
A0A2D5MR66      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADNPIRPVRPNITLNIVLGVIV
A0A2E0PDQ1      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADNPIRPVRPNITLNIALGVIV
A0A2E2ZZP9      NTTRMRDTILFRIMQEEVDL-DLPKESSVEIID--K--ADNPIRPVRPNITLNIALGVIV
A0A7C4LRK7      LDRQLMSTLKLRVSSATLDNLKIGYSSTVKMVD--V--AEPGLRPERPKKILNITLGVIA
A0A2A2RGF2      DLKRLRATMNAKIIVEESDV-AMSRSNSVRVTD--F--AEAAIKAAYPKMVLNVALGAFV
A0A2G4I5Y6      DLKRLRATMNAKIIVEESDI-DMSRSNAVRVTD--F--AEAAIKAAYPKMPLNVALGAFV
A0A6N6PS97      TENKIRETIFLRILQETVDD-KIPKNGMVDIVN--R--AKPDETAVRPNVPLNITLGVIF
A0A3M1I883      NEQRIRDTLLLRTLQETIDS-ALPTESVVEVTD--P--AVPALKPVRPDLFLNLVLGVVF
A0A1V6JZ45      NKQKIRDAILMRMLQEEVDA-ELPKESMVRIVD--P--AEPALRPVRPNIPLNIALGIMV
A0A7C7Z746      ELKKIKASLHIRLLAEQVDV-NIPTAAIVDIID--P--AVKSLKPDRPNIPLNLALGIVF
A0A520RRW5      NLSKISDMIMIRILQETVDA-ALPTDSIVEIYD--P--AEPNPDPVRPKIFLNIALGVVV
A0A356NPK0      NLSKISDMIMIRILQETVDA-ALPTDSIVEIYD--P--AEPNPDPVRPKIFLNIALGVVV
A0A2D7B5P5      NLSKISDMIMIRILQETVDA-ALPTDSIVEIYD--P--AEPNPDPVRPKIFLNIALGVVV
A0A3D3XGB5      NLSKISDMIMIRILQETVDA-ALPTDSIVEIYD--P--AEPNPDPVRPKIFLNIALGVVV
A0A2V6F8A1      NLQKLRDAVHLRVLQETVDA-ALPKTSIVEITD--H--AEPGRKPVSPDFKLNIILGILV
A0A2V5TNH4      DLTKLRDAVHLRILQETVDA-ALPKTSIVEITD--Q--AEPGRKPVSPSFKLNIALGIIV
A0A2V5X5Q6      DLQKLRDAVHLRILQETVDA-ALPKTSIVEITD--N--AEPGRRPVSPNFKLNIALGIIV
A0A4P5QM05      MTKTLLFEIRRQYDKAKMNN-ILTQIP-VKIWQ--R--AQPGLYHEKPSVILYTIIAAIF
A0A4Q3C001      NAKKILEAAELRYSTARMER-GVDIDP-ARIKE--K--AEPPMGYAKPPVKLYLTLAALI
B4DB23          QARKLYESVELSYVTQKMNN-SVKGDS-AKIWE--K--AEKAEYPSEPNVPAYMGMAAII
A0A6B3L938      NQRRLYETVTNRLTEIDVAD-ETSNAE-VTVFE-----EASIPPPSKYKHLITLAAGTVL
A0A2V5URB2      TNSQLYDGVLERFKEINVAG-EIPASN-ISILD--R--AEIPRQPSQPQKRRNLMLGALL
A0A2V2DJ66      VAEGMHAEFIAAMNVRLAQV-SLITDT-AKVID--K--AGISPLPSSPNYILNFVGGFIL
R7L5A9          VAEGMHASLISAMNVRTAQV-SLINEG-ASIID--R--AAPALRPSSPNYVLNIILGIIA
A0A5R8KA81      SNQALYASVQKRLKETDITR-TIEFAP-WRVVE--T--PQVAEDPSKPRKMRTWLIGLGV
A0A5B5WU87      VRESLYVFLLNKREENSLAL-AATEDN-ARMVD--G--VRGGAGPLAPNVPKILLVGFLV
R7DZW0          VRESLYVLLLNKREENSLAL-AATEDN-ARMVD--G--VRGGNGPLEPNVPKILMVGFLA
A0A2N8HID1      VRESLYVLLLNKREENSLAL-AATEDN-ARMVD--G--VRGGNGPLEPNVPKILMVGFLA
A0A2N8HS06      VRESLYVLLLNKREENSLAL-AATEDN-ARMVD--G--VRGGNGPLEPNVPKILMVGFLA
A0A6N2TNT9      VRESLYVLLLNKREENSLAL-AATEDN-ARMVD--G--VRGGNGPLEPNVPKILMVGFLA
A0A3R5R2M8      VKEELYLILLSKEQENAMAL-AATEAS-ARVLE--S--AHGPDIPIAPQTVQYLAAGILG
A0A411SUQ6      VKEELYLMLLSKEQENALAM-AVTESN-ARVLE--T--AHGSNLPISPKTIKYVAGGTAG
A0A2N8HZF2      VKEELYLMLLSKEQENALAM-AVTESS-ARVLE--T--AHGPNIPISPKTIKYVAGGTAG
A0A354E720      VKEELYLMLLSKEQENALAM-AVTESN-ARVLE--A--AHGPNLPISPKTIKYVAGGTAG
B2UPB6          VKEELYLMLLSKEQENALAM-AVTESN-ARVLE--T--AHGSNLPISPKTIKYVAGGTAG
A0A2V6JLK8      KEKTLFDGVRTRAQTQTMEM-AMPRFA-VSVKQ--V--AEAPSYPARPRVGLNLTLGMLV
A0A2W5Z1A5      KEKLLLDSVRQRAQTQTMEM-AMPRVA-VSVKQ--V--AEPPTFPARPRVGLNLALGGLI
A0A2V6EA09      KERLLLDGIRMRAQTQTMEL-AMPRIA-VSVKQ--V--AEPPNFPARPRVVLNLALGALV
A0A2V6GQI7      KERLLLDGIRMRAQTQTMEL-AMPRIA-VSVKQ--V--AEPPNFPARPRVVLNLALGALV
A0A3C1HEJ2      FNRELYERIVKERQVTKVVQ-TLNKDP-VAIEQ--R--ATVPERPIKPNRKQVMLMGALA
A0A522ULD9      TERAVLNALKARLAQQGIEL-QIPRTP-VEVID--P--AEPSNVPVSPNLFFNVLVGIIA
A0A1V6JU76      SSKALFDTVLAKMKEIELVQ-RDKGNN-IRVID--Y--AYAATMPVKPRVLLTLFLGAFG
A0A2A2XXW5      RVEGFYQTILTKAKDFDIGA-KDLLQN-MKVQD--P--AFAPLKPVSPNKPLIFVGSVVG
A0A6N6Q6V0      RSEAMFQLILNKTKEYDLSS-KDIVQN-MTIID--H--ADLPSRPVKPNKPLIILASTMV
A0A1Q6UHJ9      VAEGMHAAFIASMNVRLAQV-NLINEG-ANIID--K--ASPGIRPVRPNIPMNITLGILG
A0A2V2BXR0      VAEGMHAAFIASMNVRLAQV-NLINEG-ANIID--K--ASPGIRPVRPNIPMNITLGILG
A0A2D8V0G3      QSEQLYTAMLAKTKEMDLNT-KDMMQN-LEVVD--L--AYEPFNPIKPRKALTLLLGLVG
A0A348S017      QSEELYTSMLAKTKEMDLST-KDMMQN-LVVVD--K--AFEPINPVKPRKSLTLALGVIG
A0A3C1UUV7      QSEELYTSMLAKTKEMDLST-KDMMQN-LVVVD--K--AFEPINPVKPRKSLTLALGVIG
A0A350I3V2      QSEELYTSMLAKTKEMDLST-KDMMQN-LVVVD--K--AFEPINPVKPRKSLTLALGVIG
A0A520RGV5      QSEELYTSMLAKTKEMDLST-KDMMQN-LVVVD--K--AFEPINPVKPRKSLTLALGVIG
A0A3D3XF90      QSEELYTSMLAKTKEMDLST-KDMMQN-LVVVD--K--AFEPINPVKPRKSLTLALGVIG
A0A2D7B522      QSEELYTSMLAKTKEMDLST-KDMMQN-LVVVD--K--AFEPINPVKPRKSLTLALGVIG
A0A356NIC2      QSEELYTSMLAKTKEMDLST-KDMMQN-LVVVD--K--AFEPINPVKPRKSLTLALGVIG
A0A2N8HDG3      VKEELYLTLLSKELENDLTL-ALTESS-ARVLE--A--AHGSDSPIAPNTRKSVLTAAAG
A0A146GCJ0      SDRALYESVTKRLKETAITQ-GIEQAP-YRVIE--E--PMVPNVPSKPRIKLILLVSLVA
A0A2T6D6H8      SDRALYESVTKRLKETAITQ-GVEQPP-FRIIE--E--PMVPSAPAKPRVKVILAAGLLL
A0A3D1TI55      AAKQVLTALEHRVAQEVIEL-EIPSTP-VEVVE--T--AVEPRSPFSPSWTLNILASIFG
A0A3E1ET42      MQRQLLQQVKEHSMKTAVDK-EVPRKP-IEVLQ--V--ATPEPRPSKPNMMLLFSIGAGL
A0A2A2YDW8      TQQKLLDEMKQKLTTDRINL-RQPQNI-IQLHE--E--PVVARFPSSPKVNIALILGAVV
A0A352XLN9      TQQKLLDEMKQKLTTDRINL-RQPQNI-IQLHE--E--PVVARFPSSPKVNIALILGAVV
A0A3D0YP62      TAQGIKDQMQIKYDIEKTKL-AIPPTN-IIIHQ--I--PEINDIAVSPNIPLNLALGAVV
A0A3D3DV47      TAQGIKDQMQIKYDIEKTKL-AIPPTN-IIIHQ--I--PEINDIAVSPNIPLNLALGAVV
A0A2E5XJ49      TAKAMLSQMKITNSARRIAL-KIPKNP-ITILE--E--PKQAKDAVYPKVSLFLGLGAAV
A0A2E6SBY8      TAKAMLSQMKITNSARRIAL-KIPKNP-ITILE--D--PKQAKDAVYPKVSLFLGLGAAV
A0A2E5QMS4      TAKAMLSQMKLTNSARRIAL-KIPKNP-ITILE--D--PKMSKNPVYPKVTLFLSLGAAV
A0A2E7YXQ3      TAKAMLSQMKLTNSARRIAL-KIPKNP-ITILE--D--PKMSKNPVYPKVTLFLSLGAAV
A0A2E3H787      TAKAMLSQMKLTNSARRIAL-KIPKNP-ITILE--D--PKLGKXPVYPKVTLFLSLGAAV
A0A2E7AGN1      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITLLE--N--PKIGMDPVYPKVTLFLSLGAAV
A0A2E7AKY7      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITLLE--N--PKIGMDPVYPKVTLFLSLGAAV
A0A3D4CU34      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITLLE--N--PKIGMDPVYPKVTLFLSLGAAV
A0A2E8M146      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITILE--H--PKIGMDPVYPKVTLFLSLGAAV
A0A355S8S2      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITILE--H--PKIGMDPVYPKVTLFLSLGAAV
A0A2D6DVN8      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITILE--E--AKIGMDPVYPKVTLFLSLGAAV
A0A3C1W2R2      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITILE--E--AKIGMDPVYPKVTLFLSLGAAV
A0A2E3NAY6      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITILE--D--PKIGMDPVYPKVTLFLSLGAAV
A0A2E3II01      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITILE--E--AKIGMDPVYPKVTLFLSLGAAV
A0A368B8C5      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITILE--E--AKIGMDPVYPKVTLFLSLGAAV
A0A3R7RBB5      TAKAMLSQMKLTNSARRIAL-KIPKTP-ITILE--E--AKIGMDPVYPKVTLFLSLGAAV
A0A2A2QX62      SALRLLETLQAKEIVERMQD-KVTDDP-IIIHE--E--PVVSQVPVSPNVTLNLALGTVV
A0A4Q3BWH6      TAQRLLEQLKVKLISEEMQT-KITEDP-IIMHE--E--PMISQVPVSPNVTLNLTLGAIV
A0A3N5WCF1      TDQQLLETMKLKQMGETISR-KIPGES-VEVHD--P--PVISNSPVSPNVTLNLVLGAVV
A0A4Q3C1K5      TDQELLQQMRLKQIDRNIRE-KMTNDS-IVMHE--E--PQIAQGPVSPNVTLNLVLGAVV
A0A3R8IT45      MNEQLFLKTVERIKETELTN-TIEAQN-VQVMPLARAVQPREDEYVEPRIVLNLAAGFVL
A0A2A2PYE8      TNEKILDAIVARSRETSMTS-GITTQN-ARIVDKAA--PSPESKPISPNVPLNLGLGIAG
A0A2T6CN73      IQEDILTTITARRTETSMSS-NIATQN-ARIIDLAQ--ESPEGRPISPNVPLNLGLGVIG
A0A2G4G428      SQEDFLSRQKQSFEEAKIRS-STTGTT-TSIKVLDS--PSVADRPTNKNFYLNAIIGLAM
A0A6N6PCD8      SDKLLYESVLTRAKETKVGE-AIENSN-IRIVQ--D--PLVPKDPSKPKIPLILAVSVAL
A0A139TV24      VKEEYYLTLLTKEQENELAL-ETTPSS-ARVLE--T--AHGSNAPIAPNTRKFVLGGAAG
A0A2N8HT11      VKEELYLTLLSKELENDLTL-ALTESS-ARVLE--S--AHGTDYPISPNTRKSVLTAAAG
R7DS70          VKEELYLTLLSKELENDLTL-ALTESS-ARVLE--S--AHGTDYPISPNTRKSVLTAAAG
A0A2N8HNL6      VKEELYLTLLSKELENDLTL-ALTESS-ARVLE--S--AHGTDYPISPNTRKSVLTAAAG
A0A6N6PAZ1      SATTVFNTMLTRIKESSVNQ-ESEESS-AEVSN--L--ARVSGLPTAPIPSKILAGGTVG
A0A6I1K459      SQRKLYDAVIQRLREIDLTG-GMKKND-VRIIE--P--ANLPSSPIRPNKRMILIYSLAM
A0A139TUL1      VMEELYLMLLKKREENALAL-ATTEPS-ARILE--P--AFGSNSPVAPKLPLMTLGGMAG
A0A2N8HCB0      VMEELYLMLLKKREENALAL-ATTEPS-ARILE--P--AFGSNAPVAPKLFLMTVGGMTG
A0A2N8HP04      VMEELYLMLLKKREENALAL-ATTEPS-ARILE--P--AFGSNAPVAPRLPLMTMGGMAG
A0A2N8HRJ0      VMEELYLMLLKKREENALAL-ATTEPS-ARILE--P--AFGSNAPVAPRLPLMTMGGMAG
A0A6N2U9Y7      VMEELYLMLLKKREENALAL-ATTEPS-ARILE--P--AFGSNAPVAPRLPLMTMGGMAG
A0A366HAG0      TLQQDTAKLKDTKAQKEIER-DGSKTP-ITVYQ--P--AEPDTTPSKPNVKLNLLLGGII
A0A2U8DZK4      EATRLYTTFKLTLRQREIDY-NQPKRP-VEILS--K--AEPKLEPERPSWPINITFAILF
A0A2T6DFL8      DETRLLTTLKLTLRQREIDF-QVPKKT-IEILN--T--AEAPRFPIRPSWPLNLTFAFVF
A0A1D8AWD4      DEQRLLTTLKLTLRQREIDF-QVPKKT-IEILN--T--AEPARFASRPNWPLNILFACVF
A0A4Q1C9S2      DEQRLLTTLKLTLRQREIDF-QVPKKT-IEILN--T--AEPASYASKPNWPLNILFAFVF
A0A178IH18      DETRLLSTVKLVLRQREIDY-QVPKRT-IEILN--T--AEPARRAARPSWPLNLTFAFLF
A0A2T6DT99      DDTRLLSTTKLTLRQREIDF-QVPKRT-IEILN--V--AEPARRASRPNWSLNLVFAVLF
A0A1G3ZT33      DEARLLTTLKLTLRQREIDF-QVPKRT-IEILN--Q--AEPARRPSRPNWPLNIFFALLF
A0A3E1E2T2      DETKLLTTLKLTLRQREIDF-QVPKRT-IEILN--T--AEPARRPSRPSWPLNSAFAVLF
B1ZMW1          DETRLLTTLKLTLRQREIDF-QVPKRT-IEILN--T--AEPPRYPSRPNWTLSIALALVF
A0A3M1I8A3      ASRALFNMVLSRLSEAEVMQ-RDTANN-INIVD--P--ATIPTEFVKPNIPVVLTAGVLG
A0A4V0XS84      QSKLLYEKITSRLKEIEVTG-NIKDKN-FTVVD--L--ADAPLKPIKPSVGLTLLLGILG
A0A351WE84      IQRDILNALRARITQQGIEV-EVPRTP-VEVVE--P--AEPANKPSSPLVMLNILLSIFL
D5ENH7          VQQSFFQALNSRMTQEQAQV-SLKEAS-ARIVDKAF--APLRH--SSPNILMNLAAGIFG
A0A0R2XQ77      VQQGFLQALVGRMTQERAAV-NLKNPN-SRVIDQAF--PPLRH--SSPNIAMNLAAGFFG
A0A2E9IN28      VQQNFFQALNSRMTTEKAQV-NLKNPN-ARIVDEAF--PPSEDNPSSPNVTMNLAAGFFG
A0A6N4WTJ5      VQQGFLQALVARMTQEKAQV-NLKNPN-SRVIDEAL--PPLRH--SSPNIVMNLAAGLFG
A0A1V5QDZ6      VQRQILDALRARIAQEGIAV-EVPRTP-VEIVD--P--AVPPSRPVSPNLFLNILLSVLL
A0A4Y8P964      TDREMYTSLLKRLKETDITS-ALNSGN-IEVVE--T--SAIPKIPIKPQKTRNILFALVF
A0A3D4HF88      ANRDLHRAMVLRLNTEIAQV-NLKNPT-ARIVD--K--ATPPIYPSHPKILLNLFLGFSG
A0A6N6ZHN8      ISKQMYDVYQSRLQQATVAN-RVETPN-ARILE--R--AGLPRRPVSPNVPFNMLLGLVL
A0A351MR11      LGEDFLNRLKLSYEDAKLRT-STTGTS-TSVRILDT--PVVSERPINKNYYLNVFVGIGL
A0A6G6K641      QDIAVFNGVLSSLKQSDVSK-GFETDS-VEIVE--P--AVASYAPVRPDKRKILLQWSIG
A0A5B5WI95      VKEELYLNLLSKEQENAMAL-AAAESS-ARVLE--T--AHGSDLPIAPKTEQYIAAGTLG
A0A2N8I9W1      VKEELYLMLLSKEQENALAM-AVTESS-ARVLE--T--AHGPNFPISPKTIQYIAGGTAG
A0A4Q5IH27      VKEELYLMLLSKEQENALAM-AVTESS-ARVLE--T--AHGPNFPISPKTIQYIAGGTAG
A0A2N8IBZ6      VKEELYLMLLSKEQENALAM-AVTESS-ARVLE--T--AHGPNFPISPKTIQYIAGGTAG
A0A2N8IJW9      VKEELYLMLLSKEQENALAM-AVTESS-ARVLE--T--AHGPNFPISPKTIQYIAGGTAG
R6J100          VKEELYLMLLSKEQENALAM-AVTESS-ARVLE--T--AHGPNFPISPKTIQYIAGGTAG
A0A1V6J089      VNRDILTALRARITQTGIEV-EVPRTT-VDIVE--E--ADPPDRPSSPLVVLNIFLSVVL
A0A3C1BZR1      VNRDILTALRARITQTGIEV-EVPRTA-VEIIE--E--AEAPQRPSSPLVVLNIFLSVVL
A0A7C4KLL2      ADRALFDSVLNRLKETSLAA-EQQPEK-LRFIQ--P--AIPPAKPFLPNARRTYGFALLI
A0A1H6KPB7      TEKSRYEDLENEYINQTMNR-RASRPI-IQIHT--Q--AREAKVPSSPNVKMNLILGAVV
A0A2E9ISN4      HFERKYNLVYGRL----LEN-TGTTEP-FFLRKIQA--PQASEKPIKPQVIKIIAASLFL
B9XAX1          SDLALYDSVLKRLKETDLSK-GLEKAS-IAVVE--P--AMLPGATVKWSLLLVIGGAVVT
A0A5R8KKM9      GLNRDLWKLRDTLAQQQIER-DIPATP-FTIHK-SA--DEPETAPAKPNVKVNLALGAVV
A0A139TS01      TALDQLKTLDARYKDEIARL-RVPRES-VEMYD--N--PLLPTAPYKPDVTLNLAVGAVA
A0A3E1EJT7      VNEQLLESMMSRMRETSVTS-SIETES-ARIID--R--AYEPGNPVSPKVFFNLTLGVLA
A0A317ZP96      VEQNFYQALNSRMTTEKAQV-NLKNPN-ARIVDEAY--PPADDNPSSPNVVMNLAAGFFG
A0A7C3I5X9      TKKALYNAVLARMSEMDLTQ-KDRVNN-IRQVD--P--AVAPARPVKPNVPVTLAAGVVG
A0A2D5WGA5      NTTRIRDTILFRIMQEEVDL-ALPKSS-T-VQIIDD--ADLPEKPVKPNIPLNIALGMVV
A0A2E7SSH2      NTTRMRDTILFRIMQEEVDL-DLPKTS-S-VEIIDK--ADIPLRPVRPNKPLNIALGVIV
A0A349GXM8      RLAAHYNTLYTRLHDMRVSE-ELKSEH-FVPED-----ITTREDPVWPDPLKILMAALAG
A0A4P5YP61      SDRGLYENVMKKMKESQISK-ELQSDK-LRVIQ--P--AIAPERPSKPQKVKIMAAAVLV
A0A6B2LYM4      ISQELYNHYYNRLQQAAVKV-TTEGQT-ARIID--R--AVEPVRPFKPNITMNLAIGLVM
A0A6D1VXB3      TDREMYTGLLKRLKETDITS-ALNSGN-IEVIE--T--SPIPKVPVKPQKIRNILFALVF
I0JYY7          TDREMYTGLLKRLKETDITS-ALNSGN-IEVIE--T--SPIPKVPVKPQKIRNILFALVF
A0A4R7S1J2      SDKAVYESVISRLKEVDLTK-GMDQSK-LKLHQ--L--PSAPGYQIWPQPSRIISSGVGG
A0A2A2XV69      QAKKILEAAEMRLSTETMQR-TMPQDP-TVIWE--R--AEPAEYPSRPRVLLNMILGVVV
A0A651H7X9      VNELIYQSIVARMRETTMTS-TLESGN-ARVVD--S--AMVPLRPASPNVRLNLGLGLLG
A0A4Y8P842      ANQQMYMGLLKRLKETDITS-ALNSGN-IEVVE--T--SPIPKKPVKPKKMLNLLLALFG
B3DZK9          ANQQMYMGLLKRLKETDITS-ALNSGN-IEVVE--T--ASIPKKPVKPKKMLNLLLGLFG
A0A5E6MPC4      TDREMYVGVLKRMRETDITS-AINASN-VEVLE--H--ASVPQSPSRPKKGRNLLLGFLG
A0A6N6PKP9      ADRTLYDALVARLKETDVAQ-GVSRFA-VRVAT--P--AMLPERPVKPKKSLTLIFGALG
A0A6N6Z250      EAETVLRSMRLQLRQREIEL-QVPKRT-IELLN--L--AAPPAKAGRPNWALNLSLAGFL
A0A4V1SB02      TNRSLHDSIMTRMKEIDITS-TLAKSP-YKVIE--E--PLINAAPVRPNPKKIMSIAGLL
A0A6N6QEJ2      FSMQVRQSMRLQLNQELING-QISKKS-S-VQVIDR--ALQGLTPVRPNKPLFVAAGAIF
A0A3C1VB86      SDQALFDSVIGRLGETSVAG-QITAER-IRVIQ--P--ALVPELPASPKIKLIFALALFG
A0A146G2Q9      QARKVLEAAQTRLATEKMEQ-TIPQSP-TTIWE--S--AEISLVPAKPNVVLNMVLGVIV
A0A2T6D3Y2      QARKVLEAAQTRLATEKMEQ-TIPQSP-TTIWE--T--AEISLVPAKPNVVLNMVLGVIV
A0A6N6P5E3      KAKRILESAETRYSTEAMQR-TMPQSP-ATIWE--K--AEVSDFPAKPKVAQNMIVAVAV
A0A2D5VY59      NLSKISDMIMIRILQETVDA-SLPTES-I-VEIYDP--AEPNDEPVRPKKVLNIALGVLV
A0A2D8UZZ4      NLSKISDMIMIRILQETVDA-SLPTES-I-VEIYDP--AEPNDEPVRPKKVLNIALGVLV
A0A353DV86      NLSKISDMIMIRILQETVDA-SLPTES-I-VEIYDP--AEPNDEPVRPKKVLNIALGVLV
A0A2E5EPT8      RLERIRDTIELKIESEEIDA-DIGRTA-A-VEVIDP--AEPAIRPAKPKVALNIALGVVL
A0A6J4HTK1      KERALLDGVRMRTQTQTMEL-AMPRMA-VSVRQ--I--AEPPSFAARPRVTLNLALGALV
A0A6N6PHJ5      ELNDLRRLITRKKNIEEVDL-KLPKSE-Q-VVIIEK--ALASTKAVKPNKTLNIILGVVI
A0A6M1RXR2      NLVAFQRVLENKLKAERIDV-DLPKTA-M-VTIVEQ--AQPGLRPVQPKKGLNIALGVIF
A0A7C3DXS4      NLIAFQRLLENKLKAEKIDV-DLPKTA-M-VTIVER--AEPGLRPVQPNKTLNIMLGVII
A0A2V2SDV4      EAETKLKLLTMKIYTEKLDN-ELPKTA-M-AFITTH--AVPDAHAVRPNKPFNIALGIIV
A0A2V5PK75      EQQRFRQILTMKIASEKIDQ-KLPKTL-M-VEIMDK--AEPGTKPVKPNKALNIALGIII
A0A1V6DME1      EVMRFRSILNLKLAQERIDV-DLPRTA-M-VEIVDT--AKPGLRPVRPNKPLNIALGVII
A0A3D3DIJ3      ELQRFRQVLDAKIAFEKIDV-ELPKTL-M-VEVVDR--AMPGLRPVRPNKPLNIALGIII
A0A6I1K583      RQQRLRETVENKIKVEELDR-DIKRTT-A-VRVTDF--AEPAVKPASPKVVLNIALGAFV
A0A350EWA4      RRRNVRDSVAMKIAQEKINY-ALNSTF-I-VGVINP--AEEGLRPVRPNKTLNIALGVIV
A0A5B5WZ91      TALDQLKTLDARYKDEIARL-RVPRES-IEMYD--N--PLLPSAPYKPDVTLNLAVGAVA
A0A2N8HD92      AALDQLKDLSSRYTDEIARL-RVPRDA-VEMYD--L--PEYPAVAYKPSITINLAVGASV
A0A2N8HIT2      AALDQLKDLDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPAAPYKPNVTINLAVGAGA
A0A354EBD3      AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPVAPYKPNVTINLAVGAGA
A0A355VEB2      AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPVAPYKPNVTINLAVGAGA
A0A2N8IMT3      AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPVAPYKPNVTINLAVGAGA
R6K1U5          AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPVAPYKPNVTINLAVGAGA
A0A2N8IWC2      AALDQLKELDSRYKDEIARL-RVPREV-IEMYQ--L--PTYPVAPYKPNVTINLAVGAGA
A0A2N8I441      AALDQLKELDSRYKDEIARL-RVPREV-IEMYQ--L--PTYPVAPYKPNVTINLAVGAGA
A0A2N8I3A6      AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPVAPYKPNVTINLAVGAGA
A0A410SCC4      AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPVAPYKPNVTINLAVGAGA
A0A3R5VEW0      AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPAAPYKPNVTINLAVGAGA
A0A411SSG2      AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPAAPYKPNVTINLAVGAGA
B2UKW3          AALDQLKELDSRYKDEIARL-RVPREA-IEMYQ--L--PTYPAAPYKPNVTINLAVGAGA
A0A7C3HWX0      KEERVYDALYLRTLQEKFDA-KIPAGQ-SIVAMVDK--AEPGLRPVRPNLMLNLALGSVF
A0A7C4KPD7      TARTVKNALAMRIQAAILDN-QKIQYS-V-VKMVDQ--AEPVLRPVRPKKILNISLGVVA
A0A1M6RLZ4      QARAVLSQIKINLTNELLKD-NLMVDP-IRFSKVPS--EPAADEYVSPNWTLNMALGAVA
A0A354T7G8      YLEDLLVKMRSRFFEEKAGI-ELVKSP-ATIYA--E--AEPEGKPAKPNVPLHLALGGVL
A0A2S7U4L6      DSVNNLNTLRTSNVIEELQE-NMSIEP-IEFYSYPQ--EPEVADYVSPNWILNMALGSVA
A0A512MBZ2      YIEALLLKFRESYSENNASL-QLVKSP-ATIYA--K--AEAEGRPSKPNISLNLALGGVL
A0A2E8MEZ0      QSRMMYREMSVKQQQQRVLL-KMPRTP-ITLHE--R--AKKAKAPAYPNVTLNLLLGAGV
A0A6B3LBV6      TEKELLKALTMSTYTKKIEE-NKALRP-VSVLD--K--AVAGDFPVTPNKPLNLILGSVL
A0A2E3EC33      LCKEMLNGMQSQLAKEKIDA-AGQRTP-MVIHEIAE--AADPGNPARPNIKLHLVLGATV
A0A2E4GN01      LSKEMLNGMQSQLAKEKIDA-AGQRTP-MVIHEKAE--ASDPDNPARPNIKLHLVLGAAV
A0A1Z8XU55      LSKEMLNGMQSQLAKETIDK-EGQRTP-LVIHEQAE--PSDVDKPARPNIKLHLVLGAAV
A0A2E1RQR9      LSKEMLNGMXSQLAKETIDK-EGQRTP-LVIHEQAE--PSDVDKPARPNIKXHLVLGAAV
A0A2E3ISQ4      LSKEMLNGMQSQLAKETIDS-AGQRTP-LVIHEEAE--PQDVDKPARPNIKLHLVLGAAV
A0A2D6W6F4      LSKEMLNGMQSQLAKETIDS-AGQRTP-LVIHELAE--PQDVDKPARPNIKLHLVLGAAV
A0A2D8Z5A8      LSKEMLNGMQSQLAKETIDS-AGQRTP-LVIHELAE--PQDVDKPARPNIKLHLVLGAAV
A0A4Q2YKS3      TDLELLQTMKLKYITEKASG-KLNGES-IAVHE--E--PVIAASPVSPNVTLNLVLGAVV
A0A6N6P3T8      SEQEMLQQMKLKLIGEEISG-KMPNDS-IVVHD--E--PVSAQSPVSPNVTLNLILGAVI
                                                                            

A0A2A2XVF1      AFFFAIGAVIFFDSLNSSLRSVDEAESFLHLPALVGIPNRTLKGFSQLKQTLERECAALP
A0A2V5UHJ2      GLAAGIGLAFFLEQLDNTLKSPEEAERYLRLPSLAMVPDFVSVNGTNG------------
A0A2V5PST3      GLFIGAGLAFFLEYLNSRLETPEHVWRAVDLSTFGVVPDLASLNR---------------
A0A2V5PXM3      GLGSGLLLALFLNSLDRSLKTVDQTEEYLGIPVLSAIPKFASVAGDQRKL----------
A0A1V5QB01      GLGVGLGLVFGLEYIDDSLRYPEEVTDLLGLPFFGLVPAASWDPEDLRTH----------
A0A7C5LI63      GIGLGLALAFFVEYIDDSIKLAEEVERDLQLPFLGMIPAAQWSPDDLTAH----------
A0A7C5P291      GIGLGLALAFFIEYIDDSIKLAEEVERDLQLPFLGMVPAAQWNPDDLTAH----------
A0A139SU05      FCVVFFGTAFGLDFIDDRIKSAWDIENFLGTSLLGIVPDLASVKDEDKYT----------
A0A139SPN4      FLVVFFGTAFGLDFIDDRIKSAWDIENFLNTSLLGIVPDLNNVKDEDKYT----------
A0A1V6E7N1      FVALFLAVAIGLNFIDDRIKSTWDVEHYIGTTLLGIVPDLADTPDDDRYR----------
A0A2D9MYT1      GLGAGFGLAFFVNFLDDSIKSQEDIETYLKLPFLGYVPNIKTTSIIERDL----------
A0A258ANJ7      GFMLGLAIIGLIVIQDRSIRSVDDARQKLRVPVLGMIANQRQIATA--------------
A0A290QGD9      GLGLGLAVAIFVAFIDDRVKSSFDIEGQMGLHLLGIIPQVRKMPAPEKAQ----------
A0A1D8AS58      GLALGTAFAFFVAYVDDRVKSSFDIESVIGLPLVGIIPEIKRMDQPDKAQ----------
I6AQC1          GIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLLGVIPQIKKMDQADKAQ----------
W0ITH7          GIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLLGVIPQIKKMDQADKAQ----------
A0A139TLN4      GLAVPVLGCVIAAMMDSRVKRREEIESLTDIPVYGVLPRKPRKLKNQEIV----------
A0A1G3ZFT0      GLIASIILIFGRKFIFPRIEDPYWTETRFNIPNLAIIPYSKEQFKDFQDL----------
A0A1Z8ZMT6      GLCGGLALAFMFQFVDNKIHGVADVEQTFGISILSAIQKLPPEEELLEKM----------
A0A2E8MCT7      GLCGGLALAFMFQFVDNKIHGVADIEQTFGISILSAIQKLPPEEELLKEM----------
A0A290Q2Z2      GGVLGIGTAVLIEFFDTSFRNVAELEGRLGKPVLGVIPHSSEAVPPAKSG----------
A0A2A2RGK2      GAAIGVGLALLMFFMDTSMKTVDQVESVTGVGVIAAIPKLSLNARA-SVL----------
A0A2A2XXF7      GLAIGIGIAIAIFMLDTSIKTVDQVEQFTGVNVIAAIPKLSLSTRA-SVL----------
A0A2A2R5D6      GLVLGIVLAFFIEYLDTSVKTMDDVEKLLDLPVLAVIPD--------GVG----------
A0A1J4XH17      GIASGLGAVFAIAFFDDRIKTAFDIESVVGLPLLGVIPRMANLNTQEKAK----------
A0A3C1VJ32      GLIMGVGLAFFIEYLDTSVKTIDDVERTFQAPVLGVIPQ--------NIG----------
A0A2N9NTX7      GLVVGIGLAFFIEYLDTSVKTIDDVERSLQSPVLGVIPQ--------NVG----------
B9XK55          GLVVGVGLAFFIEYLDTSVKTIDDVERTLQAPVLGVIPQ--------NVG----------
A0A4P5YMI6      GMIMGVGLAFFIEYLDTSVKTIDDVEAALQTSVLGVIPQ--------NVG----------
A0A2E6T482      GLILGVGLAFFIEYLDTSVKTIDDVERSLGAAVLGVIPQ--------NVG----------
A0A3C0DQZ7      GLILGVGLAFFIEYLDTSVKTIDDVERSLGAAVLGVIPQ--------NVG----------
A0A1Z9CBK5      GLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIPQ--------NVG----------
A0A2D6ZI96      GLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIPQ--------NVG----------
A0A358KGZ3      GLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIPQ--------NVG----------
A0A2E9ZQX4      GLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIPQ--------NVG----------
A0A3D5JZU0      GLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIPQ--------NVG----------
A0A2E6HCR0      GLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIPQ--------NVG----------
A0A1Z8WN04      GLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQ--------NVG----------
A0A2D7L1N4      GLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQ--------NVG----------
A0A2E2R937      GLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQ--------NVG----------
A0A520QQY4      GLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQ--------NVG----------
A0A2D5MR66      GLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQ--------NVG----------
A0A2E0PDQ1      GLILGVGFAFFIEYLDTSVKTIDDVERALNTAVLGVIPQ--------NVG----------
A0A2E2ZZP9      GLILGVGFAFFIEYLDTSVKTIDDVERALNTAVLGVIPQ--------NVG----------
A0A7C4LRK7      GLILGVGLAFFIEYLDTSVKTIDDVERALQAPVLGVIPQ--------HVS----------
A0A2A2RGF2      GLLLGIGLAFFIEYLDTSVKTIDDVERALSAPVLAVIPQ--------NVG----------
A0A2G4I5Y6      GLLLGIGLAFFIEYLDTSVKTIDDVERALQAPVLAVIPQ--------NVG----------
A0A6N6PS97      GLIVGFGLAFFIEYLDTSVKTIDDVERALHSAVLGVIPQ--------NVG----------
A0A3M1I883      GLVMGVGLAFFIEYLDTSVKTIDDVERSLEATVVGVIPQ--------NIG----------
A0A1V6JZ45      GLVMGVGLAFFIEYLDTSVKTIDDVERSLSAPVLGVIPQ--------NVG----------
A0A7C7Z746      GLVVGVGLAFFIEYLDTSVKTIDDVEAALQAPVLGVIPQ--------NVG----------
A0A520RRW5      GLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVLGVIPQ--------NVH----------
A0A356NPK0      GLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVLGVIPQ--------NVH----------
A0A2D7B5P5      GLVVGIGXAFFIEYLDTSVKTIDDVEQALDAPVLGVIPQ--------NVH----------
A0A3D3XGB5      GLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVLGVIPQ--------NVH----------
A0A2V6F8A1      GLIVGVGLAFFIEYLDTSVKTIDDVERALQAPVLGVIPQ--------NVG----------
A0A2V5TNH4      GLIVGISLAFFIEYLDTSVKTIDDVERALQAPVLGVIPQ--------NVS----------
A0A2V5X5Q6      GLIVGIGLAFFIEYLDTSVKTIDDVERALQAPVLGVIPQ--------NVS----------
A0A4P5QM05      GIVAGIGLAFFVEYLDTSVKTVDDIERHLSLPVLAVIPT--------EIV----------
A0A4Q3C001      GLVVGVGLAFFIEYLDTSVKTLDDVERFLQIPVLAVVPK--------GVS----------
B4DB23          GLVLGVGLAFFIDYLDTSVKTLDDVERYLQIPVLAVIPN--------NVS----------
A0A6B3L938      GSGVGVGLVFLLSLLDYKIYNVRTAEEATGMACLAAIPLGSDFRRSGQKFES--------
A0A2V5URB2      GLMGGLGLALLLEHLNNTLRTPDEVERYLRLPNLAIVPDFYRLPNHRNGQ----------
A0A2V2DJ66      ALFGGIAMAFAVAFLDDRAKSAYDVETVIGLPLLGVIPRIKRLSSAEKAQ----------
R7L5A9          GIIGGICMAFLVAFLDDRAKSAYDIEAVIGLPLLGVIPRIKRLNSAEKAQ----------
A0A5R8KA81      GLVFGLALAFGIHAFDDTLRTVDQAEAATDVPVIAALPQSSKFKSPAHSL----------
A0A5B5WU87      GLAVPVLGCVIAAMMDSRVKRREEIESLTDIPVYGVLPRKPRKLKNQEIV----------
R7DZW0          GMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQEIV----------
A0A2N8HID1      GMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQEIV----------
A0A2N8HS06      GMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQEIV----------
A0A6N2TNT9      GMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQEIV----------
A0A3R5R2M8      GGALCFFALLGIAMLNNKVKNKYDLPAQVRQPVIAELPKMSKKERK-NNT----------
A0A411SUQ6      GALLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQMSKKESK-NTK----------
A0A2N8HZF2      GVLLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQMNKKESR-NTG----------
A0A354E720      GALLSILAFMGVAMLNNKVNNKHDLPSVNRQPVIAELPQMSKKESR-NTK----------
B2UPB6          GALLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQMSKKESK-NTK----------
A0A2V6JLK8      GLVIGIGLAFFIEYLDTSVKTMDDVESLLGVPVLAIIP-------K-NIN----------
A0A2W5Z1A5      GLGIGLGLAFFIEYLDTSVKTMEDVETLLGVPVLAIIP-------K-NVT----------
A0A2V6EA09      GLMIGLGLAFFIEYLDTSVKTMEDVENLLGLPVLAIIP-------K-NIK----------
A0A2V6GQI7      GLMIGLGLAFFIEYLDTSVKTMEDVENLLGLPVLAIIP-------K-NIK----------
A0A3C1HEJ2      GLVSGLAVAFGLAATDSSLKSVEQAENFLKVPLLGAIPQMKELQSSDSSQ----------
A0A522ULD9      GIVTGISLAFFLEYLDTSIKTVDDVEKYLGLPVLGAIP-------Q-RVK----------
A0A1V6JU76      GLGLAIGLAFFVNFLDDSIKSQDDVELYLHLPFLGYIPNIKTNSVVESGL----------
A0A2A2XXW5      GLAVALGLALFFNFLDDSIKSQEDVENILHLPFLGYIPNIKSISIVERDL----------
A0A6N6Q6V0      GMMFALGFAFFINFLDDSVKSQDDVENFLHLQFLGYIPNIKSASVVERDL----------
A0A1Q6UHJ9      ALAGGVMVAFIVAFMDDRAKSAYDIESVVGLPLLGVIPRIRRLNSSQKAQ----------
A0A2V2BXR0      ALAGGVMVAFIVAFMDDRAKSAYDIESVVGLPLLGVIPRIRRLNSSQKAQ----------
A0A2D8V0G3      GLGMGFAFAFFANYLDDSVKSQDDIESYLKLNFLGYIPNIKSQSLVERDL----------
A0A348S017      GLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDM----------
A0A3C1UUV7      GLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDM----------
A0A350I3V2      GLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDM----------
A0A520RGV5      GLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDM----------
A0A3D3XF90      GLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDM----------
A0A2D7B522      GLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYXPNIKTNSLVERDM----------
A0A356NIC2      GLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDM----------
A0A2N8HDG3      GAIVCILGFLGLALLNNKVKNKKDLNAITSLPVVAELPAMTKKEQR-QVA----------
A0A146GCJ0      GLGLGVALVVVIDLLDASLRTVDEAESYLGLPALTAVPEQRSKSVGEQVAEAWNDKTLGS
A0A2T6D6H8      GVMAGVGLVFVLDLLDHSLRTVDEAESFLDLPALAAIPEKRIETVLNQVGEAIREKKLSK
A0A3D1TI55      GLFLGVALAYFIEYMDTSVKTIDDVERFLGLPVLGIIP-------Q-RVR----------
A0A3E1ET42      GLVLGLLLAFFLEYLDTSVKSLDDVERYLGVPVLAVIP-------K-DVG----------
A0A2A2YDW8      GLVFGIGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP-------K-DIG----------
A0A352XLN9      GLVFGIGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP-------K-DIG----------
A0A3D0YP62      GVIFGLGIAFCLEYLDTSVKSLEDVERFLQVPVLAVIP-------K-DVG----------
A0A3D3DV47      GVIFGLGIAFCLEYLDTSVKSLEDVERFLQVPVLAVIP-------K-DVG----------
A0A2E5XJ49      GLIFGVAIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP-------K-DVG----------
A0A2E6SBY8      GLIFGIAIAFFLEXLDTSVKSLEDVERYLQVPVLAVIP-------K-DVG----------
A0A2E5QMS4      GLIFGISIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP-------K-DVG----------
A0A2E7YXQ3      GLIFGISIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP-------K-DVG----------
A0A2E3H787      GLIFGVAIAFFLEYLDTSVKTLEDVERYLQIPVLAVVP-------T-DVN----------
A0A2E7AGN1      GLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A2E7AKY7      GLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A3D4CU34      GLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A2E8M146      GLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A355S8S2      GLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A2D6DVN8      GLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A3C1W2R2      GLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A2E3NAY6      GLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVVP-------T-DVG----------
A0A2E3II01      GLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A368B8C5      GLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A3R7RBB5      GLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-------T-DVG----------
A0A2A2QX62      GLIFGIAVAFFLEYLDTSVKTLEDVERYLQVPVLAVIP-------K-DVG----------
A0A4Q3BWH6      GMIFGIGVAFFLEYLDTSVKSLEDVERYLQVPVLAVIP-------K-DVG----------
A0A3N5WCF1      GLIFGVGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP-------K-DVG----------
A0A4Q3C1K5      GLIFGVGIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP-------K-DVG----------
A0A3R8IT45      GIGFGLAFAFVVAFIDDRVKSSFDIESVVGLPLLGVIPQIKKMDQADKAQ----------
A0A2A2PYE8      GLGLGLAFAFFVAFIDDRVKSSYDIEGVVGLPLIGIIPQIKRMDQPDKAQ----------
A0A2T6CN73      GLGLGLAFAFFVAFIDDRVKSSFDIEGVVGLPLIGIIPEIKKLEQVEKAQ----------
A0A2G4G428      GAIFGLGLIILLGTFDDRIKSPKEVEIALGIPILGTIPQITKSVGPERAL----------
A0A6N6PCD8      GLMGGLALIILQQAFDTSLRSLDQAEVALDLASLAAVP-------EIDSK----------
A0A139TV24      GAALCLFAFMGVAILNNKVKNRHDLDAITTLPVIAELPAMSKKEQK-QVS----------
A0A2N8HT11      GAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQR-QVA----------
R7DS70          GAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQR-QVA----------
A0A2N8HNL6      GAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQR-QVA----------
A0A6N6PAZ1      GFSGGILLVFLLLRLDNRFHTVSQIASDTNVTVLGAIADIKLHHLEVAEQ----------
A0A6I1K459      GFGLSFGLVWLIAQLDTSIKSVDQAESLLGLPVLGAVPKNKLVKDG-KSR----------
A0A139TUL1      GAFLCLLSLMVSNALNTNVKDKNDLVGLVSLPLAGELPLLSGKERK-KLP----------
A0A2N8HCB0      GALVSLLALLAGNALNTKVRDKKDLAGLTDLPLAGALPLLSGKERA-KLP----------
A0A2N8HP04      GAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELPLLSGKERK-KLP----------
A0A2N8HRJ0      GAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELPLLSGKERK-KLS----------
A0A6N2U9Y7      GAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELPLLSGKERK-KLP----------
A0A366HAG0      GLMFGFGMAFFLEYLDTSVRTMDDLERTLSVPVLAVVP-------K-GVG----------
A0A2U8DZK4      GVVLGIGTALLIDMFDASFRSVADVERRLQRPVLGVIPSSLTARKP--------------
A0A2T6DFL8      GAVLAVGVAVVLEYFDTSFRNVADVEARLGLPVLGVIPFAQDPLAR--------------
A0A1D8AWD4      GTILGVGAAVLLEYFDTSFRNVADVEGKLSLPVLGVIPHMAEAGEL--------------
A0A4Q1C9S2      GSILGVGAAVLLEYFDTSFRNVADVEGKLGLPVLGVIPHLPEPPAL--------------
A0A178IH18      GAVLGVGAAVLIEFFDASFRGVADVERRLQRPVLGVIPASATARRP--------------
A0A2T6DT99      GTILGVGTAVLVEYFDTSFRNVAEVEARLQRPVLGVIPNAPDPLKK--------------
A0A1G3ZT33      GSLLGVGAAVLVEYFDTSFRNVADVEDHLKLPVLSVIPLSRTPARL--------------
A0A3E1E2T2      GSILGVGAAVLLEYFDTSFRNVADVETRLKLPVLGVIPFHRDPLDE--------------
B1ZMW1          GSLLGVGAALLLEYFDTSFRTVGDVETRLKLPVLGVIPRQTDPLGG--------------
A0A3M1I8A3      GILLGIGLALFVNYLDDSIKSQDDVELHLQMPFLGYVPSIKSAKEV-ERY----------
A0A4V0XS84      GLAVAIGLAFFVDYVNDTIKTQEDIEAHLQVPFLGYVPSIKRESVV-ERD----------
A0A351WE84      GFGAGIGLAYFIEYLDTSVRTVDDVEQFLGLPVLGVIP-------Q-KIR----------
D5ENH7          GLVVGAGLVFLVAFLDDRVKSAFDIEGTIGLPLLGVVPRIKKLDSN-SKA----------
A0A0R2XQ77      GLAVGAGLIFAVAFLDDRVKSVFDIEGTIGLSMLGVVPRIKKLDSS-SKA----------
A0A2E9IN28      GIAVGVGLIFVVAFLDDRVKSAFDIEGTIGLPMLGVVPRIKKLDSN-TKA----------
A0A6N4WTJ5      GVAAGVGLIFLVAFLDDRVKSAFDIEGTIGLPMLGVVPRIKKLDSN-SKA----------
A0A1V5QDZ6      GLGAGVGLAYFIEYLDTSVKTVDDIERYLGLSVLGIIP-------Q-KVR----------
A0A4Y8P964      GSLASCGLALGLAKLDTRIRSKEEIEKEFGLPVLGSVPDVEFLQGE-GID----------
A0A3D4HF88      GIMLSLIFVGLLAFFDDRVKTAYDVEGILNLPLIGVVAKLQELSAK-EKA----------
A0A6N6ZHN8      GGVLGVGLVVLLAVMDDKVKTAYDIESSLGLPLIGLIPRISRIDAL-EKA----------
A0A351MR11      GLASGVGLVVLLGVFDDRVKSAVDIEGGLGLPLVGTVPRTTDTYGP-DRA----------
A0A6G6K641      GIVLGLGLTLGLHFLDNSIKAVAEAETMTGLPVLTAII-------A-KKT----------
A0A5B5WI95      GAALCFFAFLGLGMMNNKVKNKHDLTGQTRQPIIAELPRMSKKERK-NTS----------
A0A2N8I9W1      GALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NTG----------
A0A4Q5IH27      GALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NTG----------
A0A2N8IBZ6      GALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NTG----------
A0A2N8IJW9      GALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NTG----------
R6J100          GALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NTG----------
A0A1V6J089      GLMAGTGLAFFVEYLDVSIKTVDEVEKYLGLPVLAVIP-------Q-QSR----------
A0A3C1BZR1      GLLAGTGLAFFVEYLDVSIKTVDEVEKYLGLPVLAVIP-------Q-QSR----------
A0A7C4KLL2      GLAAGLALAFGSNALDTSFKSVEQAEAYLQLPVFTAIPKLKEVRLG-ETR----------
A0A1H6KPB7      GVVFGIGVAFLLNYMDTSVKTLEDVERNLNLPVLGVIP-------Q-DIG----------
A0A2E9ISN4      GAAFGAGAILGLEYLKPNPINVTHLEREYHIDLLGQIR-------RWDLY----------
B9XAX1          GLLMSLCMIYLMSLFDSSIRTVDQAEFVLGLPVLAAIPVAKKGRNG-TPA----------
A0A5R8KKM9      GLMFGFGLAFFLEYLDTTVKSIDEVERLLGVPVLAVIP-------K-NVG----------
A0A139TS01      GLLLGMGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A3E1EJT7      GLVAGFSVAFLIATLDDRIKTISAVETLVDLPLLGVIPEVKRMDQP-DKA----------
A0A317ZP96      GLAVGTALVFAVAFLDDRVKSAFDIEGTIGLPMLGVIPRIKKLDTN-TKA----------
A0A7C3I5X9      GLAVALGLALFVNFLDDTIKSQDDVETYLRLPFLGYVP-------NIKSN----------
A0A2D5WGA5      GLILGVGLAFFLEYLDTSVKTIDDVEHALGAAVLGVIP-------Q-NVG----------
A0A2E7SSH2      GLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIP-------Q-NVG----------
A0A349GXM8      GLGLGFGLAFLAQVVDNKVQTIKDVENILGVRFLGGIPYWAHSQLESSIR----------
A0A4P5YP61      GLMGGLMLALLLNQIDSSIKSVDQAEEFLQLPVLSAIPQITAFG-N-NRG----------
A0A6B2LYM4      GTGVGLGLVFLLAFLDDKVKSAFDIESTLGVPLVGIVPHIFSIDSQ-EKA----------
A0A6D1VXB3      GSLTSCGLALGLAKLDTRIRSKEEIEKQLGIPVLGSIPDIELIKGE-GID----------
I0JYY7          GSLTSCGLALGLAKLDTRIRSKEEIEKQLGIPVLGSIPDIELIKGE-GID----------
A0A4R7S1J2      GFALAAGVIFLLFFMDRTIKSVDQAEKILRLPVLATINKAKYS--D-EAG----------
A0A2A2XV69      GIGFGVGLAFFIEYLDTSVKTLQDLESILKIPVLAVIP-------K-EIS----------
A0A651H7X9      GLGLGLGVAFFIAILDDRVKSAFDIESVVGLPLIGLIPRLRKMEVH-EKA----------
A0A4Y8P842      GSIGGIGLALGLAMLDNRFRGKEEIEKFLKIPVLGVIPDIEKLKKS-HPE----------
B3DZK9          GSVGGIGLALGLALLDNRFRGKDDIEKFLKIPVLGVIPDIEKLKKH-QPE----------
A0A5E6MPC4      GGLGGLGLAVGLARFDTRLRGKEEVERTLGLPVLGQVPDTEKLKAK-GID----------
A0A6N6PKP9      SLALAASGVLAAHTLDSSCKTVDQAERLLGLSSLAAIPRQARS--V-VAG----------
A0A6N6Z250      GLLLGSAGALLLEKADGSFRQVEELEGRLEVPVLGVVA-------R-EAR----------
A0A4V1SB02      ALLLGSGLVLLMDRLDSSIRTVDEAENILELGVLAAVPDGDSSKIP-KGG----------
A0A6N6QEJ2      GLLLGIGLAFFIEYIDTSVKTIDDVEQSLGAPVLGVIP-------Q-NVG----------
A0A3C1VB86      GLAVGLGISFVLNSMDTSFRTVDEVEHYLALPVLGAIPKLPKTEGK-GND----------
A0A146G2Q9      GLVFGVGLAFFIEYLDTSVKTMEDVESFLKVPVLAVIP-------K-GIS----------
A0A2T6D3Y2      GLVFGVGLAFFIEYLDTSVKTMEDVESFLKVPVLAVIP-------K-GIS----------
A0A6N6P5E3      GLALGVGMAFLIEYLDTSVKTMHDIETALGYQVLAIIP-------K-DVA----------
A0A2D5VY59      GLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIP-------Q-NVQ----------
A0A2D8UZZ4      GLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIP-------Q-NVQ----------
A0A353DV86      GLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIP-------Q-NVQ----------
A0A2E5EPT8      GAVMGIGMAFFIEYLDTSVKTIDDVEHTLQAPVLAVIP-------Q-NVG----------
A0A6J4HTK1      GLVVGLGLAFFIEYLDTSVKTMEDVESLLGVPVLAIIP-------K-NIK----------
A0A6N6PHJ5      GLIVGVGLAFFIEYLDTSVKTIDDVERTLQSPVLGVIP-------Q-NVG----------
A0A6M1RXR2      GLVVGVGLAFFIEYLDTSVKTIDDVERALGAPVLGVIP-------Q-NVG----------
A0A7C3DXS4      GLVVGVGLAFFIEYLDTSVKTIDDVERALGAPVLGVIP-------Q-NVG----------
A0A2V2SDV4      GLVVGVGLAFFIEYLDTSVKTIDDVERSLNSPVLGVIP-------Q-NVG----------
A0A2V5PK75      GLVVGIGLAFFIEYLDTSVKTIDDVERSLQSPVLGVIP-------Q-NVG----------
A0A1V6DME1      GLVVGVGLAFFIEYLDTSVKTIDDVERALQSPVLGVIP-------Q-NVG----------
A0A3D3DIJ3      GLVVGVGLAFFIEYLDTSVKTIDDVERALQCPVLGVIP-------Q-NVG----------
A0A6I1K583      GLLLGVGLAFFIEYLDTSVKTIDDVERALSAPVLAVIP-------Q-NVG----------
A0A350EWA4      GLVVGVGLAFFIEYLDTSVKTIDDVERALQAHVLGVIP-------Q-NVG----------
A0A5B5WZ91      GLLLGVGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A2N8HD92      GLLLGIGLALFLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A2N8HIT2      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A354EBD3      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A355VEB2      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A2N8IMT3      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
R6K1U5          GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A2N8IWC2      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A2N8I441      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A2N8I3A6      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A410SCC4      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A3R5VEW0      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A411SSG2      GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
B2UKW3          GLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------K-NVP----------
A0A7C3HWX0      GLVMGIGLAFFIEYLDTSVKTIDDVERALQAPVLGVIP-------Q-NVG----------
A0A7C4KPD7      GLVLGIGLAFFVEYLDTSVKTIDDVERALQAPVLGVIP-------Q-NVG----------
A0A1M6RLZ4      GLVFGVGIAFALELMDTSVKTLEDVERFLQVPVLAVIP-------R-DVG----------
A0A354T7G8      GLMFGLGLAFFLEYMDTTVKSLDDVERHLGVPVLAVVP-------K-GVG----------
A0A2S7U4L6      GMIFGIGIAFSLELMDTSVKSLEDVERYLQVPVLAVVP-------R-DVG----------
A0A512MBZ2      GLMFGLGLAFFLEYMDTTVKSLDDVERFLGVPVLAVVP-------K-NVG----------
A0A2E8MEZ0      GLIFGIGIAFLLEHLDTSVKSLEDVERYLQVPVLAVIP-------K-DVG----------
A0A6B3LBV6      GLAFGLGIAFALEFMDTSVKTIDDVERYLNVPVLAVIP-------K-DVG----------
A0A2E3EC33      GLVFGIGMAFFLEYLDTSVKSMDEVEHFLELPVLAVIP-------Q-AVG----------
A0A2E4GN01      GLVFGIGMAFFLEYLDTSVKSLDEVEHFLELPVLAVIP-------Q-DVG----------
A0A1Z8XU55      GLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DVG----------
A0A2E1RQR9      GLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DVG----------
A0A2E3ISQ4      GLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DIN----------
A0A2D6W6F4      GLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DIN----------
A0A2D8Z5A8      GLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DIN----------
A0A4Q2YKS3      GLIFGVGIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP-------K-DVG----------
A0A6N6P3T8      GLICGLGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIP-------K-DIG----------
                                                                            

A0A2A2XVF1      GRLRQARNIGKPHKKKESSVLGDIQELIRPAPIARTDSEKYPIATIEE------------
A0A2V5UHJ2      --------------------------------SYVSRLLKSAQAELPVSARKAAKAKHAD
A0A2V5PST3      --------------------------------PLISYQPVSSGKPKRIAQLQAQQKTSNG
A0A2V5PXM3      --------------------------------INAED-----------------------
A0A1V5QB01      --------------------------------ILSNID----------------------
A0A7C5LI63      --------------------------------RLDRVK----------------------
A0A7C5P291      --------------------------------RLDRLK----------------------
A0A139SU05      --------------------------------LLLKD-----------------------
A0A139SPN4      --------------------------------LLLKD-----------------------
A0A1V6E7N1      --------------------------------MVLDH-----------------------
A0A2D9MYT1      --------------------------------QAHLH-----------------------
A0A258ANJ7      --------------------------------SEQQKGHDFTQGLTPALI----------
A0A290QGD9      --------------------------------VVANH-----------------------
A0A1D8AS58      --------------------------------IVINN-----------------------
I6AQC1          --------------------------------VALNN-----------------------
W0ITH7          --------------------------------VALNN-----------------------
A0A139TLN4      --------------------------------VNLEE-----------------------
A0A1G3ZFT0      ----------------------KRNVKKPIMLLSQKD-----------------------
A0A1Z8ZMT6      --------------------------------ESLRDLPVSMKHISPTLAVPGWK-----
A0A2E8MCT7      --------------------------------ESIRDLPVSMKHICPTLAVPGWK-----
A0A290Q2Z2      --------------------------------IVEDP-----------------------
A0A2A2RGK2      --------------------------------VTNEE-----------------------
A0A2A2XXF7      --------------------------------VTNEE-----------------------
A0A2A2R5D6      --------------------------------PLIRE---------GADS----------
A0A1J4XH17      --------------------------------TVVKG-----------------------
A0A3C1VJ32      --------------------------------YLLEE---------GAES----------
A0A2N9NTX7      --------------------------------LLVDE---------GVES----------
B9XK55          --------------------------------LLLDE---------GAES----------
A0A4P5YMI6      --------------------------------SLLDE---------GVDS----------
A0A2E6T482      --------------------------------SLLEE---------GDES----------
A0A3C0DQZ7      --------------------------------SLLEE---------GDES----------
A0A1Z9CBK5      --------------------------------SLVDE---------GDES----------
A0A2D6ZI96      --------------------------------SLVDE---------GDES----------
A0A358KGZ3      --------------------------------SLMDE---------GDES----------
A0A2E9ZQX4      --------------------------------SLMDE---------GDES----------
A0A3D5JZU0      --------------------------------SLMDE---------GDES----------
A0A2E6HCR0      --------------------------------SLVDE---------GEES----------
A0A1Z8WN04      --------------------------------SLVDE---------GEES----------
A0A2D7L1N4      --------------------------------SLVDE---------GEES----------
A0A2E2R937      --------------------------------SLVDE---------GEES----------
A0A520QQY4      --------------------------------SLVDE---------GEES----------
A0A2D5MR66      --------------------------------SLVDE---------GEES----------
A0A2E0PDQ1      --------------------------------SLVDE---------GEES----------
A0A2E2ZZP9      --------------------------------SLVDE---------GEES----------
A0A7C4LRK7      --------------------------------NLLDE---------GPES----------
A0A2A2RGF2      --------------------------------ALLDE---------GMDS----------
A0A2G4I5Y6      --------------------------------ALLDE---------GMDS----------
A0A6N6PS97      --------------------------------SLLEE---------GADS----------
A0A3M1I883      --------------------------------LLIKE---------GPDS----------
A0A1V6JZ45      --------------------------------ILVNE---------GPDS----------
A0A7C7Z746      --------------------------------SLLDE---------GPDS----------
A0A520RRW5      --------------------------------SLLME---------GPDS----------
A0A356NPK0      --------------------------------SLLME---------GPDS----------
A0A2D7B5P5      --------------------------------SLLME---------GPDS----------
A0A3D3XGB5      --------------------------------SLLME---------GPDS----------
A0A2V6F8A1      --------------------------------SLIQE---------GPES----------
A0A2V5TNH4      --------------------------------SLILE---------GSES----------
A0A2V5X5Q6      --------------------------------SLILE---------GPES----------
A0A4P5QM05      --------------------------------ILLQQ---------KRDT----------
A0A4Q3C001      --------------------------------ALMKE---------SNDS----------
B4DB23          --------------------------------ILMKN---------AGDT----------
A0A6B3L938      --------------------------------VIAIE-----------------------
A0A2V5URB2      -------KSLIHYDKYNKVKFDNKLCLPSKKSSLSDR-----------------------
A0A2V2DJ66      --------------------------------VAASN-----------------------
R7L5A9          --------------------------------VAASN-----------------------
A0A5R8KA81      --------------------------------VMVKD-----------------------
A0A5B5WU87      --------------------------------VNLEE-----------------------
R7DZW0          --------------------------------VNLEE-----------------------
A0A2N8HID1      --------------------------------VNLEE-----------------------
A0A2N8HS06      --------------------------------VNLEE-----------------------
A0A6N2TNT9      --------------------------------VNLEE-----------------------
A0A3R5R2M8      --------------------------------PLIRN-----------------------
A0A411SUQ6      --------------------------------LFIQD-----------------------
A0A2N8HZF2      --------------------------------LFIQD-----------------------
A0A354E720      --------------------------------LFIQD-----------------------
B2UPB6          --------------------------------LFIQD-----------------------
A0A2V6JLK8      --------------------------------LLHKA---------EGDT----------
A0A2W5Z1A5      --------------------------------LLHHE---------IGDS----------
A0A2V6EA09      --------------------------------LLHRE---------AGDT----------
A0A2V6GQI7      --------------------------------LLHRE---------AGDT----------
A0A3C1HEJ2      --------------------------------VIMAD---------PRLV----------
A0A522ULD9      --------------------------------PLHEE---------GPDS----------
A0A1V6JU76      --------------------------------QAHLH-----------------------
A0A2A2XXW5      --------------------------------QSHLH-----------------------
A0A6N6Q6V0      --------------------------------QAHLH-----------------------
A0A1Q6UHJ9      --------------------------------VAVSN-----------------------
A0A2V2BXR0      --------------------------------VAVSN-----------------------
A0A2D8V0G3      --------------------------------QAHLH-----------------------
A0A348S017      --------------------------------QAHLH-----------------------
A0A3C1UUV7      --------------------------------QAHLH-----------------------
A0A350I3V2      --------------------------------QAHLH-----------------------
A0A520RGV5      --------------------------------QAHLH-----------------------
A0A3D3XF90      --------------------------------QAHLH-----------------------
A0A2D7B522      --------------------------------QAHLH-----------------------
A0A356NIC2      --------------------------------QAHLH-----------------------
A0A2N8HDG3      --------------------------------RMFTD-----------------------
A0A146GCJ0      LPKDLAQKQVLEPLRRSLNRKEREAQLKKHPLIFVED-----------------------
A0A2T6D6H8      IPQEIAGKGVVEPVRKFLNAREATAQAKRHPLVFIDD-----------------------
A0A3D1TI55      --------------------------------PLVEE---------GPDS----------
A0A3E1ET42      --------------------------------ILHKQ---------SGLS----------
A0A2A2YDW8      --------------------------------VLHKQ---------SGMS----------
A0A352XLN9      --------------------------------VLHKQ---------SGMS----------
A0A3D0YP62      --------------------------------VLHRQ---------SGMS----------
A0A3D3DV47      --------------------------------VLHRQ---------SGMS----------
A0A2E5XJ49      --------------------------------VLHKQ---------SGMS----------
A0A2E6SBY8      --------------------------------VLHKQ---------SGMS----------
A0A2E5QMS4      --------------------------------TLHKQ---------SGMS----------
A0A2E7YXQ3      --------------------------------ILHKQ---------SGMS----------
A0A2E3H787      --------------------------------VLHKQ---------SGMS----------
A0A2E7AGN1      --------------------------------VLHKQ---------SGMS----------
A0A2E7AKY7      --------------------------------VLHKQ---------SGMS----------
A0A3D4CU34      --------------------------------VLHKQ---------SGMS----------
A0A2E8M146      --------------------------------VLHKQ---------SGMS----------
A0A355S8S2      --------------------------------VLHKQ---------SGMS----------
A0A2D6DVN8      --------------------------------VLHKQ---------SGMS----------
A0A3C1W2R2      --------------------------------VLHKQ---------SGMS----------
A0A2E3NAY6      --------------------------------VLHKQ---------SGMS----------
A0A2E3II01      --------------------------------VLHKQ---------SGMS----------
A0A368B8C5      --------------------------------VLHKQ---------SGMS----------
A0A3R7RBB5      --------------------------------VLHKQ---------SGMS----------
A0A2A2QX62      --------------------------------VLYKQ---------SGMS----------
A0A4Q3BWH6      --------------------------------VLYKQ---------SGMS----------
A0A3N5WCF1      --------------------------------ILHKQ---------SGMS----------
A0A4Q3C1K5      --------------------------------VLHKQ---------SGMS----------
A0A3R8IT45      --------------------------------VVSNN-----------------------
A0A2A2PYE8      --------------------------------IVINN-----------------------
A0A2T6CN73      --------------------------------IVATN-----------------------
A0A2G4G428      --------------------------------LAMHE-----------------------
A0A6N6PCD8      --------------------------------KLLKAEESPLVLIDDPSS----------
A0A139TV24      --------------------------------LMLPD-----------------------
A0A2N8HT11      --------------------------------RMFTD-----------------------
R7DS70          --------------------------------RMFTD-----------------------
A0A2N8HNL6      --------------------------------RMFTD-----------------------
A0A6N6PAZ1      --------------------------------VFRKR---------NPDSQLAVPEHWDK
A0A6I1K459      --------------------------------LFMSD---------DPQS----------
A0A139TUL1      --------------------------------LVVIN-----------------------
A0A2N8HCB0      --------------------------------LVVMN-----------------------
A0A2N8HP04      --------------------------------MVVTN-----------------------
A0A2N8HRJ0      --------------------------------LVVTN-----------------------
A0A6N2U9Y7      --------------------------------LVVTN-----------------------
A0A366HAG0      --------------------------------TLMHA---------TGIT----------
A0A2U8DZK4      ----------------------------------------------AEEP----------
A0A2T6DFL8      ----------------------------------------------G--G----------
A0A1D8AWD4      ----------------------------------------------H--D----------
A0A4Q1C9S2      ----------------------------------------------H--D----------
A0A178IH18      ----------------------------------------------NEDS----------
A0A2T6DT99      ----------------------------------------------DAAG----------
A0A1G3ZT33      ----------------------------------------------D--P----------
A0A3E1E2T2      ----------------------------------------------E--G----------
B1ZMW1          ----------------------------------------------D--E----------
A0A3M1I8A3      --------------------------------LQCHL---------HPQS----------
A0A4V0XS84      --------------------------------LEAHS---------NPTS----------
A0A351WE84      --------------------------------PLIHE---------GPES----------
D5ENH7          --------------------------------QAVAS---------NVDR----------
A0A0R2XQ77      --------------------------------QAVAS---------NIDR----------
A0A2E9IN28      --------------------------------QAVAS---------NVDR----------
A0A6N4WTJ5      --------------------------------QAVAS---------NVDR----------
A0A1V5QDZ6      --------------------------------PLTEE---------GPDS----------
A0A4Y8P964      --------------------------------EIPKDIPFALTTHAAPES----------
A0A3D4HF88      --------------------------------IAVAS---------NADR----------
A0A6N6ZHN8      --------------------------------RIVAD---------NLDR----------
A0A351MR11      --------------------------------LLARQ---------TKDK----------
A0A6G6K641      --------------------------------SARKNPLPDLEIVHQKNS----------
A0A5B5WI95      --------------------------------LFIKE-----------------------
A0A2N8I9W1      --------------------------------LFIQD-----------------------
A0A4Q5IH27      --------------------------------LFIQD-----------------------
A0A2N8IBZ6      --------------------------------LFIQD-----------------------
A0A2N8IJW9      --------------------------------LFIQD-----------------------
R6J100          --------------------------------LFIQD-----------------------
A0A1V6J089      --------------------------------PLTEA---------GQSS----------
A0A3C1BZR1      --------------------------------PLTEA---------GQSS----------
A0A7C4KLL2      --------------------------------FVASE---------GSDS----------
A0A1H6KPB7      --------------------------------LLHLM---------NGSS----------
A0A2E9ISN4      --------------------------------LPIDKFNPESDIFVAAKG----------
B9XAX1          --------------------------------HIVAD---------DPGS----------
A0A5R8KKM9      --------------------------------ALHRT---------TGLN----------
A0A139TS01      --------------------------------ILHSA---------GSLG----------
A0A3E1EJT7      --------------------------------QIVSN---------GSDP----------
A0A317ZP96      --------------------------------QAVAS---------NVDR----------
A0A7C3I5X9      --------------------------------SLVER---FQTSHLHAQS----------
A0A2D5WGA5      --------------------------------SLLDE---------GDES----------
A0A2E7SSH2      --------------------------------SLMDE---------GDES----------
A0A349GXM8      --------------------------------PIVTE---------EHST----------
A0A4P5YP61      --------------------------------LVVVD---------DAKS----------
A0A6B2LYM4      --------------------------------RIAAD---------EHDK----------
A0A6D1VXB3      --------------------------------EIPKDIPFALTTYSSPES----------
I0JYY7          --------------------------------EIPKDIPFALTTYSSPES----------
A0A4R7S1J2      --------------------------------AILKH---------AEHS----------
A0A2A2XV69      --------------------------------LLING---------NDDN----------
A0A651H7X9      --------------------------------QIVLN---------NEDR----------
A0A4Y8P842      --------------------------------TYEGEIPYALMTYALPES----------
B3DZK9          --------------------------------TYEGDIPYALMTYALPES----------
A0A5E6MPC4      --------------------------------EIPADLPMAFAAHVAPDS----------
A0A6N6PKP9      --------------------------------SVLVK---------KPQS----------
A0A6N6Z250      --------------------------------LIGPK---------DFDS----------
A0A4V1SB02      --------------------------------TVMTD---------DANS----------
A0A6N6QEJ2      --------------------------------ALINE---------GADS----------
A0A3C1VB86      --------------------------------LAAAQ---------DSNS----------
A0A146G2Q9      --------------------------------LLVNE---------AKDN----------
A0A2T6D3Y2      --------------------------------LLVNE---------TKEN----------
A0A6N6P5E3      --------------------------------VLKDA---------PSDC----------
A0A2D5VY59      --------------------------------SLLLE---------GPDS----------
A0A2D8UZZ4      --------------------------------SLLLE---------GPDS----------
A0A353DV86      --------------------------------SLLLE---------GPDS----------
A0A2E5EPT8      --------------------------------VLMNE---------DPDT----------
A0A6J4HTK1      --------------------------------LLHKE---------PGDT----------
A0A6N6PHJ5      --------------------------------LLIEE---------GAES----------
A0A6M1RXR2      --------------------------------LLLEE---------GAES----------
A0A7C3DXS4      --------------------------------LLLEE---------GAES----------
A0A2V2SDV4      --------------------------------AILDE---------GAES----------
A0A2V5PK75      --------------------------------LILDE---------GVDS----------
A0A1V6DME1      --------------------------------SLLQE---------GAES----------
A0A3D3DIJ3      --------------------------------LLVDE---------GTES----------
A0A6I1K583      --------------------------------ALLDE---------GMDS----------
A0A350EWA4      --------------------------------SLLDE---------GPDS----------
A0A5B5WZ91      --------------------------------ILHSA---------GSLG----------
A0A2N8HD92      --------------------------------ILHSS---------DVLG----------
A0A2N8HIT2      --------------------------------ILHSS---------DVMG----------
A0A354EBD3      --------------------------------ILHSS---------GVMG----------
A0A355VEB2      --------------------------------ILHSS---------GVMG----------
A0A2N8IMT3      --------------------------------ILHSS---------DAMG----------
R6K1U5          --------------------------------ILHSS---------DAMG----------
A0A2N8IWC2      --------------------------------ILHSS---------DAMG----------
A0A2N8I441      --------------------------------ILHSS---------DAMG----------
A0A2N8I3A6      --------------------------------ILHSS---------DAMG----------
A0A410SCC4      --------------------------------ILHSS---------DAMG----------
A0A3R5VEW0      --------------------------------ILHSS---------DVMG----------
A0A411SSG2      --------------------------------ILHSS---------DVMG----------
B2UKW3          --------------------------------ILHSS---------DVMG----------
A0A7C3HWX0      --------------------------------LLLEQ---------GPDS----------
A0A7C4KPD7      --------------------------------NLLEE---------GPES----------
A0A1M6RLZ4      --------------------------------VLHKQ---------SGAS----------
A0A354T7G8      --------------------------------VLHRS---------SGFN----------
A0A2S7U4L6      --------------------------------VLYKM---------STAS----------
A0A512MBZ2      --------------------------------VLHRT---------SGFN----------
A0A2E8MEZ0      --------------------------------VLHKQ---------SGMS----------
A0A6B3LBV6      --------------------------------VLHRE---------GGMS----------
A0A2E3EC33      --------------------------------VLXRQ---------SGLS----------
A0A2E4GN01      --------------------------------ILHRQ---------SGLS----------
A0A1Z8XU55      --------------------------------VIHKQ---------SGLS----------
A0A2E1RQR9      --------------------------------VIHKQ---------SGLS----------
A0A2E3ISQ4      --------------------------------VLHKE---------SGLS----------
A0A2D6W6F4      --------------------------------VLHKE---------SGLS----------
A0A2D8Z5A8      --------------------------------VLHKE---------SGLS----------
A0A4Q2YKS3      --------------------------------VLHKQ---------SGMS----------
A0A6N6P3T8      --------------------------------ILHKQ---------SGMS----------
                                                                            

A0A2A2XVF1      --------PESGLAEAYRTLRVSIS--ML-GPEEERRVLLFVSAIPEEGKTYTSLNTAVV
A0A2V5UHJ2      SSVLLDHHSLSVVAEAYRSFRSALL--LS-QAGGPPHTILVTSAARGEGKTTTLVNSAIV
A0A2V5PST3      KDLIVSYHPLSIFSESYRTIRTALL--LS-EPEATRKVILLTSPSPGEGKTATTLNLGIA
A0A2V5PXM3      --------AESGEAEAFRTLRTAIS--ML-GRKEERRVFLFTSAVPSEGKTFCSLNFAIS
A0A1V5QB01      --------QKSGMVEAYRNVRSALL--FS-VAGSQSKFIAMTSAVPKEGKTTTCLNLAVS
A0A7C5LI63      --------QQGGVAEAYRVVRSAII--FS-IPREKLRSLLLTSAVPREGKTTTCVNLAIG
A0A7C5P291      --------QQGGVAEAYRVVRSAII--FS-TPRDKLRSILVTSAVPREGKTTTTVNLAIG
A0A139SU05      --------THPTAVEAFMGIYGAAK--TH-SLVDYPKSMLVTSTIPGEGKTLVSANLAAS
A0A139SPN4      --------TNPTAVEAFTGIYSAAK--TH-SLVDYPKAMLVTSTIPGEGKTLVSANLAAS
A0A1V6E7N1      --------RQSPGLEAFLSIYSSVK--IH-SKLDFPKSILVTSTIPGEGKTLVSANLAAS
A0A2D9MYT1      --------PQSNSAEAFRTVRAAIS--LS-VRAGDLQILSVTSTVPSEGKSLVASNHAIV
A0A258ANJ7      --------AHKAVAESFREFRAIIAR----MARCPHTCHMVVSAVPDEGKTFVSTHLAVS
A0A290QGD9      --------ADRQVSEAFLTLHSSLR--LK-DDARAAKCILVTSTIPGEGKSFTTTNLALT
A0A1D8AS58      --------QDKQVVESFLTLHSSLR--LK-DESKAAQAILVTSTIPGEGKSFTTTNLALT
I6AQC1          --------ADRQVAEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTTTNLALT
W0ITH7          --------ADRQVAEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTTTNLALT
A0A139TLN4      --------PSEL-SESFPLLAERLVSLAD-ENGPGGFSILLTSSCPGEGKTYLAVNLALS
A0A1G3ZFT0      --------PRNLSIESLRSLRTSLQ--VN-LSCANNNIISILGASPGVGKTFVSTNLAYL
A0A1Z8ZMT6      --------TDFVHSEMFRVLRASIS--LL-GDANQRKITMITSSIPGEGKTFCAANLALA
A0A2E8MCT7      --------TDFVHSEMFRVLRASIS--LL-GDTNQRKITMITSSVPGEGKTFCAANLALA
A0A290Q2Z2      --------AE---LEPFRVLHTNLN--LALKGVTPGRSLVMLSAGPGEGKSTTVLRLARS
A0A2A2RGK2      --------RSGIVAESFRSLRASLT--LH-RINEDARTFLFTSSMPSEGKTFCSSNFAVT
A0A2A2XXF7      --------RSGIVAESFRSLRASLT--LH-RLNESARTFLFTSSMPSEGKTFCSSNFAVT
A0A2A2R5D6      --------PH---AEGYRILRAKID--LN-PKSGAGNTLTVVSGGPGEGKSTTLFNLAYV
A0A1J4XH17      --------TEKTVLESFRAIDSLLR--LN-KASKPARVITVTSTLPSEGKSFFTTNLGLT
A0A3C1VJ32      --------KH---AEAYRVLRTNLL--FS-RKDEKLNTIVIVSAGAGEGKSTTTINLSTV
A0A2N9NTX7      --------PH---AEAYRVLRTNLL--FS-RKDEKLNTVAVVSAGAGEGKSTTVFNLACV
B9XK55          --------PH---AEAYRVLRTNLM--FS-RKDDKLNTMAVVSAGAGEGKSTTVYNMATV
A0A4P5YMI6      --------PH---AEAYRVLRTNLM--FA-RKDPKANSLIVVSSGAGEGKTTTVLNLAVI
A0A2E6T482      --------PH---AEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTMFNLAVV
A0A3C0DQZ7      --------PH---AEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTMFNLAVV
A0A1Z9CBK5      --------PH---AEAYRVLRTNIL--FAGRTSEXXTTFSVVSGGAGEGKTTTMFNLAVI
A0A2D6ZI96      --------PH---AEAYRVLRTNIL--FAGRTSEXXTTFSVVSGGAGEGKTTTMFNLAVI
A0A358KGZ3      --------PH---AEAYRVLRTNIL--FAGRKSEDQTTFTVVSGGAGEGKTTTMFNLAVV
A0A2E9ZQX4      --------PH---AEAYRVLRTNIL--FAGRKSEDQTTFTVVSGGAGEGKTTTMFNLAVV
A0A3D5JZU0      --------PH---AEAYRVLRTNIL--FAGRKSEDQTTFSVVSGGAGEGKTTTMFNLAVV
A0A2E6HCR0      --------PH---AEAYRVLRTNIL--FAARKSEDQTTFTVVSGGAGEGKTTTMFNLAVI
A0A1Z8WN04      --------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVI
A0A2D7L1N4      --------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVI
A0A2E2R937      --------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVI
A0A520QQY4      --------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVI
A0A2D5MR66      --------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVI
A0A2E0PDQ1      --------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVI
A0A2E2ZZP9      --------PH---AEAYRVLRTNIL--FAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVI
A0A7C4LRK7      --------PH---AEAYRVLRTNLL--FS-RKDDKWNTLTIVSAGAGEGKSTTLFNLAVV
A0A2A2RGF2      --------PH---AEAYRVLRTNVL--FT-RKDDQANAITVVSGGAGEGKSTTVLNLATI
A0A2G4I5Y6      --------PH---AEAYRVLRTNVL--FT-RKDDAANAITVVSGGAGEGKSTTVLNLATI
A0A6N6PS97      --------PH---AEAYRVLRTNML--FG-RTDPKANTITVVSGGAGEGKSTTIFNLAVV
A0A3M1I883      --------PH---AEAYRVLRTNVL--FS-RKNPNDNTITVVSGGAGEGKSTTIMNLATV
A0A1V6JZ45      --------PH---GEAYRVLRTNIL--FS-RKEPGANTLTVVSGGAGEGKSTTILNLATV
A0A7C7Z746      --------PH---AEAYRVLRTNMT--FS-RKDPTKNSLTVVSGGAGEGKSTTLFNLAVV
A0A520RRW5      --------PH---AEAYRVLRTNIL--FS-RKNEKANTLTVVSGGAGEGKSTTIFNLATV
A0A356NPK0      --------PH---AEAYRVLRTNIL--FS-RKSEKATTLTVVSGGAGEGKSTTIFNLATV
A0A2D7B5P5      --------PH---AEAYRVLRTNIL--FS-RKXEKAXTLTVVSGGAGEGKSTTIFNLATV
A0A3D3XGB5      --------PH---AEAYRVLRTNIL--FS-RKNEKANTLTVVSGGAGEGKSTTIFNLATV
A0A2V6F8A1      --------PH---AEAYRVLRTNVL--FS-RKREDANSITVVSGGAGEGKSTTIFNLGVV
A0A2V5TNH4      --------PH---AEAYRVLRTNVL--FS-RKREDANSLTVVSGGAGEGKSTTIFNLAVV
A0A2V5X5Q6      --------PH---AEAYRVLRTNVL--FS-RKREDANSLTVVSGGAGEGKSTTIFNLAVV
A0A4P5QM05      --------AD---AEAYRILKGNIE--LN-LPDHGANTYTLVSGGPGEGKSTTLSNLAYI
A0A4Q3C001      --------QH---AEAYRILRANVE--FN-KPGRDANTFTLISGGPGEGKSTTLNNLAYT
B4DB23          --------SD---AEAYRILRAAVE--FN-KPYRDANTFTLISGGPGEGKSTTLNNLAYT
A0A6B3L938      --------PKTVHAESIRNLRASIR--LL-GRKERNQVICLTSALPGEGKTTTATELAAG
A0A2V5URB2      --------RISVVTESYRKLRAAIF--LS-RPEAPPKTILFTSGTASEGKTITVANTAIM
A0A2V2DJ66      --------ADRASTEAFRTLYSTLK--IN-NVSKDAKVILATSTTPSEGKSFVISNLAFT
R7L5A9          --------ADRATTEAFRSLHSTLK--VN-NFSKNAKVILFTSTTPSEGKSFIVTNLAFT
A0A5R8KA81      --------PNSPIAESFRILRSSLE--LM-EDHDKDEVVLFTSSIPSEGKSFCSANYAIS
A0A5B5WU87      --------PSEL-SESFPLLAERLVSLAE-ENGPGCFSILLTSSCPGEGKTYLAVNLALS
R7DZW0          --------PSEL-SECFPLLAERMVALSD-GNEGNPLSVLITSTCSGEGKTYLSVNLALS
A0A2N8HID1      --------PSEL-SECFPLLAERMVALSD-GNEGNPLSVLITSTCSGEGKTYLSVNLALS
A0A2N8HS06      --------PSEL-SECFPLLAERMVALSD-GNGGNPLSVLITSTCSGEGKTYLSVNLALS
A0A6N2TNT9      --------PSEL-SECFPLLAERMVALSD-GNGGNPLSVLITSTCSGEGKTYLSVNLALS
A0A3R5R2M8      --------DHSVIAECFHILRNNVDSLLP-RPDAGGYVILLTSTCPAEGKTFASANLAAA
A0A411SUQ6      --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
A0A2N8HZF2      --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
A0A354E720      --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
B2UPB6          --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
A0A2V6JLK8      --------PD---AEAYRILRTNIE--FN-RANPEANTISLVSGGPGEGKSTTIANLAFI
A0A2W5Z1A5      --------PD---AEAYRILRTNIE--FN-RRNPEANTISIASGGPGEGKSTTVTNLGYI
A0A2V6EA09      --------PD---AEAYRILRTNIE--FN-RKNPEANTISLVSGGPGEGKSTTIANLAFV
A0A2V6GQI7      --------PD---AEAYRILRTNIE--FN-RKNPEANTISLVSGGPGEGKSTTIANLAFV
A0A3C1HEJ2      --------AG---AEAFRSLRTTLS--ML-GPVNERRTFLFTSAVPDEGKTFCTINFAYS
A0A522ULD9      --------PH---AEAYRVLRANIQ--F--ANKGNGGAFSFISGGAGEGKSTTLFNLAYI
A0A1V6JU76      --------PQSNAAESFRTVRAAIA--LG-AKAEKMRVFTVTSTIPSEGKSLVASNLAVV
A0A2A2XXW5      --------PTSSPAEGFRTLRAAIS--LA-KNADKLRVMAFTSTIPSEGKSLVASNFAIV
A0A6N6Q6V0      --------PTSSAAEGFRTLRAAIS--LA-RNSEKLRNVAVSSTIPSEGKSLVASNFAIV
A0A1Q6UHJ9      --------ADRATTEAFRSVHSMLK--VN-NIAKDSKVLLFTSTTPSEGKSFVVTNLALM
A0A2V2BXR0      --------ADRATTEAFRSVHSMLK--VN-NIAKDSKVLLFTSTTPSEGKSFVVTNLALM
A0A2D8V0G3      --------PQSNAAEGFRTVRAAVS--LV-HKSDKFKVLSMTSTIPSEGKSLVASNLAIV
A0A348S017      --------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNLAIV
A0A3C1UUV7      --------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNLAIV
A0A350I3V2      --------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNLAIV
A0A520RGV5      --------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNLAIV
A0A3D3XF90      --------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNLAIV
A0A2D7B522      --------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNLAIV
A0A356NIC2      --------PQSNAAEGFRTVRAAIS--LV-HKADKFKVLAFTSTIPSEGKSLVTSNLAIV
A0A2N8HDG3      --------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFISANLALA
A0A146GCJ0      --------PSSMQAEAIRTLRTSIS--LL-GKQDDRKTFLFASAIPQEGKSFTSLNFAHA
A0A2T6D6H8      --------PASLQAEAIRTLRTSLS--LL-GKQETRRTFLFASSIPEEGKTFTSLNFAHS
A0A3D1TI55      --------PH---AEAYRVLRTNLQ--FA-AKDPGANAITIVSGGVGEGKSTTLFNLAYV
A0A3E1ET42      --------PD---AEAYRILRTNIE--FN-RRSADANAITIVSGGAGEGKSTTLVNLAYI
A0A2A2YDW8      --------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGAAGEGKSTTLVNLAYI
A0A352XLN9      --------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGAAGEGKSTTLVNLAYI
A0A3D0YP62      --------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTLCNLAYI
A0A3D3DV47      --------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTLCNLAYI
A0A2E5XJ49      --------PD---AEAYRILRTNIE--FN-RKNPEDNAITIVSGGAGEGKSTTLVNLAYV
A0A2E6SBY8      --------PD---AEAYRILRTNIE--FN-RKNPEDNAITIVSGGAGEGKSTTLVNLAYV
A0A2E5QMS4      --------PD---AEAYRILRTNIE--FN-RNNPEDNAITIVSGGAGEGKSTTLVNLAYV
A0A2E7YXQ3      --------PD---AEAYRILRTNIE--FN-RNNPEDNAITIVSGGAGEGKSTTLVNLAYV
A0A2E3H787      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITVVSGGAGEGKSTTLVNLAYV
A0A2E7AGN1      --------PD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTLVNLAYV
A0A2E7AKY7      --------PD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTLVNLAYV
A0A3D4CU34      --------PD---AEAYRILRTNIE--FN-RSNPEDNSITIVSGGAGEGKSTTLVNLAYV
A0A2E8M146      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTLVNLAYV
A0A355S8S2      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTLVNLAYV
A0A2D6DVN8      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNLAYV
A0A3C1W2R2      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNLAYV
A0A2E3NAY6      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITIVSGGAGEGKSTTLVNLAYV
A0A2E3II01      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNLAYV
A0A368B8C5      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNLAYV
A0A3R7RBB5      --------PD---AEAYRILRTNIE--FN-RNNPEDNSITIISGGAGEGKSTTLVNLAYV
A0A2A2QX62      --------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTLVNLAYI
A0A4Q3BWH6      --------PD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNLAYI
A0A3N5WCF1      --------PD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNLAYI
A0A4Q3C1K5      --------PD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNLAYI
A0A3R8IT45      --------ADRQVSEAFLTLHSSLR--LR-NDSKNAQTFLTTSTVPGEGKSFTTTNLALT
A0A2A2PYE8      --------ADRQVSEAFLTLHSSLR--LK-DESKNAKCILVTSTIPGEGKSFTTTNLALT
A0A2T6CN73      --------TDRLASEAFLTLHSSLR--LK-DESKNAKCILTTSTIPGEGKSLTTTNLALT
A0A2G4G428      --------KDVVAVEAVRTIYSSMR--VN-PASMSSHVFLITSTRPSEGKTFVATNLALG
A0A6N6PCD8      --------RQ---AEAFRCLRTSLS--L--LPEGSPKVILFTSSIPGEGKSFCSANYATS
A0A139TV24      --------EHSVMAEYFHIMCHNVDSMLP-FSEHQGHVILLASTTPGEGKTFISANLAQA
A0A2N8HT11      --------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFISANLAMS
R7DS70          --------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFISANLAMS
A0A2N8HNL6      --------EHSVISEYFQILCHNADSMLP-VTRNQGHVILLTSTMQGEGKTFISANLAIS
A0A6N6PAZ1      RLVFRPGTSATSYAEMYRVTRASIT--LL-GDEMQRKITLFTSSLPGEGKTLTSANFAIA
A0A6I1K459      --------LC---AEAFRSMRASLA--LL-GREEDRKVVFFTSAVPSEGKSFCCVNYAVA
A0A139TUL1      --------SRSFMEECFHILRNNTELLLLPNPEKASRVVFLTSTRTGEGKTFTALNLAAA
A0A2N8HCB0      --------GRSLMEECFHILRNNAELMLLPNPEEASRVLFMTSTRAGEGKTFTALNLAAA
A0A2N8HP04      --------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAA
A0A2N8HRJ0      --------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAA
A0A6N2U9Y7      --------GRSFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAA
A0A366HAG0      --------PD---AEAYRILRTNLE--FN-RRDPNANCISVASGSPGEGKSTTMVNLATI
A0A2U8DZK4      --------LDPAEDEPFRVLQTNITLALRNKPSHGAQTLVMLSAGPGEGKSTTLLRLARA
A0A2T6DFL8      --------DDPAELEPYRVLYTNLNLAL--KPGQAH-ALVFSSAGPGEGKSTTLHRLTRL
A0A1D8AWD4      --------PSSPEGEPYRVLQTNLNLAL--TAGKTS-VLVVLSSGPGEGKSTTLRQLALC
A0A4Q1C9S2      --------ATAPEGEPYRVLQTNLNLAL--PARQSS-VLVVLSSGPGEGKSTTLRQLALC
A0A178IH18      --------GDPADAEPFRVLQTNISLAR--KDAAPGRTLVMLSAGPGEGKSTTLLRLARA
A0A2T6DT99      --------EDPAELEPFRVLHTNLNLAL--KSDARGRTLILLSAGPGEGKSTTLLRLARA
A0A1G3ZT33      --------DNPAESEPFRVLQTNLNLAL--PPGQPG-SLVVVSAGPGEGKSTTVHHLVRV
A0A3E1E2T2      --------D-PAETEPFRVLHTNLNLAL--KPGEAA-SLVLFSAGPGEGKSTTLHRLVRV
B1ZMW1          --------D-PAEAEPYRVLQTNLNLAL--KPGQPA-SLVIFSAGPGEGKSTTLFRLARL
A0A3M1I8A3      --------NA---SESIRSIRAAVA--LG-DHGEKLRVLTVTSTIPSEGKSIIAANLAIA
A0A4V0XS84      --------IS---SEGFRTLRAAIS--LT-QQPENLRTIVVTSTIPSEGKSLVASNYAIV
A0A351WE84      --------PH---GEPYRVLRTNMQ--FS-NKGIHGGAFAVISGGVGEGKSTTLFNLAYT
D5ENH7          --------HV---TETFRSIHSAMK--LN-DESKNAKIIVTTSTVPSEGKSFVSSNLALT
A0A0R2XQ77      --------HV---TESFRSIHSALR--LS-DESRHAKVLVTTSTVPGEGKSFISSNLALT
A0A2E9IN28      --------HV---TETFRTIHSALK--LN-DESKNAKIILTTSTVPSEGKSFVSSNLSLT
A0A6N4WTJ5      --------HV---TETFRSIHSALK--LN-DDSKNAKVIVTTSTVPGEGKSFISSNLALT
A0A1V5QDZ6      --------PH---AEAYRVLKTNLQ--FA-NKGTLGGAFALVSGGVGEGKSTTLFNLAYV
A0A4Y8P964      --------LI---SNAYRQIRTLLH--YA-IPNRKPQLIALTSTYPSEGKSSTVVNLATV
A0A3D4HF88      --------RV---TEAFRSVHSALN--LN-EISKNAQIILMTSTVPSEGKSFVSTNLAYT
A0A6N6ZHN8      --------PT---VEAFRSIHSTLK--LH-EESKNAKVIVTTSTVSSEGKSFASTNLAIT
A0A351MR11      --------MA---IESLRAIHSVMK--IN-PSAANAKVLLTTSTRPGEGKTFVTTNIALT
A0A6G6K641      --------PV---SESFRTLRSAIM--LL-GRFDERRVFMFTSALPAEGKTFCASNFAVS
A0A5B5WI95      --------EQSVMAECFHILRNNVDSLLP-RPDEGGHVIMLTSTTPGEGKTFTSANLAAT
A0A2N8I9W1      --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
A0A4Q5IH27      --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
A0A2N8IBZ6      --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
A0A2N8IJW9      --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
R6J100          --------EHSVIAECFHILRNNVDSMLP-RPEQGGHVILVTSTLPGEGKTFTSANLAAA
A0A1V6J089      --------GQ---GEAYRSLRTSMA--LL-GREDNKKIFAVISGGVGEGKSTTLFNLAYV
A0A3C1BZR1      --------GQ---GEAYRALRTSLA--LL-AREGKQKIFTVISGGVGEGKSTTLFNLAYV
A0A7C4KLL2      --------RG---AEAFRTLRTSVL--ML-GRQEERRVFLFTSAFPSEGKTFNSVNFAIS
A0A1H6KPB7      --------PD---AEAYRILRTNIE--LK-RKDTNVVTLALVSGNAGEGKTTTLCNLAYV
A0A2E9ISN4      --------TNQIATETYRRIRLNLL--KQ-FGQDENISFTVTSSQSGDGKTFNVANIALP
B9XAX1          --------IC---SEAFRTLRTTTG--IL-GHEEGKRITLFTSADPNEGKTFFSLNHAIC
A0A5R8KKM9      --------PD---AEAYRILRTNIE--FN-RKRPDANVISVVSGGSSEGKSTTMVNLATV
A0A139TS01      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A3E1EJT7      --------AI---VEAFLSLYSNLR--IN-DESRNARLILVTSTLPSEGKSFITTNLGLT
A0A317ZP96      --------HV---TETFRTIHSALK--LN-DESKNAKVIITTSTVPGEGKSFISSNMALT
A0A7C3I5X9      --------NA---AESFRTIRAAIT--LG-SRGDRFRLLAVTSSMPAEGKSTIAANLAIV
A0A2D5WGA5      --------PH---AEAYRVLRTNIL--FAGRKDESQTTFSVVSGGAGEGKTTTMFNLAVV
A0A2E7SSH2      --------PH---AEAYRVLRTNIL--FAGRQSEDQTTFSVVSGGAGEGKTTTMFNLAVV
A0A349GXM8      --------GA---IEAYRALRTSVL--AE-LAKKHEKILMITSADSREGKTLTALNLSIM
A0A4P5YP61      --------IG---AEAIRTLRTSLS--ML-GKAENRRVYLFTSAIPAEGKTFCSLNYAVS
A0A6B2LYM4      --------HA---VEAFRSIHSTLK--LN-EESRNAKVILSTSTIPSEGKTFISTNLSIT
A0A6D1VXB3      --------FV---SNAFRQIRTLLH--YA-IPNRKPQLIAITSTYPSEGKSSTIVNLATV
I0JYY7          --------FV---SNAFRQIRTLLH--YA-IPNRKPQLIAITSTYPSEGKSSTIVNLATV
A0A4R7S1J2      --------PV---AESFRSLRVMAN--LL-GKEEDRRVFVVTSALPSEGKTFCSCNYALS
A0A2A2XV69      --------PD---AEAYRIMRTNIE--FN-RKNPASNSITIVSGGPGEGKSTTLNNLAYT
A0A651H7X9      --------QA---VEAFRTLHSSLK--LH-DESKNAQALLITSTTPGEGKSFTATNLALT
A0A4Y8P842      --------EI---SNGFRSIRTLLH--YT-IPGRRPQVITITSTQESEGKSGTTVNLATV
B3DZK9          --------EV---SNGFRSIRTLLH--YT-IAGRRPQVITVTSTLESEGKSGTTVNLATV
A0A5E6MPC4      --------AV---SNSFRQIRTLLH--YS-LPDRRPQVMLITSCQMGEGKTSTTVNTATV
A0A6N6PKP9      --------AL---AESFRTLRTSLG--IT-GKDAGGHAVLFASAVPGEGKSFCAINCAVA
A0A6N6Z250      --------PG---AEVFRVIQTNLQ--IA-GGSARGEVLLVQSAGPGEGKSTVLRNLAAC
A0A4V1SB02      --------SQ---AEAYRTLRASLS--LL-GEESQRRVLLVTSAVPAEGKTFTATNLAAA
A0A6N6QEJ2      --------PH---AEAYRVLRTNIL--FS-RKDPGCRTMTVVSGGAGEGKSTTIFNLATI
A0A3C1VB86      --------PN---AEVFRTLRATLS--ML-GRENDRKTYLFTSSLPGEGKTFTSVNYAVS
A0A146G2Q9      --------AD---AEAYRILRTNIE--FN-RKNPDANTITMISGGAGEGKSTTMSNLASI
A0A2T6D3Y2      --------AD---AEAYRILRTNIE--FN-RKNPDANTITMISGGAGEGKSTTMSNLASI
A0A6N6P5E3      --------PD---AEGYRILRTNIE--FN-RKNPNNNTLTLVSGGPGEGKSTTMNNLAFT
A0A2D5VY59      --------PH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTIFNLATI
A0A2D8UZZ4      --------PH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTIFNLATI
A0A353DV86      --------PH---AEAYRVLRTNIL--FS-KKDPKFNALTVVSGGAGEGKSTTIFNLATI
A0A2E5EPT8      --------PH---AEPYRVLRTNIL--FT-NKKPNANTITVVSGGAGEGKSTTVLNLATI
A0A6J4HTK1      --------PD---AEAYRILRTNIE--FN-RKSPDANTLSLVSGGPGEGKSTTLANLAFT
A0A6N6PHJ5      --------PH---AEAYRVLRTNLL--FA-RKDDKLNTTAVVSAGAGEGKSTTVLNLATV
A0A6M1RXR2      --------PH---AEAYRVLRTNIL--FS-RKDERLNTLVVVSAGAGEGKTTTVLNLATV
A0A7C3DXS4      --------PH---AEAYRVLRTNLL--FS-RKDERLNTLVVVSAGAGEGKTTTVLNLATV
A0A2V2SDV4      --------PH---AEAYRVLRTNLL--FS-RKDDKLNTVAIVSAGAGEGKSTTVFNLAAV
A0A2V5PK75      --------PH---AEAYRVLRTNLL--FS-RKDDKLNSVAVVSAGAGEGKSTTVFNLACV
A0A1V6DME1      --------PH---AEAYRVLRTNLL--FS-RKDDKLNSIAVVSAGAGEGKTTTVFNLATV
A0A3D3DIJ3      --------PH---AEAYRVLRTNLL--FS-RKDDKLNTIAIVSAGAGEGKSTTVFNLAAV
A0A6I1K583      --------PH---AEAYRVLRTNVL--FT-RKDEHANAITVVSGGAGEGKSTTVLNLATI
A0A350EWA4      --------PH---AEAYRVLRTNIL--FS-RKSEDQNTITVVSGGAGEGKSTTLFNLACI
A0A5B5WZ91      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A2N8HD92      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A2N8HIT2      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A354EBD3      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A355VEB2      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A2N8IMT3      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
R6K1U5          --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTLCNLAYI
A0A2N8IWC2      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A2N8I441      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTLCNLAYI
A0A2N8I3A6      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A410SCC4      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKSTTLCNLAYI
A0A3R5VEW0      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A411SSG2      --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
B2UKW3          --------PD---AEAYRILRTNIE--FN-KKGLEEISLTFVSGSAGEGKTTTLCNLAYI
A0A7C3HWX0      --------PH---AESYRVLRTNVL--FS-RKRPDANSLTVVSGGAGEGKSTTIFNLATV
A0A7C4KPD7      --------PH---AEAYRVLRTNLL--FS-RKDQGWNTLTVVSAGAGEGKSTTLFNLAVV
A0A1M6RLZ4      --------PD---AEAYRILRTNIE--FN-RKNPDDNSITVVSGGAGEGKSTTLVNLAYI
A0A354T7G8      --------PD---AEAYRILRTNIE--FN-RKSPDANCFSVVSGGAGEGKSTTMVNLAYV
A0A2S7U4L6      --------PD---AEAYRILRTNIE--FN-RPSQDDNAITVVSGGAGEGKSTTLVNLAYI
A0A512MBZ2      --------PD---AEAYRILRTNIE--FN-RRNPEANCITVTSGGAGEGKSTTLCNLATV
A0A2E8MEZ0      --------PD---AEAYRILRTNIE--FN-RKNPEDNSITVVSGGAGEGKSTTLVNLAYV
A0A6B3LBV6      --------PD---AEAYRILRTNIE--FN-RRSADANSITMVSGGAGEGKSTTLVNLAYV
A0A2E3EC33      --------PD---AEAYRILRTNIE--FN-RKTADANSMTIVSGGAGEGKSTTLVNLAYV
A0A2E4GN01      --------PD---AEAYRILRTNIE--FN-RKTSDANSMTIVSGGAGEGKSTTLVNLAYV
A0A1Z8XU55      --------PD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTLVNLAYV
A0A2E1RQR9      --------PD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTLVNLAYV
A0A2E3ISQ4      --------PD---AEAYRILRTNIE--FN-RKNADANSITLVSGGAGEGKSTTLVNLAYV
A0A2D6W6F4      --------PD---AEAYRILRTNIE--FN-RKNADANAITLVSGGAGEGKSTTLVNLAYV
A0A2D8Z5A8      --------PD---AEAYRILRTNIE--FN-RKNADANAITLVSGGAGEGKSTTLVNLAYV
A0A4Q2YKS3      --------PD---AEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNLAYI
A0A6N6P3T8      --------PD---SEAYRILRTNIE--FN-RKNPEDNAITVVSGGAGEGKSTTLVNLAYV
                              :                           .     **:         

A0A2A2XVF1      FAQQGLKTLLIDADLRRPSLHKALLTVDTLPN-------GLTDYFSGNS-RLASVII-PT
A0A2V5UHJ2      FAQLGIRVLIIDADLRRPRCHALL--RMENLA-------GLSDLLAGQI-ELQSAIR-PT
A0A2V5PST3      LAQDSFKVLIIDADLRRGSCHSRL--GIGNHR-------GLSNLLAGNV-SIEEVVQ-RT
A0A2V5PXM3      LAQQGLRTLIIDCDLRRPMVENTLQNNNQRGF-------GLTDYLTGQK-DFKAVVH-AS
A0A1V5QB01      LAQAGARILMVDSDMRRGELHKFF--GLEGGR-------GLSDLLAGQA-KPEAVIQ-RT
A0A7C5LI63      FAQIEERTLLLDADLRRGEIHKYF--GLERDK-------GLSDVLLGEA-TPEEVVR-HT
A0A7C5P291      FSQVEDRVLLIDGDLRRGEIHKFF--NAEKEK-------GLADVLLGEA-TPEEVIK-QT
A0A139SU05      FARHGKRTLLVDCDLRRPMLHRRF--DLANTS-------GIIAFYEADG-DLDCDLPNDS
A0A139SPN4      FARHGKRTLLVDCDLRRPMLHRRF--DLANTS-------GLIPFYESGA-SLDTDLSTDP
A0A1V6E7N1      FARHGRRTLLIDCDLRRPMMHRHF--KQSNQA-------GIITWFEKGA-DLSVEPQKNP
A0A2D9MYT1      TAQTGAKTLLVDCDLRRPSVHKAF--QIQSPK-------GLSSYLLGKVDTIDSIVH-QT
A0A258ANJ7      LASQGFRTLLIDMDLRHSQLAQVF--GIPNTR------KGVVDLLLEEV-SFAEVCL-SG
A0A290QGD9      FAAHGEKVVVIDCDLRRPNIHKSF--RIANQR-------GVIDLCGGDT-RVEDVVV-KG
A0A1D8AS58      FAAHGEKVVVIDCDLRKPNIHKSF--RLENIK-------GVIDVCAGTH-TIDQVVI-KG
I6AQC1          FAAHGDRVVVLDCDLRKPNIHKSF--RRENLK-------GVIDVCAGSA-TIDDVVM-RD
W0ITH7          FAAHGDRVVVVDCDLRKPNIHKSF--RRENLK-------GVIDVCAGSA-TIDDVVM-RD
A0A139TLN4      LAVAGKKVLLMDMDLRKGTLSSLL--GGEGKP-------GTGDLDRVGEGGWRSLLEKSS
A0A1G3ZFT0      LATADKRILLVDADLRKGTVHKYF--NLDPSP-------GFAELIQGSV-NIEEALK-LT
A0A1Z8ZMT6      YAKQGTRTLLIDFDLRKPAVHKIFNEERAARP-------GIVNVLNGTA-AANQAITVYP
A0A2E8MCT7      YAKQGTRTLLVDFDLRKPAVHKIFNEERAARP-------GIVNVLNGTA-AANQAITVYP
A0A290Q2Z2      MGAAGERVLLVDSDLRRPTQHQLA--ALPKEP-------GLADLLQGKA-TLEKVTQ-RG
A0A2A2RGK2      LAQQGFNTLFIDADLRKPGGSIVFF-GENRKP-------GLSEVLMRTC-TMKNAIV-PT
A0A2A2XXF7      LAQQGFNTLFIDADLRKPGGSIVFY-GENRKP-------GLSELLMRSC-AMKNAVM-PS
A0A2A2R5D6      CAQSGQSVLLVDADLRRPTVHTIL--GIENEA-------GISEAMRGLG-EAHQYIR-AT
A0A1J4XH17      FAANDEKVLIIDADLRMPSIGSSL--QLDKKK-------GILQYCEEGA-TLDDIVN-KN
A0A3C1VJ32      FAQAGNRVLIVDSDLRRPTLHKLF--KVANNL-------GLTNYLLKQN-TVVEVVQ-TT
A0A2N9NTX7      FAQGSQRVLIVDSDLRRPTLHRML--RVSNSI-------GLTNYLLKQN-TLEEVIQ-TT
B9XK55          FAQSGHRVVMVDSDLRRPTLHKLV--NVSNTI-------GLTNYLLKQN-TLEEVIQ-TT
A0A4P5YMI6      FAHNGHKVLLVDTDIRRPSLHKRL--NVSNSI-------GVTNVLLKQC-PVEEAIQ-TT
A0A2E6T482      FAQQGDRCLIVDSDLRRPSMHRYL--QVSNNI-------GLTNYLLGQV-XIDEVIQ-TT
A0A3C0DQZ7      FAQQGDRCLIVDSDLRRPSMHRYL--QVSNNI-------GLTNYLLGQV-TIDEVIQ-TT
A0A1Z9CBK5      FAQMGDRILVVDSDLRRPSMHRYF--KVSNNI-------GLTNLLLGQN-TLDEVIQ-TS
A0A2D6ZI96      FAQMGDRILVVDSDLRRPSMHRYF--KVSNNI-------GLTNLLLGQN-TLDEVIQ-TS
A0A358KGZ3      FAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLGQN-TLDEVIQ-TS
A0A2E9ZQX4      FAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLGQN-TLDEVIQ-TS
A0A3D5JZU0      FAQMGDRILVVDSDLRRPSMHRYF--KVSNTI-------GLTNLLLGQN-TLDEVIQ-TS
A0A2E6HCR0      FAQLGDRILVVDSDLRRPSMHRYF--KVTNSI-------GLTNLLLGQN-TLDEVIQ-TT
A0A1Z8WN04      FAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLGQN-TVEEVVQ-IT
A0A2D7L1N4      FAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLGQN-TVEEVVQ-IT
A0A2E2R937      FAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLGQN-TVEEVVQ-IT
A0A520QQY4      FAQLGDRILVIDSDLRRPSMHRYF--KVSNNI-------GLTNLLLGQN-TVEEVVQ-IT
A0A2D5MR66      FAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLGQN-TVEEVVQ-IT
A0A2E0PDQ1      FAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLGQN-TVEEVVQ-IT
A0A2E2ZZP9      FAQLGDRILVIDSDLRRPSMHRYF--KVSNSI-------GLTNLLLGQN-TVEEVVQ-IT
A0A7C4LRK7      FAQNAARVLIVDSDLRRPSLHRIL--KVSNSI-------GLTNYLLKQN-TLEEVIQ-TT
A0A2A2RGF2      FAQNGDKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLGQN-KLEEVVQ-HS
A0A2G4I5Y6      FAQNGDKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLGQN-TLEEVIQ-HS
A0A6N6PS97      FAQNGSRVLLVDSDLRRPSLHKIL--NLSNSI-------GLTNYLLKQN-TLEEVVQ-RT
A0A3M1I883      FAQNGERVLLVDSDLRRPSLHKFI--GVSNSI-------GLTNYLMKQN-TLEEVIQ-TT
A0A1V6JZ45      FAQNGQRVLVVDSDLRRPSLHKFL--AVSNSI-------GLTNYLMKQN-TLEEVIQ-TT
A0A7C7Z746      FAQEGQKVLIVDSDLRRPSIHKMM--HVTNSI-------GLTNYLLGQN-TLEEVIQ-TS
A0A520RRW5      FAQNGSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLATK-SLEEVVQ-TT
A0A356NPK0      FAQNDSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLATK-SLEEVVQ-TT
A0A2D7B5P5      FAQNXSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLATK-SLEEVVQ-TT
A0A3D3XGB5      FAQNGSRILIVDSDLRRPSLHKHV--GVSNAL-------GLTDYLLATK-SLEEVVQ-TT
A0A2V6F8A1      FAQNGQRVLLVDSDLRRPSLHKLL--NVSNAV-------GLTNYLLRQN-TLEQVIQ-TT
A0A2V5TNH4      FAQNGQRALLVDSDLRRPSLHKLL--NVSNSV-------GLTSYLLRQN-TLEEVIQ-TT
A0A2V5X5Q6      FAQNGQRALLVDSDLRRPSLHKLL--NVSNSV-------GLTNYLLRQN-TLEEVIQ-TT
A0A4P5QM05      YAKGGANVLVVDADLRRPSQHRFF--NVDNSI-------GLVDYLHGRK-TLDEITH-PS
A0A4Q3C001      CAKGGYNVLVVDADLRRPTQHRIF--EVDNNY-------GLTDYLTGKA-SIDEITR-TT
B4DB23          CAKGGYNVLVVDADLRRASQHHFF--DVDNSF-------GLTDYLLGRA-EIDEIIK-TT
A0A6B3L938      FALAGERVLLVDFDLRKPRVHAEFP-DLKGKP-------GTVELLTGQA-EFSQAVH-AT
A0A2V5URB2      FARLGNRVLLMDADLRRPTCHKAL--KVQGAT-------GLADYLAGQE-ELDKVIK-LT
A0A2V2DJ66      CALNGEKCIIIDADLRLPALAKVL--GISASK-------GLVSYIEEGD-SLDDVII-KD
R7L5A9          YALHGEKTIIIDADLRLPAMAKVL--GITAKD-------GLIGHIEEGK-PLEDAII-HD
A0A5R8KA81      SANLGKRTLLIDADLRRPMVNELFF-KGRVSV-------GLADVLQGKV-TLEEALH-VS
A0A5B5WU87      LAVAGKKVLLMDMDLRKGTLSSLL--GGQGKP-------GIGNLDRSGEGGWRSLVEKSS
R7DZW0          LAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRSLVEQSP
A0A2N8HID1      LAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRSLVEQSP
A0A2N8HS06      LAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRSLVEQSP
A0A6N2TNT9      LAVAGKKVLLMDMDLRKGALSALL--GGAGKP-------GLGDLEQAGEGGWRSLVEQSP
A0A3R5R2M8      FAKAGRKVLLIDGDLRKRSLSRQL--GGYGRR-------GLTSILLNRLQTAALPIR---
A0A411SUQ6      FAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQTTDTTGIIR---
A0A2N8HZF2      FAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQQNPDTTGIIR---
A0A354E720      FAYAGKKVLLIDGDLRKSSLTRRL--GGSGRK-------GLTSILLRQNPDTAGVIR---
B2UPB6          FAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQTTDTTGIIR---
A0A2V6JLK8      CAQGGYSTLIVDADLRRPVQHLLF--DLSNEI-------GLTNYLTTDM-DLDQAIL-PT
A0A2W5Z1A5      CAQGGYSTLIVDADLRRPVQHMHF--DLDNKI-------GLSNYLTSNM-RIEEVIR-PT
A0A2V6EA09      CAQGGYSTLIVDADLRRPIQHEFF--GVSNTA-------GLTSYLTTEM-PLEKVIL-PT
A0A2V6GQI7      CAQGGYSTLIVDADLRRPIQHEFF--GVSNTA-------GLTSYLTTEM-PLEKVIL-PT
A0A3C1HEJ2      LAQQGMRTLLIDCDLRCPTVEEYLLGRNTESP-------GVSDYLSGKK-DFSDIIQ-KS
A0A522ULD9      CAQQGDKVLIVDSDLRRPTQHTIL--GLSNRL-------GLTNVLMRDV-PIEETIK-PT
A0A1V6JU76      VAQTGLRTVLVDADLRRPSLHKAF--QLHSPM-------GLTAYLTEQTNRVDDVIQ-TT
A0A2A2XXW5      TSQTGLKTLLVDADLRRPSVHKAF--QLQSPV-------GLSAYLSGRTDNFSEFVH-TT
A0A6N6Q6V0      TAQTGLRTLLVDADLRRPSVHKAF--QLQSPV-------GLAAYLAERVKSVDEIVH-TS
A0A1Q6UHJ9      CAMHGEKTIIIDADLRLPAMAKVL--GIESRD-------GIVGYVEDGR-PLEDCVI-KD
A0A2V2BXR0      CAMHGEKTIIIDADLRLPAMAKVL--GIESRD-------GIVGYVEDGR-PLEDCVI-KD
A0A2D8V0G3      TAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GLSAYLTGQITDPSEITQ-TT
A0A348S017      TAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ-KT
A0A3C1UUV7      TAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ-KT
A0A350I3V2      TAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ-KT
A0A520RGV5      TAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ-KT
A0A3D3XF90      TAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ-KT
A0A2D7B522      TAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ-KT
A0A356NIC2      TAQTGVKTLLIDADLRRPSMHKAF--QMQSPI-------GISSYLTDQVSDIAEITQ-KT
A0A2N8HDG3      FANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFSVIRTLP
A0A146GCJ0      LAQKGLRTVVIDADLRRPRLKDDLLPDAGDID-------GLTDYLSGGA-PLDQVVR-KT
A0A2T6D6H8      LAQQGLRTVIIDADLRKPRLKADLLPEEGDIS-------GLTNYLSGTA-TLTEVVK-KT
A0A3D1TI55      CAQLGDKVLLVDSDLRRPALHKIL--GMSNDF-------GLTNVLMRDV-PIEETIK-ST
A0A3E1ET42      CAQGGYNTLMIDGDLRRPKLHTFF--DINNSV-------GLTNYLTTAL-MLEDVIL-QT
A0A2A2YDW8      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLSNYLTTEL-MLEDVIL-QT
A0A352XLN9      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLSNYLTTEL-MLEDVIL-QT
A0A3D0YP62      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTDL-LLEDVIL-QT
A0A3D3DV47      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTDL-LLEDVIL-QT
A0A2E5XJ49      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTDL-MLEDVIL-QT
A0A2E6SBY8      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTDL-MLEDVIL-QT
A0A2E5QMS4      CAQGGYTTLMIDSDLRRPTLHTFF--DINNSV-------GLTNYLTTDL-MLEDVIL-QT
A0A2E7YXQ3      CAQGGYTTLMIDSDLRRPTLHTFF--DINNSV-------GLTNYLTTDL-MLEDVIL-QT
A0A2E3H787      CAQGGYTTLMIDADLRRPQLHTFF--DINNSV-------GLTNYLTTDL-MLEDVIL-QT
A0A2E7AGN1      CAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A2E7AKY7      CAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A3D4CU34      CAQGGYTTLMIDADLRRPTVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A2E8M146      CAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A355S8S2      CAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A2D6DVN8      CAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A3C1W2R2      CAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A2E3NAY6      CAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A2E3II01      CAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A368B8C5      CAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A3R7RBB5      CAQGGYTTLMIDADLRRPNVHTFF--DINNSV-------GLSNYLTTDL-MLEDVIL-QT
A0A2A2QX62      CAQGGYTTLMIDADLRRPRLHTFF--EINNSV-------GLTNYLTTEL-MLEDVIL-QT
A0A4Q3BWH6      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTEL-MLEDVIL-QT
A0A3N5WCF1      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTEL-MLEDVIL-QT
A0A4Q3C1K5      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTEL-MLEDVIL-QT
A0A3R8IT45      FAAHGDKVVIVDCDLRKPNIHKSF--RRENLK-------GVIDVCAGSA-TIDDVVM-RD
A0A2A2PYE8      FAAHGERVVVIDCDLRKPNIHKSF--RLENLK-------GVIDICAGKA-TIADVAI-RN
A0A2T6CN73      FAAHGEKVIVVDCDLRKPNIHKSF--RIENIR-------GVIDVCSGKA-TLDEVIV-RN
A0A2G4G428      FSQHGERVLVIDADLRLPNVGPSL--GLTGTE-------GISRWFNDES-TIDESIV-KN
A0A6N6PCD8      LAQQNLRILIIDADLRKPGLGKSF--PTKHGV------IGLSDVLSGKA-VFEEACH-ST
A0A139TV24      FSKIGKRVLLIDGDLRKTSLSSQL--GGKGRK-------GLSTILLNKVSDLSSVIHPLP
A0A2N8HT11      FANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFSVIRTLP
R7DS70          FANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFSVIRTLP
A0A2N8HNL6      FANIGKRVLVIDGDLRKASLSKQL--DGKGRK-------GLSTILLRKVEDPFSVIRTLP
A0A6N6PAZ1      AAGQGRKTLLIDMDLRKPSIHKLF--GIPRAG----ENGGLTEFLANLA-SFEDVIRHDS
A0A6I1K459      YAQQGRRTLVIDFDLRKPTLAESF--GLKEDL------AGVSDVLLGKA-TLDQSVQ-KT
A0A139TUL1      YAQTGKKVLLIDGDLRKASLSAFC--VGKNSR-------GLAHLLMNPLASPDSVLQSGE
A0A2N8HCB0      YAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDSVLQSGR
A0A2N8HP04      YAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDSVLQSGK
A0A2N8HRJ0      YAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDSVLQSGK
A0A6N2U9Y7      YAQTGKKVLLIDGDLRKASLSAFY--GGKNAR-------GLVHLLMNPQVSPDSVLQSGK
A0A366HAG0      CAQGGYNTLIIDADMRRPRQHTFF--NVPHTF-------GLSNYLSSNV-PLEEVVV-QT
A0A2U8DZK4      MGAAGERVLLIDADLRRPTQHRLF--NVAKTP-------GLADLLQSKV-TLDQCRS-RN
A0A2T6DFL8      MGEMGDRVLLIDADLRRPTQHRIA--ERPRSP-------GLSDLLTAQK-TLDEVIQ-KS
A0A1D8AWD4      MAAAGEKVLLIDSDVRRPTQHKLA--GLSRDP-------GLTDIVLNKV-PWTAAVV-RD
A0A4Q1C9S2      MAAAGEKVLLIDSDVRRPTQHKLA--TLPREP-------GLTDIVLNKV-GWEAAVQ-RD
A0A178IH18      MGEAGARVLLIDSDLRRPTQHQLT--GAAKEP-------GLADLLQGKA-TLDDVTR-RS
A0A2T6DT99      MAKAGERVLLIDSDLRRPTQHQLA--GLRKEP-------GLAEVLQGKA-TLQSVTQ-RE
A0A1G3ZT33      MAAAGERVLLVDSDVRRPAQHRLM--DQTREP-------GLIDLLLNKA-TLESVVR-RD
A0A3E1E2T2      MAAGGERVILIDSDVRRPTQHHLA--DRPREP-------GLSEFLLNRK-TLDEVIQ-KG
B1ZMW1          AAAAGERVVLIDSDFRRPAQHRLA--ERPREP-------GLSDWLMNRQ-PLETIVQ-RE
A0A3M1I8A3      MAQTGYRTLLVDADMRRPRLHKAF--QLHNPV-------GLPAYLHGKTDQFEELVT-AT
A0A4V0XS84      SAQSGLRTLLVDADLRRPSVHKAF--GIENNI-------GLSAYLMDQVTDPTEIIN-TS
A0A351WE84      CAQLGYKTIVVDSDLRRPVQHSIL--SMSNRI-------GLTNVLMKDS-TLEECVK-PT
D5ENH7          FANHGEKTLLLDADLRLPNVAASM--QLENER-------GVLDHVEKGM-PIEDVTI-RE
A0A0R2XQ77      FANHGEKTLLLDGDLRLPNVARSL--QLQNDF-------GLLDHIEKGV-ALDEVIL-KE
A0A2E9IN28      FANHGEKTLLIDCDLRLPNVARSL--QLENDF-------GVLDHIDKGV-DLDEVII-KE
A0A6N4WTJ5      FANHGEKTLLLDGDLRLPNVARSL--QLENEF-------GVLDHIEKDV-SLDEVII-KE
A0A1V5QDZ6      CAQLGDKVLIVDSDLRRPVQHRIL--GVSNRF-------GLTNVLMRDV-PIEETIK-TT
A0A4Y8P964      LGQQG-TVLIIDGDLRRPMLHKVL--GLRPRP-------GLSEILTGQV-NVEEAIQ-ST
A0A3D4HF88      YASHGERVVLIDCDLRMPNVAKSM--NLSNEK-------GLQQCLKDGS-RPEDVVH-KD
A0A6N6ZHN8      FAIHGERTLVVDCDLRMPNVAKSL--DLSEHK-------GVIDYINGND-DLDGLII-HD
A0A351MR11      FAQHGERVLVVDADLRLPNVAPSM--GIETDN-------GISKYFNNEI-TLDEAIL-KD
A0A6G6K641      LAQQGLKTVLVDCDLRKPAISEVFL-GKAAPI-------GVSDVLAGQC-ALDEVLQ-ST
A0A5B5WI95      FAKAGRKVLLIDGDLRKFSLTRQM--GGHGRR-------GLTSILLNQVDDPFHIIR---
A0A2N8I9W1      FAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQSSDTTGIIR---
A0A4Q5IH27      FAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQSSDTTGIIR---
A0A2N8IBZ6      FAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQSSDTTGIIR---
A0A2N8IJW9      FAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GLTSILLQQSSDTTGIIR---
R6J100          FAYAGKKVLLIDGDFRKSSLTRRL--GGSGRK-------GFTSILLQQSSDTTGIIR---
A0A1V6J089      CAEQGSKVLVIDSDLRRPVQHKMV--GLANRA-------GLVNVLTGEL-KPEDVIQ-ET
A0A3C1BZR1      CAEQGSKVLIIDSDLRRPVQHKMV--GLANRT-------GMVNVLTGDL-KAEDVIQ-ET
A0A7C4KLL2      LAQQGLKVLLIDADLRKPSVENFITGQTGKLA-------GLTDILVGSK-SLGEVIHTLE
A0A1H6KPB7      FAQGGFSTLMIDADLRRSKLAEYN--DVECEY-------GLSNFLTSDL-ALQDVIL-QT
A0A2E9ISN4      FAWVGKRVLLIDADLRLGNLTRRLL-GRELRH-------GLADWLADDSCDANIHIV-KL
B9XAX1          QAQGGKLTLLIDLDLRRPSVGESFS-HPPGTP-------GVTNYLLGKE-SLSTLVL-KT
A0A5R8KKM9      CAQGGYNTLIIDGDLRRPRMHTFF--DVTNDV-------GLTTYLSSPM-ELEEVVL-ET
A0A139TS01      CAQGGYATLMIDADLRRSKLHRYY--ELDNEA-------GLTSYLLEDY-PLEEVIF-QT
A0A3E1EJT7      FASQGQRTVIVDCDLRKPNVERSF--RLQTTA-------GVISYCLQGS-ALDDIIV-KN
A0A317ZP96      FANHGEKTLLLDGDLRLPNVARSL--QLENEK-------GLLDHVEQGK-DLDDVIV-KE
A0A7C3I5X9      IAQTGLRTLLVDADLRRPSVHHGF--EAEGAA-------GLVAYLTGKVATLEEVAQ-RT
A0A2D5WGA5      FAQQGDRVLIVDSDLRRPSMHRYL--KVTNNT-------GLTNYLLGQN-TIEEVIQ-TT
A0A2E7SSH2      FAQMGDRILVVDSDLRRPSMHRYF--KVTNNI-------GLTNLLLGQN-TLDEVIQ-TS
A0A349GXM8      VVQMGKRVLLVDMDLRRGRIHRSL--GLDREP-------GVTDVLRHGK-SLREVIQ-PA
A0A4P5YP61      LAQQGSKTLLIDGDLRRPAVEKAISGKDKKAV-------GVTDYILGQK-TLKEIVQ-QT
A0A6B2LYM4      FAAHGERTIVVDADLRMPNVSKEL--NIDGKR-------GIIQLIADKG-DLDSYIY-KD
A0A6D1VXB3      LGQQG-TVLIIDGDLRKPSLHKSL--GLRPRP-------GLSEILTGQV-NIEEALQ-LS
I0JYY7          LGQQG-TVLIIDGDLRKPSLHKSL--GLRPRP-------GLSEILTGQV-NIEEALQ-LS
A0A4R7S1J2      LAQQGLKTLLIDADLRRPKVSASVY-GEDRKP-------GLTEYLLGQA-TFTDVIH-SS
A0A2A2XV69      FAKGGYTTLVVDADLRRPSQHRIF--GIDNKN-------GLSDLLTKQL-SLEQVVH-KT
A0A651H7X9      YAQHGEKTLLIDCDLRKPNIHQGL--QLENDT-------GLIDFVRGNA-NFDALAK-RS
A0A4Y8P842      LGQQG-TVLIIDADLRRPAIHKNL--GLRPRP-------GLSEILTGQA-QVEEAVQ-AT
B3DZK9          LGQQG-TVLVIDADLRRPSIHKIL--GLRPRP-------GLSEILTGQA-QVEEAVQ-PT
A0A5E6MPC4      LGQQG-TVLLIDADLRRPNLHKIL--GLRPHP-------GLSELLTNQA-SLGNAVQ-AT
A0A6N6PKP9      FAQQGLRTLLIDADLRLPTVERIIL-QTQGAP-------GLSDLLLGHT-HLGKAIH-LT
A0A6N6Z250      AALGGERVLVIDSDLRRPTQHDLL--SAERQP-------GLVDYLAGQR-ELDAVVR-PT
A0A4V1SB02      LATQGLSTLLIDADLRRPALSATM---LERDVRQNEEFRGLTDVLSGLC-TPDEAIR-AT
A0A6N6QEJ2      FAQQGSRVLIVDSDLRRPSLHKIL--NVSNTV-------GLTNFLLRTA-KLEEVVQ-TT
A0A3C1VB86      LAQQGLRTLLVDIDLRRPMIEKFFLGKTSRLP-------GVTDYFLGRK-KFDELCQPHQ
A0A146G2Q9      FASGGYSTLIVDADLRRPSQHRIF--GVENEV-------GLTDFLTTDV-HLEEVVN-QT
A0A2T6D3Y2      FASGGYSTLIVDADLRRPSQHRIF--GVENEV-------GLTDFLTTDV-HLEEVVN-QT
A0A6N6P5E3      FARGGYRTLIVDADLRRPSQHRFF--GIENEK-------GLTDFLTQNI-PFEPLVH-ST
A0A2D5VY59      FAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLGQK-SVEEVIQ-TT
A0A2D8UZZ4      FAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLGQK-SVEEVIQ-TT
A0A353DV86      FAQNDSRVLIIDSDLRRPSLHKLV--GVSNAV-------GLTDFLLGQK-SVEEVIQ-TT
A0A2E5EPT8      FAQNGNRVLLVDSDLRRPSLHKRL--DIENSP-------GLTDYLLGQG-KLEDVIQ-KT
A0A6J4HTK1      SAQGGYSTLIVDADLRRPVQHSIF--DLSNKV-------GLTNYLTTDM-RLEDVIV-PT
A0A6N6PHJ5      FAQSGQRVVIVDSDLRRPTLHKLL--KVTNNL-------GLTNYLLKQN-TLDEVIQ-TT
A0A6M1RXR2      FAQSNQRVLIVDSDLRRPALHKRL--KVSNAI-------GLTNYLLRQN-KLEEVIQ-TT
A0A7C3DXS4      FAQSNQRVLIVDSDLRRPAIHKRL--KVSNAI-------GLTNYLLRQN-KLEEVIQ-TT
A0A2V2SDV4      FAQGGQRVLIVDSDLRRPTLHKML--RVSNHI-------GLTNYLLKQN-TVEEVIQ-TT
A0A2V5PK75      FAQSRQRVLIVDSDLRRPTLHKML--RVPNDL-------GLTNYLLKQN-SLEDVIR-TT
A0A1V6DME1      FAQGNQRVIIVDSDLRRPTLHKRF--GVSNSI-------GLTNYLLKQN-KLEEVIQ-TS
A0A3D3DIJ3      FAQSGQRTIIVDSDLRRPTLHKML--RVTNAI-------GLTNYLLRQN-TLEEVIQ-TT
A0A6I1K583      FAQNGNKVLLVDSDLRRPSLHKRL--GLSNSL-------GLTNYLLGQN-KLEEVIQ-TT
A0A350EWA4      FAQNGARVLIVDSDLRRPSIHKIL--RVSNSV-------GLTNYLLGQQ-PIEEVVQ-TS
A0A5B5WZ91      CAQGGYATLMIDGDLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEDVIF-QT
A0A2N8HD92      CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A2N8HIT2      CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A354EBD3      CAQGGYATLMIDADLRRSKLHRYY--ELDNEL-------GLTSYLLEDY-PLEEVIF-QT
A0A355VEB2      CAQGGYATLMIDADLRRSKLHRYY--ELDNEL-------GLTSYLLEDY-PLEEVIF-QT
A0A2N8IMT3      CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
R6K1U5          CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A2N8IWC2      CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A2N8I441      CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A2N8I3A6      CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A410SCC4      CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A3R5VEW0      CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A411SSG2      CAQGGYATLMIDADLRRSKLHRYY--ELDNEA-------GLTSYLLEDY-PLEEVIF-QT
B2UKW3          CAQGGYATLMIDADLRRSKLHRYY--ELDNEV-------GLTSYLLEDY-PLEEVIF-QT
A0A7C3HWX0      FAQQGQRVLVVDSDLRRPSLHKFL--KVSNSL-------GLTNYLLKQA-TLEEVIQ-TT
A0A7C4KPD7      FAQNGNRVLLVDSDLRRPSLHKRL--GVSNSI-------GLTNFLLKQN-SLAEVIQ-TT
A0A1M6RLZ4      CAQGGYSTLMIDADLRRPKLHTFF--DINNTV-------GLTNYLTTDL-MLEDVIL-QT
A0A354T7G8      CAQGGYNVLLIDADLRRPSLHHHF--DVSHAT-------GLTNYLTTDI-SLEDVVI-RT
A0A2S7U4L6      CAQGGYSTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTTL-PLEDVVL-QT
A0A512MBZ2      CAQGGYSVLLIDADLRRPSLHRLF--DVSNAN-------GLTNYLTMNI-RLEDVVV-RT
A0A2E8MEZ0      CSQGGYTTLMVDADLRRPRLHSFF--DINNSV-------GLTNYLTTDL-ALEDVIL-QT
A0A6B3LBV6      CAQGGYNTLIIDGDLRRPTLHGHF--DTSNSV-------GLTNYLTTNM-PLEEVIL-QT
A0A2E3EC33      CAQGGYNTLMIDADLRRPQLHTFF--NXNNSV-------GLTNYLTTDL-ALEDVIL-QT
A0A2E4GN01      CAQGGYNTLMIDGDXRRPQLHTFF--NINNSV-------GLTNYLTTDX-ALEDVIL-QT
A0A1Z8XU55      CAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTTDL-QLEDVIL-QT
A0A2E1RQR9      CAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTTDL-QLEDVIL-QT
A0A2E3ISQ4      CAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTTDL-KLEDVIL-QT
A0A2D6W6F4      CAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTTDL-XLEDVIL-QT
A0A2D8Z5A8      CAQGGYNTLMIDGDLRRPQLHTFF--NINNSV-------GLTNYLTTDL-KLEDVIL-QT
A0A4Q2YKS3      CAQGGYTTLMIDGDLRRPRLHTFF--DINNAV-------GLTNYLTTEL-ALEDVIL-QT
A0A6N6P3T8      CAQGGYTTLMIDADLRRPRLHTFF--DINNSV-------GLTNYLTTEL-MLEDVIL-QT
                        :.:* * *                       *                    

A0A2A2XVF1      EI------E----NLALLPAGRRA-PNPAELLSSADIPKLFA-QLLKRYDRIVIDSAPVN
A0A2V5UHJ2      SA------E----NLSFISAGALP-PNPAELLGSKKMHDLLE-QLREQFEFIFVDSSPLM
A0A2V5PST3      SI------A----GLSVLTRGACP-PNPTELLRMRKMKEILT-GLGGSFDFILIDSSPAI
A0A2V5PXM3      GS------E----NFFYIPAGSHA-PNPAELLARTGIDGLID-EALLHFERVIIDSAPVH
A0A1V5QB01      GL------P----NLDLVATGPFP-PNPAELVLRPEFKAFMD-HARRQYDRILFDCPPVM
A0A7C5LI63      NI------P----KLDVITSGAYP-ANPAEMLLSWRLKELMD-WARQHYDRIIVDSPPIM
A0A7C5P291      DV------P----KLDVITVGSYP-ANPAELLLGWRLKELLD-WARPRYSRVILDCPPVM
A0A139SU05      TLGIVKLSE----NLSLLRSGGRS-RRPTELLESPFFGDLLQ-KLGHYYDLIIIDSPPLG
A0A139SPN4      TLGIVKLNE----NLSLLRSGGRS-RRPTELLESDLFGDLLK-KLGRYYDLIVIDSPPLG
A0A1V6E7N1      DLGIISLGE----NLSLLCSGGRS-KTPSSLLETPAFTQLLE-RLKQQYELVVVDSPPLG
A0A2D9MYT1      EV------A----NLDIICCGAVP-NNPSELAGSQRMIDFVE-EVRXKYEKIVFDCPPVS
A0A258ANJ7      GI------A----HLAIMPAGKRV-ANPAELLSTCGVERLKEMAFSAGFDRIVIDTAPLI
A0A290QGD9      PH------P----NLDIIPAGGRA-KNPTHVLNSAGFEHMIA-DLRTRYDRVFIDTPPIA
A0A1D8AS58      VH------P----NLDVIPAGGRA-KNPTQILNSRNFEHLLA-DLRKRYDRVFIDTPPLA
I6AQC1          VH------P----NLDVIATGGRA-KNPTQILNSKNFEIMIA-ELRKRYDRIFIDTPPLA
W0ITH7          VH------P----NLDVIATGGRA-KNPTQILNSKNFEIMIA-ELRKRYDRIFIDTPPLA
A0A139TLN4      VS------D----HLDYLFAGTLP-DHPSRLLLHDRVRELMK-ELKEHYDFIFMDCVPYA
A0A1G3ZFT0      SH------H----NLTILPRGNYP-VDPAELLSSERCKELIS-LFSKQFDIILIDTAPVL
A0A1Z8ZMT6      GL------D----TLSVIYSGPKS-PNPGELLEPGRLRALIG-MFAANFDHIVIDSAPLL
A0A2E8MCT7      GL------D----TLSVIYSGPKS-PNPGELLEPGRLRDLVE-MFSSNFDHIVIDSAPLL
A0A290Q2Z2      VS------P----GLDFIPCGAVG-GFTLSLLYIDRLKALLA-ELRGRYDRVIFDAPPII
A0A2A2RGK2      HI------D----NLQIMTAGGRA-PNPSELLTYENIDRVLK-EALSKYDRVVVDSAPLL
A0A2A2XXF7      HI------D----GLSILTAGGRA-PNPSELLTYENLERVMS-EALSKYDRIVVDSAPLL
A0A2A2R5D6      SV------P----NMHVITAGDMP-ASEMGAFSGLKLREILN-DLKLRYDIVLLDAPPVL
A0A1J4XH17      VY------S----NFDVITAGGKA-TNPTQIFLSPRFQQLLE-EAKSRYSKIIIDTPPLG
A0A3C1VJ32      SV------P----NLDFMASGKLP-SSSMGILGSAQMKELIA-ELKQRYDFIFFDSPPIL
A0A2N9NTX7      NL------P----SMDFLASGKLP-SSSLGILSSSQMRDLIN-ELKQRYDFVFFDSPPIM
B9XK55          RL------P----NLDFMASGKLP-SSSLGILSSAQMKDLIT-ELKQRYDYVFFDSPPIM
A0A4P5YMI6      PI------P----NLHFLPSGRLQ-SSSLGILNSPQMREFID-EMKRRYDFVFFDSPPIM
A0A2E6T482      QI------P----SLHFIPSGKLP-SSSMGILSSSKMREFVS-EMKSRYDYVFLDAPPIM
A0A3C0DQZ7      QI------P----SLHFIPSGKLP-SSSMGILSSSKMREFVS-EMKSRYDYVFLDAPPIM
A0A1Z9CBK5      DS------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAPPIM
A0A2D6ZI96      DS------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAPPIM
A0A358KGZ3      ES------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAPPIM
A0A2E9ZQX4      ES------P----NLHFIPSGKLP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAPPIM
A0A3D5JZU0      ES------T----NLHFIPSGKLP-SSSMGVLNSAKMKQFVA-EMKSRYDYVFFDAPPIM
A0A2E6HCR0      DI------P----NMHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKSRYDYVFFDAPPIM
A0A1Z8WN04      DI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAPPIM
A0A2D7L1N4      DI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAPPIM
A0A2E2R937      DI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAPPIM
A0A520QQY4      DI------P----NLHFIPSGKLP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAPPIM
A0A2D5MR66      DI------P----NLHFIPSGKLP-SSSMGVLSSSKMKGFVA-DMKSRYDYVFFDAPPIM
A0A2E0PDQ1      DI------P----NLHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKGRYDYVFFDAPPIM
A0A2E2ZZP9      DI------P----NLHFIPSGKLP-SSSMGVLSSSKMKDFVA-DMKGRYDYVFFDAPPIM
A0A7C4LRK7      SI------P----TLDFMPSGKLP-SSALGILNSAAMRDMIT-ELKNRYEYVFFDSPPIM
A0A2A2RGF2      TL------A----NLHFLPSGRLP-SSALGILNSPQMKDFIK-EAKQRYDFVFFDAPPIM
A0A2G4I5Y6      PL------A----NLHFLPSGRLP-SSALGILNSPQMKDFIK-EAKRRYDFVFFDAPPIM
A0A6N6PS97      PV------P----TLDFLPSGKLP-SSSLGVLSSAQMREFIA-IAKERYDFVFFDSPPIM
A0A3M1I883      SL------P----TLDFLPSGKLP-SSALGIINSPRMKELVD-EVRNRYDFVFFDSPPIM
A0A1V6JZ45      KL------P----MMDFLASGKLP-SSSLGILNSTRMKEFIK-DVQRRYDFVFFDSPPIM
A0A7C7Z746      IN------P----FMDFMPSGKLP-SSSMGILNSPQMKELIK-SVKARYDFVLFDSPPIM
A0A520RRW5      KH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSPPIM
A0A356NPK0      KH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSPPIM
A0A2D7B5P5      KH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSPPIM
A0A3D3XGB5      KH------E----NLDFLPSGKLP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSPPIM
A0A2V6F8A1      SI------P----TLDFLPSGKLP-SSSLGILNSVQMKDFIK-EAKKRYDFVFFDSPPIM
A0A2V5TNH4      SI------P----TLDFLPSGKLP-SSSLGILNSAQMKDFIK-EAKRRYDFVFFDSPPIM
A0A2V5X5Q6      SI------P----TLDFLPSGKLP-SSSLGILNSTQMKDFIK-EAKRRYDFVFFDSPPIM
A0A4P5QM05      RL------E----NLAIIPSGSLA-MEDVGILNGPRMTELIL-QLKKRYDVVFFDSPPIL
A0A4Q3C001      KI------D----NLSFIPSGQLP-SDAIGILNSQRMTDMMQ-KVKHQYDLVFFDSPPIL
B4DB23          KI------D----NLSFIPSGLLP-GDSVGILNSQRMTDLIA-KVKSQYDLVFFDSPPIL
A0A6B3L938      GT------E----NLYVMVSGKKA-PSPSELLLPEDIQSLFD-HAAEHFDRVIVDTPPVL
A0A2V5URB2      SI------P----NLWILNGGSVP-PSPTELIGSKKMQDTLA-LLKESYDFIFIDSPPIM
A0A2V2DJ66      YF------Q----NLDVLVCERRA-KNPSQMLNSEEFVSMIE-SFREKYDKVFIDSPPIG
R7L5A9          YF------P----NLDVLVCEKRA-KNPTQTLNSEEFAAMIE-KFRDTYDRIFIDSPPIG
A0A5R8KA81      NT------E----NLFILSAGTEI-RNPAELLASPALAEFFD-SLKGKFDRVVLDTAPIH
A0A5B5WU87      VS------D----HLDYLFAGTLP-DHPSRLLLHDRVRVLME-ELKEHYDFIFMDCVPYA
R7DZW0          VS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCVPYS
A0A2N8HID1      VS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCVPYS
A0A2N8HS06      VS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCVPYS
A0A6N2TNT9      VS------D----HLDYLFAGTVP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCVPYS
A0A3R5R2M8      RI------EETGISFDFLGAGPAV-PNPVSLLSQPILGQMLE-HLKKQYDTVIIDAPPYG
A0A411SUQ6      PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKKQYDAVIIDAPPYG
A0A2N8HZF2      PL------GGNSRGMDILYTGPMV-PNPVILLSHPLLGHILG-ILKKQYDAVIIDAPPYG
A0A354E720      PV------GEDTRGMDVLYTGPTV-PNPVTLLSHPLLGQILS-ILKKQYDAVIIDAPPYG
B2UPB6          PL------GENSRGMDILYTGPMV-PNPVTLLSHPLLGHILG-ILKKQYDAVIIDAPPYG
A0A2V6JLK8      NV------E----NLSILPSGILP-SDAVGILNSQRMSDTIA-QLKMRYDIVFFDSPPIL
A0A2W5Z1A5      SV------E----NLSLLPSGVIP-SDAVGILNSQKMSDLIA-ELKTRYDIIFFDSPPML
A0A2V6EA09      AV------E----NLSILPSGVLP-ADAVGILNSQRMSDTIA-ELKSRYDLIFFDSPPML
A0A2V6GQI7      AV------E----NLSILPSGVLP-ADAVGILNSQRMSDTIA-ELKSRYDLIFFDSPPML
A0A3C1HEJ2      QT------E----NFCFIGAGTKS-PNPSELLAQPGFKQLLT-EALSHFDQVVIDSAPVH
A0A522ULD9      AI------P----NLHFLPSGKLP-KTSIGLLDSQRMRELVK-DLKARYDYVFFDSPPII
A0A1V6JU76      EV------T----NLDVACCGQIR-SQPSELLGSQRMVQFMQ-ELSKRYDRVILDCPPVS
A0A2A2XXW5      EV------P----NLDVICCGAVP-PNPSELIGSNRMVRFLE-EASRRYDRVILDCPPVS
A0A6N6Q6V0      DV------P----NLDIVCAGAAP-SNPSELISSKRMHQFLE-EVSSRYDRVILDCPPVS
A0A1Q6UHJ9      YY------P----NLDVLPCEKRS-QNPTQALSSEEFISMIA-KFREQYDKVFIDSPPVG
A0A2V2BXR0      YY------P----NLDVLPCEKRS-QNPTQALSSEEFISMIA-KFREQYDKVFIDSPPVG
A0A2D8V0G3      EV------P----NLDLICCGAVP-NNPSELVGSKRMGELLD-SLRDRYDRIFVDCPPVS
A0A348S017      EV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVS
A0A3C1UUV7      EV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVS
A0A350I3V2      EV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVS
A0A520RGV5      EV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVS
A0A3D3XF90      EV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVS
A0A2D7B522      EV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVS
A0A356NIC2      EV------P----NLDIICCGAVP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVS
A0A2N8HDG3      EH------A----GVDILYAGPHV-PNPVTLLSLPELGTLIQ-MFKERYDAVIIDSPPYG
A0A146GCJ0      DQ------D----NLFLLPAGHRA-PNPSELLGGSEFREMLA-KLLLTYDRVVVDSAPVN
A0A2T6D6H8      PY------E----NLFLLPGGHRA-PNPAELLNEDDFQKMLD-ELLKSYDRIVVDTAPVN
A0A3D1TI55      SV------P----NLHFLPSGKLP-RTSVGILNSQRMRELIK-TLKSRYDYIFFDSPPIV
A0A3E1ET42      PI------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKNRFDLVLIDSPPIL
A0A2A2YDW8      PV------E----NLFFMPSGILP-ADAAGILNSRRMSELIA-DVKQRFDLVLVDSPPIL
A0A352XLN9      PV------E----NLFFMPSGILP-ADAAGILNSRRMSELIA-DVKQRFDLVLVDSPPIL
A0A3D0YP62      PV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A3D3DV47      PV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A2E5XJ49      PV------D----NLYFLPSGILP-ADAAGILNSRRMSELIE-DVKQRFDLVLVDSPPIL
A0A2E6SBY8      PV------D----NLYFLPSGILP-ADAAGILNSRRMSELIE-DVKQRFDLILVDSPPIL
A0A2E5QMS4      PV------D----NLYFLPSGILP-ADAAGILNSRRMSELVQ-DVKQRFDLILVDSPPIL
A0A2E7YXQ3      PV------D----NLYFLPSGILP-ADAAGILNSRRMSELVQ-DVKQRFDLILVDSPPIL
A0A2E3H787      PV------D----NLYXLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A2E7AGN1      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A2E7AKY7      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A3D4CU34      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A2E8M146      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A355S8S2      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A2D6DVN8      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A3C1W2R2      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A2E3NAY6      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A2E3II01      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A368B8C5      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A3R7RBB5      PV------D----NLYFLPSGILP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A2A2QX62      PV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A4Q3BWH6      PV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A3N5WCF1      PV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A4Q3C1K5      PV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A3R8IT45      VA------P----NLDVIATGGRA-KSPTQILNSKNFEIMIA-ELRKRYDRIFIDTPPLA
A0A2A2PYE8      VH------P----NLDVIPAGGRA-KNPTQILNSKGFELMIS-DLRKQYDRVFIDTPPLA
A0A2T6CN73      QQ------P----NLDVLPTGGRA-KNPTHILNSKAFETMIA-DLRKRYDRVFIDTPPLA
A0A2G4G428      VA------P----NLDVLPVGMSC-RNPTQVISSAKFIEMLT-DMRSRYDRIFIDSPPIG
A0A6N6PCD8      KV------P----NLTFMPAGNRN-TSPLELLADERFAKLIR-EAREKFDRVILDSAPIN
A0A139TV24      DH------P----GVDILYGGPHV-PNPVSLLSRPEIEQLIQ-SFKRSYDAVIIDAPPYG
A0A2N8HT11      EH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSPPYG
R7DS70          EH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSPPYG
A0A2N8HNL6      EH------P----GVDILYAGPQV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSPPYG
A0A6N6PAZ1      GQ------P----NLHLILGGKTA-PNPGELLETGRLHQLLE-QACKDYDVVVLDTAPIL
A0A6I1K459      RF------E----NLFLLTAGRTV-PNPAELLSGQWARQLIR-EAAGKFDHVVLDNAPVN
A0A139TUL1      NF------P----GFDMVPAGPVP-PNPAALLTQGRFEDLIR-YWRTRYDRIIVDGCPYE
A0A2N8HCB0      KF------P----GFDLVTAGPVP-PNPVALLTQDRFEELLR-YWRARYDRIILDGCPYE
A0A2N8HP04      RF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRARYDRIILDGCPYE
A0A2N8HRJ0      RF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRARYDRIILDGCPYE
A0A6N2U9Y7      RF------P----GFDLVTAGPVP-PNPVALLTQGRLEELLR-YWRARYDRIILDGCPYE
A0A366HAG0      QV------D----HLYFMPSGVMP-ADSAGLLNSQKFVDLLT-DVKSRFDLVLIDSPPII
A0A2U8DZK4      IA------P----GLDFIPSGTIS-GFTLSLFYADRLKEILA-DLRTQYDRIVFDAPPII
A0A2T6DFL8      IS------P----GLDFIASGAAG-NFTLSLIYANRLRELMT-TLRGRYDRIVFDSPPII
A0A1D8AWD4      KS------G----LIDFIPAGAAANNVTLGLLYATKLKALVE-EFRGRYDKVLFDSPPII
A0A4Q1C9S2      KS------G----LIDFIPAGALANNITLGLLYANKLRELVA-HCRSRYDKVLFDSPPII
A0A178IH18      IA------P----NLDFIPCGSVG-GFTLSLLYADRLKALLA-GLGKSYDRIMFDAPPII
A0A2T6DT99      IQ------P----NFDFIPCGSVG-SFSLTLLYVDRLKALIQ-ELRGQYDRIVFDAPPII
A0A1G3ZT33      VV------P----GLDFIASGTPG-GFTLSLLYANRLRELIA-QCKGRYGRIVFDSPPVI
A0A3E1E2T2      LA------P----NLDFIPSGHAP-GFTLGLLHLNRLKDLIA-TLSGRYDKIVFDSPPII
B1ZMW1          LA------P----NLDFIPSGGVP-GFTLGLLQVNRLKELIA-TLRGRYDKILFDSPPII
A0A3M1I8A3      EV------P----NLDMISCAGGS-SQSTELVASRRMVQFLD-EARKRYDRVILDTPPVS
A0A4V0XS84      KV------P----NLDVVCCGSIP-MIPSELIGSKRMEKFLL-DMRERYDRVVFDCPPVA
A0A351WE84      IV------P----NLSFLPSGRLP-RSMMGIIDSQRMRELVK-DLKSRYDYVFFDSPPII
D5ENH7          VY------P----NLDVIPTGGKS-KNPTQVLVSAPFEAMLA-DLRDRYDRIVIDSPPLA
A0A0R2XQ77      VY------P----NLDVLPSGGKS-KNPTQVLNSARFEAMIA-DLRDRYDRIVIDSPPLA
A0A2E9IN28      VY------P----NLDVLPTGGKS-KNPTQVLNSARFEAMFA-DLRDRYDRIVVDSPPLA
A0A6N4WTJ5      VY------P----NLDVLPTGGKS-KNPTQVLNSSKFEAMLA-DLRDRYDRIVIDSPPLA
A0A1V5QDZ6      SV------P----NLHFLPSGKLP-RTSLGLLDSQRMRELVK-NLKARYDYVFFDSPPIM
A0A4Y8P964      AI------P----NVWAIGGGRAA-IHPADLLGSESMQYLTQ-LVRQYFGYVLIDTPPMH
A0A3D4HF88      VY------P----NLDVMGSGGHS-QKSTQILNDKRFIALLE-DLRGSYDRVFIDSPPVA
A0A6N6ZHN8      YM------P----GLDVLVSGGRS-KSPTQALSSQRFENLMH-ELRMRYDKVIIDCPPLA
A0A351MR11      FE------P----NLDILPVGGIC-KNPTQVINSPRFDELIR-ELRTRYDRIFIDSPPLG
A0A6G6K641      PV------A----DLDVLPAGSRS-PNPSELLSGKSLPRLIR-DLLERYDKVVIDSAPIM
A0A5B5WI95      QA------GENNTPFDFLGTGPAA-PNPVTLLSQPLLAQILE-CFRKKYDAVIIDTPPYG
A0A2N8I9W1      PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYG
A0A4Q5IH27      PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYG
A0A2N8IBZ6      PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYG
A0A2N8IJW9      PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYG
R6J100          PL------RENSRGMDILYTGPMV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYG
A0A1V6J089      GV------P----NLWMLTSGRLR-RGTIGIMNNTRLRNLLD-HLKEQYDYILLDSPPIL
A0A3C1BZR1      GV------P----NLWMMTSGRLR-RGSLGIMNNARLRALMD-SLKEKYDFVLLDSPPIL
A0A7C4KLL2      KV------K----NLHWLPAGKPA-PNPAELLAQPSFKEIIQ-TALQHYDRVVLDTAPIH
A0A1H6KPB7      HV------D----NLYILPAGPTP-SDASGVLNSYRMRELLD-EVRRRFDIVLIDSPPVL
A0A2E9ISN4      KH------E----PISILPAGVFD-DSLPEKVNAARLRGLVH-SLQQDYDVIIIDTAPVS
B9XAX1          PY------P----NLYILTAGPKV-ANPAEELGGDAIKQLLL-EASNQFDRIVIDTPPIN
A0A5R8KKM9      PI------E----NLFLMPSGLMP-ADSSGMLNSPRFRQLLD-DVKSRFDIVLIDSPPIL
A0A139TS01      PV------E----NLYVMPAGPVP-FDPSGALNSRKFSELLQ-EVKQRFDIVLVDSPPIL
A0A3E1EJT7      VH------P----YLDIISTGGRA-KNPIQLFNSKEFETLVV-ELSKRYDRVLFDTPPLG
A0A317ZP96      VY------P----NLDVLPSGGKS-KNPTQILNSASFESMLA-ELRDRYDRIIIDTPPLA
A0A7C3I5X9      EV------P----HLDVVCCGSTP-SQPSELLSSRRMTEFIQ-EAGRQYDRVVIDCPPVS
A0A2D5WGA5      EL------P----SLHFIPSGKLP-SSSMGILSSAKMKEFVT-EMKSRYDYVFLDAPPIM
A0A2E7SSH2      DS------P----NLHFIPSGKLP-SSSMGVLNSSKMKEFVA-EMKSRYDYVFFDAPPIM
A0A349GXM8      RI------E----NLFVAPSGGDI-DDSAELLQTVDVRGFFV-DVQDDYDYIFVDTSPVL
A0A4P5YP61      GI------E----NFSFIPAGTTA-PNPAELLGQHGIDGLVA-EALLNYDRVVIDSAPVH
A0A6B2LYM4      FL------P----NLDLLPAGGNT-KKPTQILGSEEFANLIH-ELRLRYDRVIIDTPPIA
A0A6D1VXB3      TI------P----NVWAISGGRAA-IHPTDLLGSESMHSLIQ-LVRQYFCYILIDTPPMH
I0JYY7          TI------P----NVWAISGGRAA-IHPTDLLGSESMHSLIQ-LVRQYFCYILIDTPPMH
A0A4R7S1J2      PI------PAHSGTFRVIPAGFRS-PNPAELLASNAFPQLLE-LALKHFDRVVIDTAPIV
A0A2A2XV69      KV------E----NLFFMPSGLLP-RDAVGILNSQRMMEVIQ-ETKSRFDIVFFDSPPIL
A0A651H7X9      PH------E----NLDVILTGGRA-KQPSQILNSADFERFIA-EARQRYQRIIIDTPPLA
A0A4Y8P842      SL------P----NVWAIVGGRAA-IHPADLLGAESFGQLCR-YLREYFAYILIDTPPMR
B3DZK9          SL------P----NVWAIVGGRAA-LHPADLLGAESFSQLCR-SLREYFTYILIDTPPMR
A0A5E6MPC4      AL------P----NVWAIGAGRTP-CHPADLLGAAAMAYLCQ-WARGHFTYVILDCPPLV
A0A6N6PKP9      GI------K----NLSVMPAGKRV-PNLAELFGRSELPAFLQ-CVAGGYDRVVIDSAPVL
A0A6N6Z250      EI------P----GLDVITAGDGP-LHSLTLLHRAALEQLLT-QLRGRYDRILLDSPPIL
A0A4V1SB02      AV------Q----HLSLMPSGRRA-PNPAELLAQGGVEKLIQ-QLLAKYDRIVFDSAPVN
A0A6N6QEJ2      PQ------P----GLDFLPSGKLP-SSSVGILNSVQMKEFIE-EVKNRYDFVFFDSPPIM
A0A3C1VB86      DV------P----KLSWMAAGSSV-PNPSELLMSADFQKLLS-EGLAHYDRIVIDTAPIL
A0A146G2Q9      KI------D----NLFLMTSGRLP-ADAVGILNSQRMVDLIE-EVKHRFDIVFFDSPPIL
A0A2T6D3Y2      KI------D----NLFLMTSGRLP-ADAVGILNSQRMVDLIE-EVKHRFDIVFFDSPPIL
A0A6N6P5E3      EV------E----NLFFMPSGRLP-IDAVGILNSQRMVDLVA-STKAAYDIVFFDSPPIL
A0A2D5VY59      KL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSPPIM
A0A2D8UZZ4      KL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSPPIM
A0A353DV86      KL------D----NLHFLPSGKLP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSPPIM
A0A2E5EPT8      DQ------A----DLDLLPSGKLP-SSAMGILNSQQMRDFVK-EVQSRYDFILLDSPPLM
A0A6J4HTK1      TV------E----NLSLLPSGILP-SDSVGILNSQRMSDMIA-ELKTRYDIIFFDSPPML
A0A6N6PHJ5      SV------P----TLDFLASGKLP-SSSLGILSSSAMKDLIG-ELKARYDIVFFDSPPIM
A0A6M1RXR2      QL------P----TLDFMPSGKLP-SSSLGILSSQAMRELIQ-ELKQRYDFVFFDSPPIM
A0A7C3DXS4      QL------P----TLDFMPSGKLP-SSSLGILSSAAMRDLIN-ELKQRYDFVFFDSPPIM
A0A2V2SDV4      SL------P----TLDFMASGKLP-SSSLGILNSPQMKELIG-QLKQHYDFVFFDSPPVM
A0A2V5PK75      PL------P----TLDFLASGKLP-SSSLGILSSAQMKELIN-ELKQRYDFVFFDSPPIM
A0A1V6DME1      PL------A----TLDFLPSGKLP-SSSLGILNSAQMKDLIA-QLKQRYDFVFFDSPPIM
A0A3D3DIJ3      SL------P----TLDFLSSGKLP-SSSLGILSSTQMKDLIG-ELKQRYDFVFFDSPPIM
A0A6I1K583      SL------P----NLNFLPSGRLP-SSALGILNSPQMKEFIK-EAKRRYDFVFFDAPPIM
A0A350EWA4      SL------P----SLDVMPSGKLP-SSSMGILSSVRMKQLVK-ELKSRYDFVFFDSPPIM
A0A5B5WZ91      PV------E----NLYVMPAGPIP-FDPSGALNSRKFSELLQ-EVKQRFDIVLVDSPPIL
A0A2N8HD92      PI------E----NLYVMPAGPTP-FDPSGTLNSRKFSELLQ-EVKQRFDMVLVDSPPIL
A0A2N8HIT2      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A354EBD3      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A355VEB2      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A2N8IMT3      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
R6K1U5          PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A2N8IWC2      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A2N8I441      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A2N8I3A6      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A410SCC4      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A3R5VEW0      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A411SSG2      PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
B2UKW3          PI------E----NLYVMPAGPTP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPIL
A0A7C3HWX0      KN------P----LLDFLPSGKLP-SSSLGILNSQRMKDFIQ-DVKKRYDFVFFDSPPIM
A0A7C4KPD7      SL------P----TLDFMPSGKLP-SSAMGILNSPSMKEMIS-ELKRRYDFVFFDSPPIM
A0A1M6RLZ4      PI------D----NLFFMPSGILP-ADAAGILNSRRMSDLVQ-DVKQRFDLVLIDSPPIL
A0A354T7G8      QV------E----NLFFLPSGLLP-ADSAGLLNSQRMVDLIA-DVKSRFDLVLIDSPPIL
A0A2S7U4L6      SI------E----NLYFMPSGILP-ADASGILNSRRMSELIQ-EVKSRFDLVLVDSPPIL
A0A512MBZ2      PI------D----NLYFLPSGLLP-ADSAGILNSQRMSELIA-DVKSRFDLVLIDSPPIL
A0A2E8MEZ0      PV------D----NLYFLPSGILP-ADAAGILNSRRMSELLQ-DVKQRFDLVLVDSPPIL
A0A6B3LBV6      PI------E----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKSRFDLVLVDSPPIL
A0A2E3EC33      AY------E----NLYFMPSGILP-SDAAGILNSRRMSELIA-DVKSRFDLVLVDSPPIL
A0A2E4GN01      AY------E----NLYFMPSGILP-SDAAGILNSRRMSELXA-DVKSRFDLVLVDSPPIL
A0A1Z8XU55      AY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSPPIL
A0A2E1RQR9      AY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSPPIL
A0A2E3ISQ4      AY------E----NLYFMPSGILP-ADAAGILNSKRMSELIA-DVKSRFDLVFIDSPPIL
A0A2D6W6F4      AY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-XVKSRFDLVFIDSPPIL
A0A2D8Z5A8      AY------E----NLYFMPSGILP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSPPIL
A0A4Q2YKS3      PV------D----NLYFMPSGILP-SDAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPIL
A0A6N6P3T8      PV------D----NLYFMPSGILP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPIL
                              .                                 :  :..*  *  

A0A2A2XVF1      AVSDTLILAPH-ADKTILVIHAGKTPRKAIQRSVHLLR-KAQA--KVAGFVLNR-LPTGR
A0A2V5UHJ2      AVSDAVFLSTM-VDGTLLVIN-RRTPKPLLRKARARLT-TPHS--KILGMLLNR-INIH-
A0A2V5PST3      AVSDPVILSNV-ADGVILVFHAQKTTAASARKTKERFD-AIRA--PILGVILNG-INL--
A0A2V5PXM3      AVSDTLLILDR-VQTLCLVVRSRKTPRNSVLRAVQMLN-EAGA--PLAGVILNL-IPRSG
A0A1V5QB01      AVSEAAILTSL-AEGVVMVVWAGHTSRKLVQLAAKLIQ-ERGA--RILGCVLNN-LDFSR
A0A7C5LI63      GIADAAILGAA-CDGSLFVIWAGRTSRRYVRVAKMTAV-SRGA--KLFGFILNN-LEPG-
A0A7C5P291      GIADSAILGAA-VDGVLFVIWAGRTSRRYVRVAKTTAV-SRGA--KIFGFVLNN-LEPG-
A0A139SU05      AVTDGLLIAER-VDEVAYVCRFNRAHRKHIQLYMRALR-NAKT--EVLGVVLNGLTPRRV
A0A139SPN4      AVTDGLLIAER-VDEVAYVCRFNRAHRKHIQLYMRALR-NAKT--EILGVILNGLAPRRV
A0A1V6E7N1      AVTDSLLLAER-TDEIVYVCRFNKALRKHIQLYTKLLL-SGKN--EVLGIVLNGLSPRRI
A0A2D9MYT1      AVSDPLIIAAN-TDGTVFVNKFNKIRREHARKTVQRVQ-DAGI--NIVGVCIND-LDFEG
A0A258ANJ7      PVNDTLELGTL-ADSTFLVVRCNRTPADIILEAIRKLH-QTGI--PITGLVLNR-LTQRT
A0A290QGD9      AVSDALIILPL-VDGSIFTVFFNKVRRRAAQYAARRLI-DSHV--PNFGAVLNG-LNMNV
A0A1D8AS58      AVSDALIILPL-VDGSIFTIFFNRVRRKAAQFSARKLL-EANV--PCFGAVLNG-LNLAV
I6AQC1          AVSDALIILPL-VSGSIFTIFFNKVRRKAAQHAARKLL-ESNV--PVYGAVLNG-LNLAV
W0ITH7          AVSDALIILPL-VSGSIFTIFFNKVRRKAAQHAARKLL-ESNV--PVYGAVLNG-LNLAV
A0A139TLN4      SLADARIAARL-ADATLYVMRAGCVKKRDLSSLQKTWK-SGEL--KRMGIVLCD-VENRS
A0A1G3ZFT0      LVTDAVLISAT-SATNYLVLGSNVHQASHLEMAIKRLS-SAGV--TVHGSIFN--FHNAT
A0A1Z8ZMT6      PVPDTRILAPL-VDNLALVIRADHTPVKSIQGALEMLK-DDGV--SSSGVILND-FTENR
A0A2E8MCT7      PVPDTRILAPL-VDNLALVIRAEHTPVKSIQRAFDMLE-DDGV--FSSGVILND-FTENR
A0A290Q2Z2      GVSDASVLASV-ADDVLLLVQHRRNPHSMVVRAQQIIE-GLHK--QIVGVVLNR-VPVN-
A0A2A2RGK2      AVSDTLLIAPH-IDLCTLVVRAFTTPKKMVMRAIKSLE-ETKT--TPAGLILNF-LPSG-
A0A2A2XXF7      AVSDTLLVAPH-VDLCTLVVRAFGTPRKMVARAIKSLE-ETKT--HPAGLILNF-LPSG-
A0A2A2R5D6      GISDGAVLAHE-VDFTLLVIQHRRYPRDISMRAKRAVE-EVKG--NLLGVVLNA-VAVK-
A0A1J4XH17      VVSDIMNILPY-TDGLIFVVKFNSVKRKTAKAHLSRLL-ESNV--PVFGAVINQ-ISLDI
A0A3C1VJ32      GVSDASILASE-VDLVMQVIQYRRYPQPMTIRAKQMIE-KVGG--NFVGMVLNN-INMS-
A0A2N9NTX7      GVSDASILASE-VDMTLQVIQYRRYPQPMNIRAKQLIE-KVGG--NLIGIVLNN-INMS-
B9XK55          GVSDASILASE-VDMTLQVIQYRRYPQPMNIRAKQLIE-KVGG--NLIGIVLNN-INMS-
A0A4P5YMI6      GVSDASILVSQ-MDLAMLVVQFRKYPQAMSVRAKQTIE-KVGG--NLMGAVLNN-INIA-
A0A2E6T482      GVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGG--DLVGVVLNN-INIS-
A0A3C0DQZ7      GVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGG--DLVGVVLNN-INIS-
A0A1Z9CBK5      GVSDASVLASA-VDLCVLVVQYRKYPQXMTQRAKDMVV-KVGG--NLVGVVLNN-INIS-
A0A2D6ZI96      GVSDASVLASA-VDLCVLVVQYRKYPQXMTQRAKDMVV-KVGG--NLVGVVLNN-INIS-
A0A358KGZ3      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--DLVGVVLNN-INIS-
A0A2E9ZQX4      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--XXVGVVLNN-INIS-
A0A3D5JZU0      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--DLVGVVLNN-INIS-
A0A2E6HCR0      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--DLAGVVLNN-INIS-
A0A1Z8WN04      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NLIGVVLNN-INIS-
A0A2D7L1N4      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NLIGVVLNN-INIS-
A0A2E2R937      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NLIGVVLNN-INIS-
A0A520QQY4      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NLIGVVLNN-INIS-
A0A2D5MR66      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKEMVT-KVGG--NLVGVVLNN-INIS-
A0A2E0PDQ1      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVT-KVGG--NLVGVVLNN-INIS-
A0A2E2ZZP9      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVT-KVGG--NLVGVVLNN-INIS-
A0A7C4LRK7      GISDASILASE-VDMTLQVIQYRRYPQPMTIRAKQMIE-KVGG--NLMGIVLNN-INMS-
A0A2A2RGF2      GVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGG--RLIGVVLNN-INLA-
A0A2G4I5Y6      GVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGG--RLIGVVLNN-INLA-
A0A6N6PS97      GVSDASILCSE-VDIALLVIQYRKYPEVMTVRAKQMVD-KVGG--NLIGVVLNN-INIS-
A0A3M1I883      GVSDASILCSM-VDIALLVVQYRKYPQAMTLRAKQMVQ-KVGN--NLLGIVLNN-INIS-
A0A1V6JZ45      GVSDASILASE-VDLSVLVVQYRKYPQAMTLRAKQMVE-KVGG--TMLGVVLNN-INIS-
A0A7C7Z746      GVSDASILASE-VDLAIQVIQYRKYPQAMTIRAKQMVE-KVGG--NLLGVVLNN-INIS-
A0A520RRW5      GVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGG--NLLGVVLNN-INIS-
A0A356NPK0      GVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGG--NLLGVVLNN-INIS-
A0A2D7B5P5      GVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGG--NLLGVVLNN-INIS-
A0A3D3XGB5      GVSDASILASE-VDMAILVIQYRKYPQAMTVRAKQMVE-KVGG--NLLGVVLNN-INIS-
A0A2V6F8A1      GVSDASILASE-VDLALLVIQYRKYPQAMTLRAKQMVE-KVGG--TMLGVVLNN-INIS-
A0A2V5TNH4      GVSDASILASE-VDLSLLVIQYRKYPQAMTIRAKQMVE-KVGG--ALLGVVLNN-INIS-
A0A2V5X5Q6      GVSDASILASE-VDLSVLVIQYRKYPQAMTIRAKQMVE-KVGG--AMLGVVLNN-INIS-
A0A4P5QM05      GVSDASILVSE-VDNTIMVVQYRRFPRNMLQRVKSTVA-HVGG--NLIGVVLNN-VDIH-
A0A4Q3C001      GVSDGSVLASE-VDMTIMVVQHRRFPRAMLQRVKQAVI-QVGG--TLIGVVLNN-VDTR-
B4DB23          GVSDGSVLASE-VDVTIMVVQHRRFPRVMLQRVKQAVL-NVGG--RLIGVVLNN-VDAK-
A0A6B3L938      PVSDTRLIAQH-AQKSILVVRALKTPVGAVLRARDLLQ-DAKI--SLAGVVVNA-LRVKH
A0A2V5URB2      PVSDAVVLSTL-TDGMIFVVRGQNTPKHIVREAISQLG-NNRS--KILGVVLNR-VDVR-
A0A2V2DJ66      AVSDAISLLPE-VDGVLYVIKFNTAKRKVVRRCVRRMM-ESNV--PILGAVMNM-VNTGA
R7L5A9          AVSDAITLLPT-VDGVIYVVKFNTVKRKTIRAYIRRMM-ESNV--PILGAVMNM-VNPSS
A0A5R8KA81      AVSDTLHMVSF-CKFVCLVARCSKTPRKAVIRAAQMLE-EAGK--APSGIILNM-LPARR
A0A5B5WU87      SLADARIVARL-ADATLYVMRAGCVRKRDLPCLQKTWK-NGKL--KRMGIVLCD-VENHS
R7DZW0          SLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGEL--KRMGIVLCD-VEPHG
A0A2N8HID1      SLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGEL--KRMGIVLCD-VEPHG
A0A2N8HS06      SLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGEL--KRMGIVLCD-VEPHG
A0A6N2TNT9      SLADARIVARL-ADVTLYVMRAGCVKKRDLAGLQKIWK-NGEL--KRMGIVLCD-VEPHG
A0A3R5R2M8      ILADTAILASW-SDISLYLTRSGMIDKRYFPQVQKLAD-TGKL--PNLAFIING-VNFKS
A0A411SUQ6      ILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PNMAYIING-VNFKS
A0A2N8HZF2      ILADTAILASL-SDITLYTVRSGKIDKRYLLQIQQLAD-QGKL--PNMAYIING-VNFKS
A0A354E720      ILADTAILASL-SDITLYTVRSGKIDKRYLTQIQQLAD-QGKL--PNMAYIING-VNFKS
B2UPB6          ILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PNMAYIING-VNFKS
A0A2V6JLK8      GVSDASVIASE-VDQTVIVVQHRRFPRAMLTRVKQAIL-GVGG--TVLGVVLNN-VDLK-
A0A2W5Z1A5      GVSDASVLASE-VDQTIIVVQHRRFPRAMLTRVKQAIT-GSGG--TVLGVVLNN-VDLR-
A0A2V6EA09      GVSDASVLASE-VDETIIVVQHRRFPRAMLTRVKQAIL-SVGG--TLLGVVLND-VDLK-
A0A2V6GQI7      GVSDASVLASE-VDETIIVVQHRRFPRAMLTRVKQAIL-SVGG--TLLGVVLND-VDLK-
A0A3C1HEJ2      PVSDTLLLAHR-AKTVCVVVRANKTPRKAALTAVQKLQ-KSRA--NIAGFILNGITLLH-
A0A522ULD9      GVTDASILASE-VDGVMLVVQYRKFPKVISMRAKRMIE-NTGS--HILGVVLNN-INIM-
A0A1V6JU76      AVSDPLILSAM-ADAVVFVTKFNKVRRDHARRTIQRIQ-DAGI--HICGVVLND-IDFEG
A0A2A2XXW5      AVSDPLIVGAM-ADGMVFVTKFNKIRREHALRSVQRIQ-DSGI--HLVGLVLND-IDFEG
A0A6N6Q6V0      AVADPLVVGAM-CDGVIFVTKFNKIRRDHALRSVQRIQ-DAGI--NLIGLVLND-IDFEG
A0A1Q6UHJ9      AVSDAIALLPY-VDGVIYIVKFNSVSRKAIQKNVRRLM-VSNV--PVVGAIMNM-VSQGS
A0A2V2BXR0      AVSDAIALLPY-VDGVIYIVKFNSVSRKAIQKNVRRLM-VSNV--PVVGAIMNM-VSQGS
A0A2D8V0G3      AVSDPLMVGAR-TDGMVFVSKFNKIRREHARKTVQRIQ-DAGI--YILGTVIND-IDFEG
A0A348S017      AVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YILGTVIND-IDFEG
A0A3C1UUV7      AVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YILGTVIND-IDFEG
A0A350I3V2      AVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YILGTVIND-IDFEG
A0A520RGV5      AVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YILGTVIND-IDFEG
A0A3D3XF90      AVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YILGTVIND-IDFEG
A0A2D7B522      AVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YILGTVIND-IDFEG
A0A356NIC2      AVSDPLMIASR-SDGIVFVSKFNKIRRDHARKTIQRIQ-DAGI--YILGTVIND-IDFEG
A0A2N8HDG3      ILADTAILAGH-ADISLYVVRSNRIDKRHISTVQQLAD-SGQL--PNLGFIINA-VDFKA
A0A146GCJ0      AVSDALLIASC-VDTACLVVRAGKTPKKASLRAVKQLQ-KSGA--KLAGFIFNR-LPVGG
A0A2T6D6H8      AVSDVLLIANC-IQTTCLVVHAGRTPKKAVLRAVRQLQ-KTGA--RLGGFVFNR-LPVGG
A0A3D1TI55      GVSDASVLASE-VDLALLVVQYRKYPKVMSNRAKKMVE-NVGG--RLVGVVLNN-INVM-
A0A3E1ET42      GVSDASVLASE-VDLTIIVIQHRKLPRSMLLRVKQAIE-NVGG--NLLGVVLNN-VDVR-
A0A2A2YDW8      GVSDASVLASE-VDLTIIVVQHRKLPRNMLLRVKQAVE-NVGG--HVLGVVLNN-VDVR-
A0A352XLN9      GVSDASVLASE-VDLTIIVVQHRKLPRNMLLRVKQAVE-NVGG--HVLGVVLNN-VDVR-
A0A3D0YP62      GVSDASVLASE-VDLTIVVVQHRKLPRNMLVRVKQAVE-NVGG--HVIGVVLNN-VDVR-
A0A3D3DV47      GVSDASVLASE-VDLTIVVVQHRKLPRNMLVRVKQAVE-NVGG--HVIGVVLNN-VDVR-
A0A2E5XJ49      GVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--QVIGVVLNN-VDVR-
A0A2E6SBY8      GVSDASVLASE-VDLTMIVVQHRKLPRXMLLRVKQAVE-NVGG--QVIGVVLNN-VDVR-
A0A2E5QMS4      GVSDASVLASE-VDLTIVVVQHRKLPRNMLMRVKAAVE-NVGG--QVIGVVLNN-VDVR-
A0A2E7YXQ3      GVSDASVLASE-VDLTIVVVQHRKLPRNMLMRVKAAVE-NVGG--QVIGVVLNN-VDVR-
A0A2E3H787      GVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVXQAVE-NVGG--QVIGVVLNN-VDVR-
A0A2E7AGN1      GVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--YVVGVVLNN-VDVR-
A0A2E7AKY7      GVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--YVVGVVLNN-VDVR-
A0A3D4CU34      GVSDASVLASE-ADLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--YVVGVVLNN-VDVR-
A0A2E8M146      GVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKQAVE-NVGG--HVIGVVLNN-VDVR-
A0A355S8S2      GVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKQAVE-NVGG--HVIGVVLNN-VDVR-
A0A2D6DVN8      GVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HVIGVVLNN-VDVR-
A0A3C1W2R2      GVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HVIGVVLNN-VDVR-
A0A2E3NAY6      GVSDASVLASE-VDLTMIVVQHRKLPRNMXVRVKEAVE-NVGG--HVIGVVLNN-VDVR-
A0A2E3II01      GVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HVIGVVLNN-VDVR-
A0A368B8C5      GVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HVIGVVLNN-VDVR-
A0A3R7RBB5      GVSDASVLASE-VDLTMIVVQHRKLPRNMLVRVKEAVE-NVGG--HVIGVVLNN-VDVR-
A0A2A2QX62      GVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--HVIGVVLNN-VDVR-
A0A4Q3BWH6      GVSDASVLASE-VDLTMIVVQHRKLPRNMLMRVKQAVE-NVGG--HVIGVVLNN-VDVR-
A0A3N5WCF1      GVSDASVLASE-VDLTMLVVQHRKLPRNMLLRVKQAVE-NVGG--HVIGVVLNN-VDVR-
A0A4Q3C1K5      GVSDASVLASE-VDLTMIVVQHRKLPRNMLLRVKQAVE-NVGG--NVIGVVLNN-VDVR-
A0A3R8IT45      AVSDALIILPL-ANGAIFTIFFNKVRRKAAQHAARKLL-ESNV--PVFGAVLNG-LNLAV
A0A2A2PYE8      AVSDALIILPL-VDGSIFTIFFNKVRRKAAQFSAKKLL-EANV--PNFGAVLNG-LNLAV
A0A2T6CN73      AVSDALIILPL-VDGSIFTIFFNKVRRKAAQFAAKRLL-DSNV--PNFGAVLNG-LNLVV
A0A2G4G428      AVSDALNLIPN-VDGVIYVVRYNFVSTRNVAECITRLR-EVGV--PILGAVLNR-MSMRM
A0A6N6PCD8      AVSDALLIVKH-ADATAFVVRARKTPTRTVLRALHLLE-GADQ--TPAGFILNR-LPSR-
A0A139TV24      ILADTAIFAKL-ADISLYVIRSNKIDKRYIATIQQLAN-EGKL--PNMGFVINA-VDFKA
A0A2N8HT11      ILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQL--PNMGFVINA-VDFKS
R7DS70          ILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQL--PNMGFVINA-VDFKS
A0A2N8HNL6      ILADTAILASH-ADISLYVIRSNRIDKRHIATVQQLAE-SGQL--PNMGFVINA-VDFKS
A0A6N6PAZ1      AVPDTRIIAPL-AHNFCLVARAEYSPKGAVHRTIQILA-EDGT--HISGIIFNGFVEKRS
A0A6I1K459      AVSDALLIVKE-AQTVCLVANARKTSYRVVQRALEMLR-RAGA--KPSGVVLNF-LPQS-
A0A139TUL1      AVADASLMARH-ADLVLYLIRCGMIEKQYVPSIQEVAA-RGEF--RSVALILNA-ENFK-
A0A2N8HCB0      AVVDASLMARH-ADLVLYVIRCGMIEKQYVPAIQGLAD-KGEF--RAVALILNA-ENFK-
A0A2N8HP04      AVADASLMARH-ADLVLYVIRCGMIEKQYVPVIQGLAD-KGEF--RSGAVILNA-ENFK-
A0A2N8HRJ0      AVADASLMARH-ADLVLYVIRCGMIEKQYVPVIQGLAD-KGEF--RSGAVILNA-ENFK-
A0A6N2U9Y7      AVADASLMARH-ADLVLYVIRCGMIEKQYVPVIQGLAD-KGEF--RSGAVILNA-ENFK-
A0A366HAG0      GVSDASVLAAE-ADMTIIVVQHRKLPRQMLQRVKQTIE-QVGG--KVAGAVLNN-VNIN-
A0A2U8DZK4      GVSDSAVITSL-IDHVLLLIQYRRNPLSMVLRAQQTIL-GLDK--EILGVVLNR-VPKN-
A0A2T6DFL8      GVSDTSVLMTV-VDGVVLLIQHRRNPQSMVLRAQQIVG-GVKA--SILGIVLNQ-IPGN-
A0A1D8AWD4      GVSDASVLASL-ADGIVLLIQHRRNPESMVQRAKQIID-GLKV--PVIGVVLNQ-VPTG-
A0A4Q1C9S2      GVSDASVLGSL-ADGIVLLIQHRRNPESMVQRAKQIIDQQVKV--PVIGVVLNQ-VPTG-
A0A178IH18      GVSDASVITSL-VDDVLLLVQYRRNPQSMVVRAQQIIA-GLHK--EILGIVLNR-VPKN-
A0A2T6DT99      GVSDASVLASV-MDDVLLLVQHRRNPQSMVMRAQQIIE-GLGK--TIVGIVLNR-VPRN-
A0A1G3ZT33      GVSDASVLSSV-VDGVVLLIQHRRNPQSMVLRAKQIIE-GLKT--PLVGVVLNQ-VPHG-
A0A3E1E2T2      GVSDASVLASA-VDGTVLLIQHRRNPQSMVVRAQQIVE-SLKA--PLLGVVLNQ-VPLN-
B1ZMW1          GVSDASVLASV-MDGAVLLIQHRRNPQSMVLRAQQIVE-AIKT--PLLGVVLTQ-VPEN-
A0A3M1I8A3      AVSDPLVVASL-SDGCVFVAKFNKVRREHARKTLRRLL-DAGV--HICGVLLND-IDFEG
A0A4V0XS84      AVSDALVLGTL-ADGVIFVVKFNKIHRDHARKSIQRIQ-SAGI--NIFGTVVND-IDYS-
A0A351WE84      GITDASILASE-VDGVLLVVQYRKYPRVISSRAKRMVE-NVGG--KLLGVVLNN-INIM-
D5ENH7          AVSDALNLLPL-VDGVVYVIKFNTVKRKTAVANVRRLW-ESNT--PVFGAILNN-ITTSL
A0A0R2XQ77      AVSDVLNLLPL-ADGVLYVIKFNTVKRKTAVVNVRRLW-ESNT--PIFGAILNN-ISSTL
A0A2E9IN28      AVSDALNLLPL-VDGILYVIKFNTVKRKTAVVNVRRLW-ESNT--PVFGAILNN-ITSSL
A0A6N4WTJ5      AVSDALNLLPL-ADGVIYVIKFNTVKRKTAVVNVRRMW-ESNT--PVFGAILNN-ITSSL
A0A1V5QDZ6      GVTDASILASE-VDGVLLVVQYRKYPKIITSRAKRMIE-NVGG--NVLGVVLNN-INIM-
A0A4Y8P964      GMPDAAIIGTL-TDGLIYVIQNGRTEKKDFLQNLQILA-SVNT--KILGVVLNK------
A0A3D4HF88      AVSDALNVLPH-VDGVLYVINYNTVKRKTVKASVRRLF-ESNV--PVFGVIMNQ-ITAAM
A0A6N6ZHN8      PVSDALNVVPQ-ADGVLYVIRFKMVKRKTASINIRRLR-ESNV--PVFGAILNN-INTN-
A0A351MR11      AVSDALHLVPK-VDGVIYVVRFNLVKKRNAMSCIARLR-EAGV--PIVGAVLNS-MATRL
A0A6G6K641      AVSDTLVVAPH-VDTICLVVRSHKTPAYAVMRASVALR-KTDK--IPAGIVLNR-MPAA-
A0A5B5WI95      ILADTAILAAL-SDISLYLIRSGMIDKRYFNQIQKLAD-SGKL--PNLAYIINA-VDFKS
A0A2N8I9W1      ILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PNMAYIING-VNFKS
A0A4Q5IH27      ILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PNMAYIING-VNFKS
A0A2N8IBZ6      ILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PNMAYIING-VNFKS
A0A2N8IJW9      ILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PNMAYIING-VNFKS
R6J100          ILADTAILASL-SDITLYAVRSGKIDKRYLLQIQQLAD-QGKL--PNMAYIING-VNFKS
A0A1V6J089      GVTDAAILASE-VDGVLLVVQYRKYPKIISLRAKRMIE-NAGG--QVLGAVLNN-INIM-
A0A3C1BZR1      GVTDAAILASE-ADGVLLVVQYRKYPKIISLRAKRMIE-NAGG--RLMGAVLNN-INIM-
A0A7C4KLL2      AVSDTLLICNL-AETTVLVVNSTKTPRKPVLRSIQLLR-NAGG--NPCGVVLNL-VPLRR
A0A1H6KPB7      GVSDASLIVSK-ADATIMVVQPRKLPMKALVREKMVIE-NAGG--HLMGVVMNN-VDIS-
A0A2E9ISN4      IFSESLAFCQ--ATGGVLVMMDSLTSQASVQNCLNELR-GI----RTLGFCVNG-VNESY
B9XAX1          AVSDTFILLPL-AQIICLVVRAGKTPKHAIMRAVELMA-RANV--PPTGIVLNF-LP---
A0A5R8KKM9      GVSDASVLAAE-ADLTLLVVQHRKLPRHMLQRVKHSVD-AVGG--DVVGVVLNN-VDIH-
A0A139TS01      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A3E1EJT7      AVSDALNILPL-MDGAIYTIHFNRVRRKAAQQCTRRLL-AVNV--PVFGAVMNG-MNTGI
A0A317ZP96      AVSDALNLLPL-VDGILYVIKFNTVKRKTAVVNVRRLW-ESNT--PVFGAVLNN-ITSTL
A0A7C3I5X9      AVSDPLIVASQ-VDGVVLVAKFNKVRREMARKSVQRLL-DAGV--QPCGVVIND-IDFEG
A0A2D5WGA5      GVSDASVLASM-VDMCVLVVQYRKYPQLMTQRAKEMVT-KVGG--DLVGVVLNN-INIS-
A0A2E7SSH2      GVSDASVLASA-VDLCVLVVQYRKYPQLMTQRAKDMVI-KVGG--NLVGVVLNN-INIS-
A0A349GXM8      RVTDTVILASQGIGQVLYVARVNFTPKPMIRYSLDMLK-DA----NILGLVMNS-IEMHK
A0A4P5YP61      AVSDTLLMLKR-VQTVCLVARANKTPRKATLRAVQMLR-QAEA--PLAGLILNR-LPRR-
A0A6B2LYM4      TVSDAMNILPL-VDGVLMVIRFNMVKRKTASVNIRRLR-ESNV--PIFGAVLNN-LN---
A0A6D1VXB3      GMPDAAIIGSV-TDGLIYVIQAGRIERKDFLQNLQILA-TVNA--RILGVVLNK------
I0JYY7          GMPDAAIIGSV-TDGLIYVIQAGRIERKDFLQNLQILA-TVNA--RILGVVLNK------
A0A4R7S1J2      AVSDTLVIVPH-VQTVLLVIHWKKTPSTVIQRALNLLG-ESGK--SPSGLILNN-VPEG-
A0A2A2XV69      GVSDASVLSSE-LDLTIIVVQHRRFPKEMIQRVKQAIE-NVGG--NILGVVLNN-VDIR-
A0A651H7X9      AVSDSLILLPL-VDGALFTIQFNRVKRKAAQTVVRRLS-ETSV--PVFGAILNG-LNLSL
A0A4Y8P842      GIPDASIVSMQ-TEGVLYVIEDGKDDRKEVQNNVEAFS-RINT--RILGIILNK-ADPV-
B3DZK9          GMPDAPIVSMQ-SEGVLYVIEDGRDDRKEVQNNIEAFS-RINS--RVLGIILNR-ADPL-
A0A5E6MPC4      GMPDAAVVATL-TDGVLLVIRDGAVDRSDARRVVETLS-VVNT--RILGIVLNR-VQQA-
A0A6N6PKP9      TVSDTLLLAPH-ADTACLVVRAGVTPGHAVVRAVEKLR-ESGA--KIAGFVLNA-LPIR-
A0A6N6Z250      GVSDASLLQPL-ADAVVLVVQYGRFPQPAVERAARSVR-QHGS--LVRGVIFNQ-VPAR-
A0A4V1SB02      AVSDTLSIAPL-ANAVCIVLRYGKTPRRAILRAVGLLR-KSNA--RMAGVIMNR-MPAR-
A0A6N6QEJ2      GVSDASILVSE-VEMAILVVQYRKYPQQMTLRAKQMVE-KIGGAERLLGVVLNN-INIS-
A0A3C1VB86      PVSDTLLLAGK-VQTVVLVVQACKTSRKAVERSVQLLK-NASA--PTGGVVLNL-LPKRR
A0A146G2Q9      GVSDASVLSSA-VDLTIIVVQHRRFPRAMLQRVKQAVL-NVGG--NILGVVLNN-VDVR-
A0A2T6D3Y2      GVSDASVLSSA-VDLTIIVVQHRRFPRAMLQRVKQAVH-NVGG--NILGVVLNN-VDVR-
A0A6N6P5E3      GVSDASVIASS-VDLTLVVVQHRRFPRAMLIRVKQALA-NVGA--NVIGCILNN-TDTR-
A0A2D5VY59      GVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGG--NLLGVVLNN-INIS-
A0A2D8UZZ4      GVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGG--NLLGVVLNN-INIS-
A0A353DV86      GVSDASILASE-VDMAILVIQYRKYPQAMTIRAKQMVE-KVGG--NLLGVVLNN-INIS-
A0A2E5EPT8      GVSDATVLTSM-VDLTLLVIQYRKYPQSLAVRSRQMIE-KVGG--TLLGIVLNN-INVS-
A0A6J4HTK1      GVSDASVLASE-VDQTIIVVQHRRFPRAMLTRVKQAVL-GVGG--TVLGVVLNN-VDLK-
A0A6N6PHJ5      GVSDASILASE-VDMTVQVIQYRRYPQPMNVRAKQLIE-KVGG--NLVGIVLNN-INMS-
A0A6M1RXR2      GVSDASILASE-VDMALQVIQYRRYPQPMNIRAKQMIE-KVGG--NLVGIVLNN-INLS-
A0A7C3DXS4      GVSDASILASE-VDLTLQVIQYRRYPQPMNIRAKQLIE-KVGG--NLIGIVLNN-INLS-
A0A2V2SDV4      GVSDASIIASE-VDMTLQVIQYRRYPQPLNIRAKQLIE-KVGG--NLVGIVLNN-INMS-
A0A2V5PK75      GVSDASILASE-VDMTLQVIQYRRYPQPMNVRAKQLIE-KVGG--NLVGIVLNN-INMS-
A0A1V6DME1      GVSDASILASE-MDMTVQVIQYRRYPQPMNIRAKQLIE-KVGG--NLIGIVLNN-INMS-
A0A3D3DIJ3      GVSDASILASE-VDMTIQVIQYRRYPQPMNIRAKQLIE-KVGG--NLVGIVLNN-INMS-
A0A6I1K583      GVSDATVLASG-ADLAILVIQYRKYPQSLAIRSRQMVE-KVGG--RLIGVVLNN-INLA-
A0A350EWA4      GVSDASVLASE-VDLTLQVIQYRRYPQPMTIRAKQMIE-KVGG--NLLGVVLNN-INMA-
A0A5B5WZ91      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A2N8HD92      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A2N8HIT2      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A354EBD3      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A355VEB2      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A2N8IMT3      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
R6K1U5          GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A2N8IWC2      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A2N8I441      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A2N8I3A6      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A410SCC4      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLVGVVMNN-VDIT-
A0A3R5VEW0      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A411SSG2      GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
B2UKW3          GVSDSAVIVSE-VDMTLMVVQPRKLPLKALLRQKQVIE-SVGG--NLAGVVMNN-VDIT-
A0A7C3HWX0      GVSDASILASE-VDLAILVVQYRKYPQAMTLRAKQMVE-KVGG--TLLGVVLNN-INIS-
A0A7C4KPD7      GISDASILASE-VDMTLQIIQYRRYPQPMTIRAKQMIE-KVGG--NLMGIVLNN-INMS-
A0A1M6RLZ4      GVSDASVLASE-VDLTMIVVQHRKLPRKMLVRVKQAVE-NVGG--TVLGVVLNN-VDVK-
A0A354T7G8      GVSDASVLANE-ADMTMIVVQHRKLPRHMLMRVKQSVE-NAGG--KVVGVVLNN-VDLR-
A0A2S7U4L6      GVSDASVISSE-VDLTMIVVQHRKLPRNMLVRVKQAVE-NVGG--TVLGVVLNN-VDLR-
A0A512MBZ2      GVSDASVLSNE-ADMTMLVVQHRKLPRHMLMRVKQTVE-NVGG--RVLGVVLNN-VDVR-
A0A2E8MEZ0      GVSDAAVLASE-VDLTMVVVQHRKLPRNMLLRVKQAVE-NVGG--QVIGVVLNN-VDVR-
A0A6B3LBV6      GVSDASVLCSE-VDMTVVVIQHRKLPRNMLQRVKKAVE-SVGG--TLLGVVLNN-VDVR-
A0A2E3EC33      GVSDASVLASE-VDLTIIVIQHRKLPRGMLIRVKQAIE-NVGG--KALGVVLNN-VDVR-
A0A2E4GN01      GVSDASVLASE-VDLTIIVIQHRKLPRGMLIRVKQAIE-NVGG--KALGVVLNN-VDVR-
A0A1Z8XU55      GVSDASVLSSE-VDLTIIVIQHRKLPRGMLVRVKQAIQ-NVGG--TALGVVLNN-VDVR-
A0A2E1RQR9      GVSDASVLSSE-VDLTIIVIQHRKLPRGMLVRVKQAIQ-NVGG--TALGVVLNN-VDVR-
A0A2E3ISQ4      GVSDASVISSE-VDLTIIVIQHRKLPRGMLLRVKQAIQ-NVGG--TALGVVLNN-VDVR-
A0A2D6W6F4      GVSXASVISSE-VXLTIIVIQHRKLPRGMLLRVKQAIQ-NVGG--TALGVVLNN-VDVR-
A0A2D8Z5A8      GVSDASVISSE-VDLTIIVIQHRKLPRGMLLRVKQAIQ-NVGG--TALGVVLNN-VDVR-
A0A4Q2YKS3      GVSDASVLASE-VDLTMIVVQHRKLPRNMLIRVKQAVE-NVGG--HVIGVVLNN-VDVR-
A0A6N6P3T8      GVSDASVLASE-VDLTMIVVQHRKLPRNMLQRVKQAVE-NVGG--TIIGVVLNN-VDVR-
                 .                                              .  .        

A0A2A2XVF1      AAGYYYYY---YGDKYEKDSVYGTKT----------------------------------
A0A2V5UHJ2      -NNEYGGY---YQQYY--EYYSQDPPAITDNAPALSENGHGRLSRRSRLNGSFPVTLKPV
A0A2V5PST3      -EDPDYAY---YRHYYGSDYGTVAAAENGNGGEHTDVEVLMNDGPFEKDPWPKIAASEIV
A0A2V5PXM3      GGYGYYYYDSYYAYGYYGKYGHGQKEKARAAAA---------------------------
A0A1V5QB01      VGYYYYST---YYGYYDYDHIRESKEDAKT------------------------------
A0A7C5LI63      -RVGYYHYYPYYYSYYSRGYYYAHKEEEEARAGEIKAGEAPAAEKKEEDQIEDVY-----
A0A7C5P291      -RVGYYHYYPYYYSYYSHGYYYARSEEDKGKGGDIKGLEVPRAESGKDD-IDDVY-----
A0A139SU05      EYYSNYRYYRSYGKYTERVDRPERETKRPKKVVEEAEVSEIA------------------
A0A139SPN4      EYYSNYRYYRSYGKYTNVEPARGELDREPARAPEAAPAAEPAVAA---------------
A0A1V6E7N1      KYYSNYRYYRSYKKYYGTHG----------------------------------------
A0A2D9MYT1      KDSYYYSYYYYQNRYYASHYKSDKPXEEEAXQLPLQPGVKXAGKEEXSA-----------
A0A258ANJ7      RS---------FDQYYHRSYYKGSETDETAPLRPASRGLHTPSNFG--------------
A0A290QGD9      SGYYYGQY---TDKSYKDYYVVMSKKDDTQSPLK--------------------------
A0A1D8AS58      SGYYYAQY---YDKSYKDYYVTMAKQDGEPDAR---------------------------
I6AQC1          AGYYYAQY---YDKSYKDYYVMTESEEGEDTAEADDKVPEMPTSRS--------------
W0ITH7          AGYYYAQY---YDKSYKDYYVMTESEEGEDTAEADDKVPEMPTSRS--------------
A0A139TLN4      RPSRKYAM---YRSFDTSSPCPGK------------------------------------
A0A1G3ZFT0      SKKSSYQY---YSSHY---YYEDESDHPKKKRRTLV------------------------
A0A1Z8ZMT6      LQGGKYGYGYGYGQYGDDA-----------------------------------------
A0A2E8MCT7      LQGGKYGYGYGYGHYGDDT-----------------------------------------
A0A290Q2Z2      -SSDDYGY---YTRNY--AYYSARENRSSERRDKRSRTEQAERAKSDERITFTERERDER
A0A2A2RGK2      -RGGYYAY--YYSGKYYGSYGAKGVYGE--------------------------------
A0A2A2XXF7      -RGGYYAY--YYSGKYYGSYGAKGVYGE--------------------------------
A0A2A2R5D6      -SDEAYYYYSSYGNYYYNRNGEKKPRSGAATPQRATLAKNDEQSHGSEDF----------
A0A1J4XH17      VNYYYSNY---YDKTYYDYYNNGELPEKKSNLDKATKLATRVKSALSKKKNKEKTLV---
A0A3C1VJ32      -QDEGYYY---YSGYYHDYYYSRDPS----EQEAEAKKADL---AAKGPG-DTE------
A0A2N9NTX7      -QDESYYY---YSGYYHDYYSRNEDQ----EKGSGPD---------EGPGDKTK------
B9XK55          -QDESYYY---YSGYYHDYYSKNEDE----SE-TATD---------AGEG-KAR------
A0A4P5YMI6      -QDSYYYY---YSGYQYT------------SENQPEAPAVAKRATKGALAEKPA------
A0A2E6T482      -QDSYYYY---YSGYYYDYYYKSREK----EEENADKSEDG--AKEGKLLAKADLGA---
A0A3C0DQZ7      -QDSYYYY---YSGYYYDYYYKSREK----EEENADKSEDG--AKEGKLLAKADLGA---
A0A1Z9CBK5      -QDSYYYY---YSGYYYDYYYKSREG----EEDAGEEKKAD---KDQKLVAQANPGG---
A0A2D6ZI96      -QDSYYYY---YSGYYYDYYYKSREG----EEDAGEEKKAD---KDQKLVAQANPGG---
A0A358KGZ3      -QDSYYYY---YSGYYYDYYYKSRET----EDEPVEDKKDG---KEEKLIAQADAAG---
A0A2E9ZQX4      -QDSYYYY---YSGYYXDYYXKSRET----EEEPVEDKKDG---KEEKLIAQADAXG---
A0A3D5JZU0      -QDSYYYY---YSGYYYDYYYKSRET----EEEPVEDKKDG---KEEKLIAQADAVG---
A0A2E6HCR0      -QDSYYYY---YSGYYYDYYYKSREN----EEESEDVKESE---NGKSLVSEAASDR---
A0A1Z8WN04      -QDSYYYY---YSGYYYDNYYKSRED----EEGSDGTGSDNKEIKDKSITTE-VDSS---
A0A2D7L1N4      -QDSYYYY---YSGYYYDNYYKSRED----EEGSDGTGSDNKEIKDKSITTE-VDSS---
A0A2E2R937      -QDSYYYY---YSGYYYDNYYKSRED----EEGSDGTGSDNKEIKDKSITTE-VGGS---
A0A520QQY4      -QDSYYYY---YSGYYYDNYYKSRED----EEGSDGTGSDNKEIKDKSITTE-VDSS---
A0A2D5MR66      -QDSYYYY---YSGYYYDNYYKSREN----EEESLPEKGSD---QEKSITNESADRD---
A0A2E0PDQ1      -QDSYYYY---YSGYYYDNYYKTREN----EEESIAVKESD---KDKLINTEATENN---
A0A2E2ZZP9      -QDSYYYY---YSGYYYDNYYKSREN----EEEPIAEKESD---KDKLINTEDAENN---
A0A7C4LRK7      -QDSYYYY---YSGYFEESYYQQDGE----KKSKSRSGGKS---RETEVASTGG------
A0A2A2RGF2      -SDASYYY---YSGYN---YHSNNNA----DEPGTNGKPPG---KADRHKPAAPTADA--
A0A2G4I5Y6      -SDASYYY---YSGYN---YRSNNND----DESSTNGKPPG---KVDRHKPVAPVADA--
A0A6N6PS97      -QDSYYYY---YSGYYYD-YYSKHDD----GDKYGDKYGDS---YEGSKKKKKKGSEKPT
A0A3M1I883      -QDSYYYY---YSGYYYDYYYGSSSEYGRRRRKSSRKRRKS---REKDSSAEAPATAATE
A0A1V6JZ45      -QDSYYYY---YSGYYYD-YYSKGEY----GESKSSEDDES---RKAAPKKPAE------
A0A7C7Z746      -QDENYYY---YSGYYYDYYYSRRDD----DDSDDSKKSRK---KSGNLKRSGDSKKASS
A0A520RRW5      -QDSYYYY---YSGYYYD-YYSKQDG----DNTSSKKKSDG---KSGKTSARGD------
A0A356NPK0      -QDSYYYY---YSGYYYD-YYSKQDG----DNTSSKKKSDG---KSGKTSARGD------
A0A2D7B5P5      -QDSYYYY---YSGYYYD-YYSKQDG----DNTSSKKKSDG---KSGKTSARGD------
A0A3D3XGB5      -QDSYYYY---YSGYYYD-YYSKQDG----DNTSSKKKSDG---KSGKTSARGD------
A0A2V6F8A1      -QDSYYYY---YSGYYYD-YYSKREE----EP-S--KNNGE---KKKPAGERAQ------
A0A2V5TNH4      -QDSYYYY---YSGYYYD-YYAKREE----EPPA--KNNGE---KKTPAGERAQ------
A0A2V5X5Q6      -QDSYYYY---YSGYYYD-YYAKREE----EPAA--KNNGE---KKKPAGERAQ------
A0A4P5QM05      -QDDSYRYYSNYKDYYGPKRDTPE-DRKKPEVAAA--------NADNEDAY---------
A0A4Q3C001      -HDEGYSYYNNYNDYYAPRTESPK-QASGQQPRRPAAAPTPASTGSKHGDY---------
B4DB23          -HDDGYSYYYNYNEYYGPRRGTPKIEAPAPQLARP--------RDTHREDY---------
A0A6B3L938      TGGSGYYGYHGYGEYGHEGYYGDND-----------------------------------
A0A2V5URB2      -SAEYRDY---YRYYNPEFYYPSARLT---------------------------------
A0A2V2DJ66      VSGYSINY---YDKNYQNYYMTPPEIENQQEGRRQPPEVSHSDGEEKNS-----------
R7L5A9          ASVYSMNY---YDKSYQNYYTAPMESDEDEQPPEDVPPEMPSESKQ--------------
A0A5R8KA81      NSGLYYHY---YSGSYGKPVYGKPVAS---------------------------------
A0A5B5WU87      RSSRKYAM---YRSFDTSSPCPGK------------------------------------
R7DZW0          RSSRGYAV---YRSLDTSSPCAGK------------------------------------
A0A2N8HID1      RSSRGYAV---YRSLDTSSPCAGK------------------------------------
A0A2N8HS06      RSSRGYAV---YRSLDTSSPCAGK------------------------------------
A0A6N2TNT9      RSSRGYAV---YRSLDTSSPCAGK------------------------------------
A0A3R5R2M8      ASYNYYGYGYGYGYGTGSRSRRNEPETAPEDSDKQ-------------------------
A0A411SUQ6      ASYSYYGYGYGYQYGYGTK----EPQQTSRKQDK--------------------------
A0A2N8HZF2      ASYSY--YGYGYQYGYGTK----KPQQTSRKQNK--------------------------
A0A354E720      ASYSYYGYGYGYQYGYGAK----DPQQTARKRD---------------------------
B2UPB6          ASYSYYGYGYGYQYGYGTK----EPQQTSRKQDK--------------------------
A0A2V6JLK8      -HDQNYYY---YTNYY--GYYQPRDKETHRRGRQKSRVAANGSADNGHIDTDEY------
A0A2W5Z1A5      -HDQNYYY---YTNYY--GYYQPQDRQS-RRSRSR-AGVGAESNGASDNGRDEY------
A0A2V6EA09      -HDQNYYY---YTHYY--AYYQPRGKET-RRGRSRKAAATVAHNGASGSDEDEY------
A0A2V6GQI7      -HDQNYYY---YTHYY--AYYQPRGKET-RRGRSRKAAATVAHNGA--SDSDEY------
A0A3C1HEJ2      -RSDYYDYSDYYARYREKDHSPAAPAPKAANSGK--------------------------
A0A522ULD9      -RDDYYYY---YHSYYADYYYRSQESMPKPETVGGVTAAEVRKEST--------------
A0A1V6JU76      RDSYYYSYTYYQNRYYSSYHRERAESRRQAVVESSGSTPAPHA-----------------
A0A2A2XXW5      KDSYYYSYHYYQNQYYSSHYRNK--SADEPADKKSASEKSKSA-----------------
A0A6N6Q6V0      KDSYYYSYHYYQNRYYSSHYRTK--PGKPEAEKGAGVAKAKG------------------
A0A1Q6UHJ9      AAGYSLNY---YDKSYQNYYTMPDVEEEDSEGEEAQEGGESEDPENSENSK---------
A0A2V2BXR0      AAGYSLNY---YDKSYQNYYTMPDVEEEDSEGEEAQKGGESEDPENSENSK---------
A0A2D8V0G3      KDSYYYSY-YYYQNRYYASYYSNEKKLGSKKGEGAKDGELVQGGKAGKDDEPSKA-----
A0A348S017      KDSYYYSY-YYYQNRYYASYYSNEKKLEPNK----KSKSVVQLDKTAKKSESEV------
A0A3C1UUV7      KDSYYYSY-YYYQNRYYASYYSNEKKLEPNK----KSKSVVQLDKTAKKSESEV------
A0A350I3V2      KDSYYYSY-YYYQNRYYASYYSNEKKLEPNK----KSKSVVQLDKTAKKSESEV------
A0A520RGV5      KDSYYYSY-YYYQNRYYASYYSNEKKLEPNK----KSKSVVQLDKTAKKSESEV------
A0A3D3XF90      KDSYYYSY-YYYQNRYYASYYSNEKKLEPNK----KSKSVVQLDKTAKKSESEV------
A0A2D7B522      KDSYYYSY-YYYQNRYYASYYSNEKKLEPNK----KSKSVVQLDKTAKKSESEV------
A0A356NIC2      KDSYYYSY-YYYQNRYYASYYSNEKKLEPNK----KSKSVVQLDKTAKKSESEV------
A0A2N8HDG3      GSYSYYGYGYHYGNTSKNAHS---------------------------------------
A0A146GCJ0      RSAGYYYY------YYGGEYSKNSVYGEKSV-----------------------------
A0A2T6D6H8      QSAGYYYY------YYGGDYAKNGVYGAKAG-----------------------------
A0A3D1TI55      -RDDYYYY---YHTYY-SHYYGPQEERTPDRPKELDVGEAY-------------------
A0A3E1ET42      -SDSQYQY---YTSYY--TYYSPTNAEARKPRQAAPAGGAP----QRPAPAKAGAGR---
A0A2A2YDW8      -SDSQYQY---YTSYY--TYYAPAESELPQPQPSTSSRPATPS-------STASTSN---
A0A352XLN9      -SDSQYQY---YTSYY--TYYAPAESELPQPQPSTSSRPATPS-------STASTSN---
A0A3D0YP62      -SDNQYQY---YTSYY--TYYAPTTGDEIARDTATAAPAPS---------QQAQPAR---
A0A3D3DV47      -SDNQYQY---YTSYY--TYYAPTTGDEIARDTATAAPAPS---------QQAQPAR---
A0A2E5XJ49      -SDSQYQY---YTSYY--TYYAPSADPDPVA--GGSPGGPPGGGSRTVS-TS-APQD---
A0A2E6SBY8      -SDSQYQY---YTSYY--TYYAPTADADPVP--XASPGGASAGRVRSAA-ASPSSQD---
A0A2E5QMS4      -SDSQYQY---YTSYY--TYYAPSSDVDPISSPPRKMTVST-GASPTAT-PSTPEED---
A0A2E7YXQ3      -SDSQYQY---YTSYY--TYYAPSSDVDPISSPPRKMTVST-GASPTAT-PSTPEED---
A0A2E3H787      -SDSQYQY---YTSYY--TYYAPSADADPVPGAGFEAAAES-ATAEATG-SSKDEND---
A0A2E7AGN1      -SDSQYQY---YTSYY--TYYAPSADADPVPGGGVTKSAER-ASVKTPG-GKNETDD---
A0A2E7AKY7      -SDSQYQY---YTSYY--TYYAPSADADPVPGGGVTKSAER-ATVKTPG-GKNELDD---
A0A3D4CU34      -SDSQYQY---YTSYY--TYYAPSADADPVPGGGVTKSAER-ASVKTPG-GKNETDD---
A0A2E8M146      -SDSQYQY---YTSYY--TYYAPSADSDPVPTVGATASATSGSALESKV-VANDSEE---
A0A355S8S2      -SDSQYQY---YTSYY--TYYAPSADSDPVPTVGATASATSGSALESKV-VANDSEE---
A0A2D6DVN8      -SDSQYQY---YTSYY--TYYAPSADSDPVPSVGATASGTS-AATESTV-ATSDEDK---
A0A3C1W2R2      -SDSQYQY---YTSYY--TYYAPSADSDPVPSVGATASGTS-AATESTV-AANDEDK---
A0A2E3NAY6      -SDSQYQY---YTSYY--TYYAPSADSDPVPTGGTTSSGTT-EAIESTV-ATNDADD---
A0A2E3II01      -SDSQYQY---YTSYY--TYYAPSADSDPVPTVGTTASGTS-AAIESAV-AATDADK---
A0A368B8C5      -SDSQYQY---YTSYY--TYYAPSADSDPVPTVGTTASGTS-AAIESAV-AANDADK---
A0A3R7RBB5      -SDSQYQY---YTSYY--TYYAPSADSDPVPTVGTTASGTS-AAIESAV-AANDADK---
A0A2A2QX62      -SDSQYQY---YTSYY--TYYAP-AESQSLPSQGSSSAPAKPAPPRSTS-RGDAADD---
A0A4Q3BWH6      -SDSQYQY---YTSYY--TYYAP-AESQPMPTQSGSQAPSQSPAPRSSS-RASSTDD---
A0A3N5WCF1      -SDSQYQY---YTSYY--TYYAP-AEAQVVAP--PPGSSSAPSKPQAAATRGADS-----
A0A4Q3C1K5      -SDSQYQY---YTSYY--TYYAP-AESQIGPPVSSPTSSTPAAKPQAPA-RGNDS-----
A0A3R8IT45      AGYYYAQY---YDKSYKDYYVMAGAEDAIDNSASNEEEDVVAPGSKS-------------
A0A2A2PYE8      SGYYYAQY---YDKSYKDYYVVMSKNDTEQEK----------------------------
A0A2T6CN73      SGYYYAQY---YDKSYKDYYVV-SKGDTEQER----------------------------
A0A2G4G428      ASVYTDSFDASYEKYYNAAAGAA--------------------AKDDAGDAVASTEN---
A0A6N6PCD8      -LAGYYYY---DAGNYSSAGVYGI------------------------------------
A0A139TV24      AGHHYYGYGYHYNYGYNTTNS---------------------------------------
A0A2N8HT11      SSYSYYGYGYHYGNTSKNNPS---------------------------------------
R7DS70          SSYSYYGYGYHYGNTSKNNPS---------------------------------------
A0A2N8HNL6      SSYSYYGYGYHYGNTSKNNPS---------------------------------------
A0A6N6PAZ1      LMGENYSYGYYKTSRYGRAYRYGYDAAYGAYGSDSEKKPRSRK-----------------
A0A6I1K459      -AGSGYYYYYSGNKYY---------------------------GKKGVYGATSSRG----
A0A139TUL1      --NSRFHY---YSEYSGSETAG--------------------------------------
A0A2N8HCB0      --NSRFHY---YSEY--SETDG--------------------------------------
A0A2N8HP04      --NSRFHY---YDEY--SETDG--------------------------------------
A0A2N8HRJ0      --NSRFHY---YDEY--SETDG--------------------------------------
A0A6N2U9Y7      --NSRFHY---YDEY--SETDG--------------------------------------
A0A366HAG0      -SDATYGY---YTSYY--GYYSGDGKGDGTMKAKRKTR-----QSTPAKGAKVKSPR---
A0A2U8DZK4      -AGADYAY---YSKNY--AYYGSKSARTR-----------DKTAGDTINFSEKK------
A0A2T6DFL8      -AGGDYGY---YTSNY--AYYHEGSRRTRRSARSDK--KPEAGGEDRLDLHE--------
A0A1D8AWD4      -TGEDYSY---YTNNY--SYYS---HEKPVPGAAGAAGPNEARGSDRIEMRETREPE---
A0A4Q1C9S2      -SGEDYGY---YTNNY--SYYS---HEKP-----AVAGKAAERGAERLDLDEK---P---
A0A178IH18      -AGDDYGY---YTNNY--AYYSSRDVRRRSRRHRSGRDRDDEADA-RETFTEPER-----
A0A2T6DT99      -SGEDYGY---YTHNY--AYYSSHGRRRSRRSRRDDADGESDSRGDRIEYVERERRR---
A0A1G3ZT33      -SGDDYGY---YTGNY--DYYSEGHKRRKSARTEAA--AVPAGGAERIVLDEPDSRR---
A0A3E1E2T2      -SGDDYGY---YTNNY--SYYSEGSGRRRR---SAAKPKSPGRGGDELKLS---------
B1ZMW1          -AGGDYGY---YTHNY--SYYSDGSHRRHRPGPSAAHQAAPAVEGDRLVLREPERKD---
A0A3M1I8A3      RDSYYYSYYFYQNRYYSSYRSRPDQIGAVRST----------------------------
A0A4V0XS84      -NSQYY-----YSEYYSNQIASPEFGEAKSSSVATDSDRANGASRSASFNGGGKSAT---
A0A351WE84      -RDDYYYY---YHASYTQY------------------------NPDGQEKVPAKTIA---
D5ENH7          SSYYYSQY---SDKAYQDYYIHQEDEFEEELAGSVEPDKQ--------------------
A0A0R2XQ77      ASYYYSSY---SDKAYQDYYISQDVELEDELAGSVEP--EMEPRS---------------
A0A2E9IN28      SSYYYSNY---SDKAYQDYYIHHEEELEEEMAGSVEPQSELGPKA---------------
A0A6N4WTJ5      SNYYYSSY---SDKAYQDYYIHQDEEFEEELAGSVEP--EMRPKA---------------
A0A1V5QDZ6      -RDDYYYY---YHSYYSQYYQSDESKPADELADTSNRKKDAL------------------
A0A4Y8P964      -TDGSYQS---YYSYY--AYKAKDELQNKNETQNLSPFQSLRFLNGWVKKKSSDKTT---
A0A3D4HF88      SSYYYTNY---YEKSYDKYYTGGSNPKA--------------------------------
A0A6N6ZHN8      -VAGYYYSHYYYDKSYKNYYMSGNE------------------EGTREVENTHRKTP---
A0A351MR11      AAFYTNSYDASYSKYY-----------------------------TDAADQGAEKPA---
A0A6G6K641      -AAGQYYY---YSSSH--------------------------------------------
A0A5B5WI95      SSYSYYGYNYGYRYSY---------------------------GSG--REAAGKN-----
A0A2N8I9W1      SSYSYYGYGYGYQYGY---------------------------GSGEPRQTTRKQD----
A0A4Q5IH27      SSYSYYGYGYGYQYGY---------------------------GSGEPRQTTRKQD----
A0A2N8IBZ6      SSYSYYGYGYGYQYGY---------------------------GSGEPRQTTRKQD----
A0A2N8IJW9      SSYSYYGYGYGYQYGY---------------------------GSGEPRQTTRKQD----
R6J100          SSYSYYGYGYGYQYGY---------------------------GSGEPRQTTRKQD----
A0A1V6J089      -RDDYYYY---YHYTTRKYYGVVRHENDDNLTES--------------------------
A0A3C1BZR1      -RDDYYYY---YHYATKKYYGSSKHDKEDDATEA--------------------------
A0A7C4KLL2      GGGYYYDS---YYYYHTDSYHKEKNKSGGEEQVSQSGDDKQAKQETASSVPR--------
A0A1H6KPB7      -GDTQYQY---YTTYY--SYYSPTEGVEPSAALNPLPVTSRS-SKRSEVAKKTESTD---
A0A2E9ISN4      LRSNGYDA---YGSYGT--------------------------RHIESAFLYGMESE---
B9XAX1          -QHSGYRY---YYHYTPRNGYKSIGVYGNDYPAKIPLNT---------------------
A0A5R8KKM9      -SDNTYGY---YTSYY--TYYNSDQRGKKDRQPVANAPQK---TLASLQSPKSEKNR---
A0A139TS01      -SDHQYQY---YTTYY--SYYSAESGASGGNADASSLKKA---ERSGKAKELAATQS---
A0A3E1EJT7      TGDYYMEN---NSKLFKEYYNPGGEPPVTSQSS---------------------------
A0A317ZP96      SSYYYSQY---SDKSYQDYYIQQ--------------------EEEFEHELEGEVEP---
A0A7C3I5X9      RDAYYYSYYYYQNRYYKGYYQAGAGAETEPAEESTPVQKA--------------------
A0A2D5WGA5      -QDSYYYY---YSGYYYDYYYKSREKEEESGDAAKDG------KKEPKLLAKADVGG---
A0A2E7SSH2      -QDSYYYY---YSGYYYDYYYKSRETEEESTEDNKNG------GND-KLIAQADIGG---
A0A349GXM8      ISSLYYAYQYPNYAYYSNAYAYGYDYYYDEKGGNRRSRRQIRWRKQLEHAGAWIRKT---
A0A4P5YP61      -VGLGGYY---YDSYYNYSYYGKYGAKGVYGAKA--------------------------
A0A6B2LYM4      -THVAGYY---YSHYYDKSYKSYKHYYLQNKGME---------DLDEEVAASGPSDG---
A0A6D1VXB3      -TTTSYQS---YYSYY--AYKEKNEIQNKNQTQSLSPFHSLQFLNDWVQEKIKRPDK---
I0JYY7          -TTTSYQS---YYSYY--AYKEKNEIQNKNQTQSLSPFHSLQFLNDWVQEKIKRPDK---
A0A4R7S1J2      SRGYYYHY---SPGYY---------------------------GSKGVYGASA-------
A0A2A2XV69      -HDQSYGY---YTSYY--NYYSPSKNVPEKS------------GQNAQAASPATTKP---
A0A651H7X9      AGYYYAQY---YDKSYKDYYVVTSEDEKEMR-----------------------------
A0A4Y8P842      -SSSYYYS---YSYKY---------------------------RSAVPSDSQEIMRK---
B3DZK9          -SHSSYY----YAYKY---------------------------RSQASSNSQELMRK---
A0A5E6MPC4      -NRSYYAY---HYAYR---------------------------LSEEQRRAEALRAP---
A0A6N6PKP9      -NGGYYYH---YQAPG---------------------------YGSDEVYGASAALA---
A0A6N6Z250      -QQGAYGY---YGYGYRR-------------------------ENTGPASSSTTAAK---
A0A4V1SB02      -RGASYYY---Y--YYGDPYVKDGVYGSSVNPKKKRGKKANDEDAAWPESTPAVSPS---
A0A6N6QEJ2      -QDSYYYY---YSGYYYDYYSKSEDSKPDGEKKKKS-------RSGKAGAAVADDKS---
A0A3C1VB86      LSGYYYSY---HHGYGYGNYGEKAA------------------DKTSDDTRGNLASE---
A0A146G2Q9      -HDQHYQY---YTSYYNYYYQKPQQQKADKKPA----------KKAPVSAVQQLNGE---
A0A2T6D3Y2      -HDQHYQY---YTSYYNYYYQKPQQQKADKKPA----------KKAPVSAVQQLNGE---
A0A6N6P5E3      -SDEYYEY---YTSYY--SYYQPKQFSEKPSSKQPQIDLV---GEKKEKKVAVVDAE---
A0A2D5VY59      -QDSYYYY---YSGYYYDYYSKQDDSEGGSSA-----------QPKTKSSKTASRGD---
A0A2D8UZZ4      -QDSYYYY---YSGYYYDYYSKQDDSEGGSSA-----------QPKTKSSKTASRGD---
A0A353DV86      -QDSYYYY---YSGYYYDYYSKQDDSEGGSSA-----------QPKTKSSKTASRGD---
A0A2E5EPT8      -SDASYYY---YSGYH---YHDNPSSSGSLNIDSKPRELK---GKVDRQRGQDSSEE---
A0A6J4HTK1      -HDQNYYY---YTNYY--GYYQPRDKETRR-------------SSRKAAAATVASNG---
A0A6N6PHJ5      -QDESYYY---YSGYYQDYYAKNEDSEPLAEGQA---------KKPADKKTEG-------
A0A6M1RXR2      -QDESYYY---YSGYYHDYYYRSDDSEKSDSGKG---------REKTDK-AAGELAR---
A0A7C3DXS4      -QDESYYY---YSGYYHDYYYRSEDSEKIGSDKD---------KEKAGKTASADTAR---
A0A2V2SDV4      -QDENYYY---YSGYYHE-----EGT----NDEE---------QEAAPGGPASQKS----
A0A2V5PK75      -QDESYYY---YSGYYHDYYSVNED-------QE---------SAARPDEPAGDKAR---
A0A1V6DME1      -QDESYYY---YSGYYHDYYYRSSES----SDKD---------EAAGEKKADDSQAK---
A0A3D3DIJ3      -QDESYYY---YSGYYHDYYYRSEE-------QE---------PVVKEGAESGGKDK---
A0A6I1K583      -SDASYYY---YSGYH---YHSNNNADEPGANGKPPG------KVDRRKPVAPATDA---
A0A350EWA4      -QDENYYY---YSGYY-YDYYSKQNDDDGDQSG----------RKNGHPATKDEPAS---
A0A5B5WZ91      -SDHQYQY---YTTYY--SYYSAESGASDGNADASSLKKA---ERSGKAKELAATQS---
A0A2N8HD92      -SDHQYQY---YTTYY--SYYSADGGSSGGNVDASSMKKA---ERSGKAKELAANQS---
A0A2N8HIT2      -SDHQYQY---YTTYY--SYYSADGGSSGENADASSMKKA---ERSGKAKELAATQS---
A0A354EBD3      -SDHQYQY---YTTYY--SYYSTDGSSSGENAEASSMKKA---ERSGKAKELAATQS---
A0A355VEB2      -SDHQYQY---YTTYY--SYYSTDGSSSGENAEASSMKKA---ERSGKAKELAATQS---
A0A2N8IMT3      -SDHQYQY---YTTYY--SYYSADGSSSGENADASSMKKV---ERSGKAKELAATQS---
R6K1U5          -SDHQYQY---YTTYY--SYYSADGSSSGENADASSMKKV---ERSGKAKELAATQS---
A0A2N8IWC2      -SDHQYQY---YTTYY--SYYSADGSSSGENADASSMKKV---ERSGKAKELAATQS---
A0A2N8I441      -SDHQYQY---YTTYY--SYYSADGSSSGENADASSMKKV---ERSGKAKELAATQS---
A0A2N8I3A6      -SDHQYQY---YTTYY--SYYSADGSSSGENADASSMKKV---ERSGKAKELAATQS---
A0A410SCC4      -SDHQYQY---YTTYY--SYYSADGSSSGENADASSMKKV---ERSGKAKELAATQS---
A0A3R5VEW0      -SDHQYQY---YTTYY--SYYSADGASSGENADASSMKKV---ERSGKAKELAATQS---
A0A411SSG2      -SDHQYQY---YTTYY--SYYSADGASSGENADASSMKKV---ERSGKAKELAATQS---
B2UKW3          -SDHQYQY---YTTYY--SYYSADGASSGENADASSMKKV---ERSGKAKELAATQS---
A0A7C3HWX0      -QDSYYYY---YSGYY-YDYYSKSS----ESEPEGKSAKPAKDVPKAVAAVTGAGDP---
A0A7C4KPD7      -SDSYYYY---YSGYFEESYYK-------DSDDKSSSRRK---GKRSGSDAGSTSAE---
A0A1M6RLZ4      -SDSQYQY---YTSYY--TYYAPSEA-----------------PQEVRAAAQPQGAQ---
A0A354T7G8      -SDAQYQY---YTSYY--TYYAPTNSPTGGAGGKTRRRKVKAETTANALTSPRTVSR---
A0A2S7U4L6      -SDSQYQY---YTSYY--TYYAPGQNK----------------SAAAEATAKSSSDS---
A0A512MBZ2      -SDSQYQY---YTSYY--TYYSPNNQAA-APGEQPQKRRRRSDAPAAPNAAPSPASR---
A0A2E8MEZ0      -SDSQYQY---YTSYY--TYYAPSS--L-EETGTPQQMTA---APASSKTEEKKSER---
A0A6B3LBV6      -SDSQYQY---YTSYY--TYYASGD------DQAAKPKKR---GKKEVSSSVGGGDV---
A0A2E3EC33      -SDNQYQY---YTSYY--TYYSPSN--I-DPNQKISSDKP---KAPSSKEPKGSSEE---
A0A2E4GN01      -SDNQYQY---YTSYY--TYYSPSN--M-DPNQKISSDKT---KSSSSKESKSSSEE---
A0A1Z8XU55      -SDNQYQY---YTSYY--TYYAPRN--L-DPNMNSNSDDL---FKSGDKLASNDKDN---
A0A2E1RQR9      -SDNQYQY---YTSYY--TYYAPRN--L-DPNMNSNSDDL---FKSGDKLASNDKDN---
A0A2E3ISQ4      -SDNQYQY---YTSYY--TYYAPRN--L-DPNMESDSIGS---TKSESKVASNDQNN---
A0A2D6W6F4      -SDNXYQY---YTSYY--TYYAPRN--L-DPDMESGSIGS---PKAGSKLASNDQNN---
A0A2D8Z5A8      -SDNQYQY---YTSYY--TYYAPRN--L-DPDMESGSIGS---PKPGSKLASNDQNN---
A0A4Q2YKS3      -SDSQYQY---YTSYY--TYYAPAEGQV-GPPVNAET-------APRQQKSGGREND---
A0A6N6P3T8      -SDSQYQY---YTSYY--TYYAPAESQI-GPPALGASPKP---QAASKSQPTAQGND---
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      ASEKSSNGVSTGALDVVRAKLGEAMGPMASLVLRDSIRALGESSESFPEAKLEVLVQHVS
A0A2V5PST3      PQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARNRFPKNRLQELFDRICEEILDDKLK
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      RKS---------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------VNIKQKY-----------------------------------------------
A0A2N9NTX7      ------LDIKPKY-----------------------------------------------
B9XK55          ------TDIKPKY-----------------------------------------------
A0A4P5YMI6      ------AELNQKY-----------------------------------------------
A0A2E6T482      ------GEDKPKY-----------------------------------------------
A0A3C0DQZ7      ------GEDKPKY-----------------------------------------------
A0A1Z9CBK5      ------SDVKPKY-----------------------------------------------
A0A2D6ZI96      ------SDVKPKY-----------------------------------------------
A0A358KGZ3      ------EDVNPKY-----------------------------------------------
A0A2E9ZQX4      ------XDVXPKX-----------------------------------------------
A0A3D5JZU0      ------EDVKPKY-----------------------------------------------
A0A2E6HCR0      ------EDVKPKY-----------------------------------------------
A0A1Z8WN04      ------SDVKPKY-----------------------------------------------
A0A2D7L1N4      ------SDVKPKY-----------------------------------------------
A0A2E2R937      ------SDVKPKY-----------------------------------------------
A0A520QQY4      ------SDVKPKY-----------------------------------------------
A0A2D5MR66      ------GSVKPKY-----------------------------------------------
A0A2E0PDQ1      ------ESVEPKY-----------------------------------------------
A0A2E2ZZP9      ------ESVEPKY-----------------------------------------------
A0A7C4LRK7      -------EIKQKY-----------------------------------------------
A0A2A2RGF2      ------PTIKPKY-----------------------------------------------
A0A2G4I5Y6      ------TSIKPKY-----------------------------------------------
A0A6N6PS97      EVAETTVKIEQKF-----------------------------------------------
A0A3M1I883      TEEAETPELKEKF-----------------------------------------------
A0A1V6JZ45      ------AELKTKY-----------------------------------------------
A0A7C7Z746      AKGETAVNLKTKY-----------------------------------------------
A0A520RRW5      ------LELKNKF-----------------------------------------------
A0A356NPK0      ------LELKNKF-----------------------------------------------
A0A2D7B5P5      ------LELKNKF-----------------------------------------------
A0A3D3XGB5      ------LELKNKF-----------------------------------------------
A0A2V6F8A1      ------LDLKQKY-----------------------------------------------
A0A2V5TNH4      ------LDLKQKY-----------------------------------------------
A0A2V5X5Q6      ------LDLKQKY-----------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------GENEDY------------------------------------------------
A0A2A2YDW8      ------QNDTLY------------------------------------------------
A0A352XLN9      ------QNDTLY------------------------------------------------
A0A3D0YP62      ------NDEDLY------------------------------------------------
A0A3D3DV47      ------NDEDLY------------------------------------------------
A0A2E5XJ49      ------EDEALY------------------------------------------------
A0A2E6SBY8      ------DDGGLY------------------------------------------------
A0A2E5QMS4      ------DDGLSY------------------------------------------------
A0A2E7YXQ3      ------DDGLSY------------------------------------------------
A0A2E3H787      ------DDGLTY------------------------------------------------
A0A2E7AGN1      ------EEGLTY------------------------------------------------
A0A2E7AKY7      ------EKGLTY------------------------------------------------
A0A3D4CU34      ------EEGLTY------------------------------------------------
A0A2E8M146      ------DEGLNY------------------------------------------------
A0A355S8S2      ------DEGLNY------------------------------------------------
A0A2D6DVN8      ------DEGLTY------------------------------------------------
A0A3C1W2R2      ------DEGLTY------------------------------------------------
A0A2E3NAY6      ------DEGLTY------------------------------------------------
A0A2E3II01      ------DEGLTY------------------------------------------------
A0A368B8C5      ------DEGLTY------------------------------------------------
A0A3R7RBB5      ------DEGLTY------------------------------------------------
A0A2A2QX62      ------AKQDLY------------------------------------------------
A0A4Q3BWH6      ------SKQDLY------------------------------------------------
A0A3N5WCF1      ---------ELY------------------------------------------------
A0A4Q3C1K5      ---------ELY------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------PEDNPKV-----------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------AKADEVF-----------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------RKR---------------------------------------------------
A0A4Q1C9S2      ------RRR---------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------SKE---------------------------------------------------
A0A1G3ZT33      ------HG----------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------PA----------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------VPLASTLATSPRRPVGSEKSSFKMNRNS--------------------------
A0A351WE84      ------ASADGKDSLF--------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------DS----------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------PSEEMHV-----------------------------------------------
A0A351MR11      ------PKKDPVV-----------------------------------------------
A0A6G6K641      -------GERKVYGSA--------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------QPGDDLY-----------------------------------------------
A0A2E9ISN4      ------TPKNKRWKFR--------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------TSYQDAF-----------------------------------------------
A0A139TS01      ------NDNEDLY-----------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------EELQTKS-----------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------EDEKPKY-----------------------------------------------
A0A2E7SSH2      ------DDVKPKY-----------------------------------------------
A0A349GXM8      ------LMPM--------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------PQETKTS-----------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------TPQSGEY-----------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------EKEG--------------------------------------------------
B3DZK9          ------EEEA--------------------------------------------------
A0A5E6MPC4      ------SQPPS-------------------------------------------------
A0A6N6PKP9      ------DEAVVEYASK--------------------------------------------
A0A6N6Z250      ------PSIEGARWRE--------------------------------------------
A0A4V1SB02      ------QASRAKE-----------------------------------------------
A0A6N6QEJ2      ------AEVKPKY-----------------------------------------------
A0A3C1VB86      ------ARPENLL-----------------------------------------------
A0A146G2Q9      ------KDQEDTY-----------------------------------------------
A0A2T6D3Y2      ------KDQEDTY-----------------------------------------------
A0A6N6P5E3      ------AGSTGDY-----------------------------------------------
A0A2D5VY59      ------VELKNKF-----------------------------------------------
A0A2D8UZZ4      ------VELKNKF-----------------------------------------------
A0A353DV86      ------VELKNKF-----------------------------------------------
A0A2E5EPT8      ------PDLKSKY-----------------------------------------------
A0A6J4HTK1      ------QSDSEEY-----------------------------------------------
A0A6N6PHJ5      -------EIKQKY-----------------------------------------------
A0A6M1RXR2      ------TEIKPKY-----------------------------------------------
A0A7C3DXS4      ------VEIKSKY-----------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------RA----------------------------------------------------
A0A1V6DME1      ------VEIKKKY-----------------------------------------------
A0A3D3DIJ3      ------LDIKQKY-----------------------------------------------
A0A6I1K583      ------PTIKPKY-----------------------------------------------
A0A350EWA4      ------RLDLKKY-----------------------------------------------
A0A5B5WZ91      ------SDNEDLY-----------------------------------------------
A0A2N8HD92      ------HDSEDLY-----------------------------------------------
A0A2N8HIT2      ------HDSEDLY-----------------------------------------------
A0A354EBD3      ------HDSEDLY-----------------------------------------------
A0A355VEB2      ------HDSEDLY-----------------------------------------------
A0A2N8IMT3      ------HDSEDLY-----------------------------------------------
R6K1U5          ------HDSEDLY-----------------------------------------------
A0A2N8IWC2      ------HDSEDLY-----------------------------------------------
A0A2N8I441      ------HDSEDLY-----------------------------------------------
A0A2N8I3A6      ------HDSEDLY-----------------------------------------------
A0A410SCC4      ------HDSEDLY-----------------------------------------------
A0A3R5VEW0      ------HDSEDLY-----------------------------------------------
A0A411SSG2      ------HDSEDLY-----------------------------------------------
B2UKW3          ------HDSEDLY-----------------------------------------------
A0A7C3HWX0      ------AKK---------------------------------------------------
A0A7C4KPD7      ------VEIKQKY-----------------------------------------------
A0A1M6RLZ4      ------SNSADLY-----------------------------------------------
A0A354T7G8      ------PEGEDVF-----------------------------------------------
A0A2S7U4L6      ------PKTNDLY-----------------------------------------------
A0A512MBZ2      ------APQGDLF-----------------------------------------------
A0A2E8MEZ0      ------SSSEDLY-----------------------------------------------
A0A6B3LBV6      ------KLGDDVY-----------------------------------------------
A0A2E3EC33      ------ISIEDKF-----------------------------------------------
A0A2E4GN01      ------ISAEDKY-----------------------------------------------
A0A1Z8XU55      ------LTAEDKF-----------------------------------------------
A0A2E1RQR9      ------LTAEDKF-----------------------------------------------
A0A2E3ISQ4      ------LSAEDKF-----------------------------------------------
A0A2D6W6F4      ------LSAEDKF-----------------------------------------------
A0A2D8Z5A8      ------LSAEDKF-----------------------------------------------
A0A4Q2YKS3      ---------SELY-----------------------------------------------
A0A6N6P3T8      ---------TELY-----------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      QEILDDYQRQRFEEETLKEIKKTTEQHGAAQPDGPVKADSAISKKKPNGTAVDNPSLTSE
A0A2V5PST3      NDFQQSMQEELRVL----------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      PAAIQEPRDGADGATASGAASISEKTSEALPHRPSKNPAAIPKPATKKTMNKESREELSP
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      EFLKLVIVRLTQAMGPIAPLVLREHISALGETLESFPQARLEELVQRLCKEIVTDSFRQQ
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A7C5LI63      ------------------------------------------------------------
A0A7C5P291      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A4P5YMI6      ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A520QQY4      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A7C4LRK7      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A6N6PS97      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A7C7Z746      ------------------------------------------------------------
A0A520RRW5      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A4P5QM05      ------------------------------------------------------------
A0A4Q3C001      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A6B3L938      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A5R8KA81      ------------------------------------------------------------
A0A5B5WU87      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A6N2TNT9      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A522ULD9      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A6N6Q6V0      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A520RGV5      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A4Q3BWH6      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A4Q3C1K5      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A6N6PCD8      ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A6N6PAZ1      ------------------------------------------------------------
A0A6I1K459      ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A6N2U9Y7      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A4Q1C9S2      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A4V0XS84      ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
A0A6N4WTJ5      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A4Y8P964      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A6N6ZHN8      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A6G6K641      ------------------------------------------------------------
A0A5B5WI95      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A4Q5IH27      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A7C4KLL2      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
A0A5R8KKM9      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A7C3I5X9      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
A0A4P5YP61      ------------------------------------------------------------
A0A6B2LYM4      ------------------------------------------------------------
A0A6D1VXB3      ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A4R7S1J2      ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A651H7X9      ------------------------------------------------------------
A0A4Y8P842      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A5E6MPC4      ------------------------------------------------------------
A0A6N6PKP9      ------------------------------------------------------------
A0A6N6Z250      ------------------------------------------------------------
A0A4V1SB02      ------------------------------------------------------------
A0A6N6QEJ2      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A6N6P5E3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A6J4HTK1      ------------------------------------------------------------
A0A6N6PHJ5      ------------------------------------------------------------
A0A6M1RXR2      ------------------------------------------------------------
A0A7C3DXS4      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A6I1K583      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A5B5WZ91      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A7C3HWX0      ------------------------------------------------------------
A0A7C4KPD7      ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A512MBZ2      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A6B3LBV6      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
A0A4Q2YKS3      ------------------------------------------------------------
A0A6N6P3T8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------
A0A2V5UHJ2      FEEEMAKLTSDV
A0A2V5PST3      ------------
A0A2V5PXM3      ------------
A0A1V5QB01      ------------
A0A7C5LI63      ------------
A0A7C5P291      ------------
A0A139SU05      ------------
A0A139SPN4      ------------
A0A1V6E7N1      ------------
A0A2D9MYT1      ------------
A0A258ANJ7      ------------
A0A290QGD9      ------------
A0A1D8AS58      ------------
I6AQC1          ------------
W0ITH7          ------------
A0A139TLN4      ------------
A0A1G3ZFT0      ------------
A0A1Z8ZMT6      ------------
A0A2E8MCT7      ------------
A0A290Q2Z2      ------------
A0A2A2RGK2      ------------
A0A2A2XXF7      ------------
A0A2A2R5D6      ------------
A0A1J4XH17      ------------
A0A3C1VJ32      ------------
A0A2N9NTX7      ------------
B9XK55          ------------
A0A4P5YMI6      ------------
A0A2E6T482      ------------
A0A3C0DQZ7      ------------
A0A1Z9CBK5      ------------
A0A2D6ZI96      ------------
A0A358KGZ3      ------------
A0A2E9ZQX4      ------------
A0A3D5JZU0      ------------
A0A2E6HCR0      ------------
A0A1Z8WN04      ------------
A0A2D7L1N4      ------------
A0A2E2R937      ------------
A0A520QQY4      ------------
A0A2D5MR66      ------------
A0A2E0PDQ1      ------------
A0A2E2ZZP9      ------------
A0A7C4LRK7      ------------
A0A2A2RGF2      ------------
A0A2G4I5Y6      ------------
A0A6N6PS97      ------------
A0A3M1I883      ------------
A0A1V6JZ45      ------------
A0A7C7Z746      ------------
A0A520RRW5      ------------
A0A356NPK0      ------------
A0A2D7B5P5      ------------
A0A3D3XGB5      ------------
A0A2V6F8A1      ------------
A0A2V5TNH4      ------------
A0A2V5X5Q6      ------------
A0A4P5QM05      ------------
A0A4Q3C001      ------------
B4DB23          ------------
A0A6B3L938      ------------
A0A2V5URB2      ------------
A0A2V2DJ66      ------------
R7L5A9          ------------
A0A5R8KA81      ------------
A0A5B5WU87      ------------
R7DZW0          ------------
A0A2N8HID1      ------------
A0A2N8HS06      ------------
A0A6N2TNT9      ------------
A0A3R5R2M8      ------------
A0A411SUQ6      ------------
A0A2N8HZF2      ------------
A0A354E720      ------------
B2UPB6          ------------
A0A2V6JLK8      ------------
A0A2W5Z1A5      ------------
A0A2V6EA09      ------------
A0A2V6GQI7      ------------
A0A3C1HEJ2      ------------
A0A522ULD9      ------------
A0A1V6JU76      ------------
A0A2A2XXW5      ------------
A0A6N6Q6V0      ------------
A0A1Q6UHJ9      ------------
A0A2V2BXR0      ------------
A0A2D8V0G3      ------------
A0A348S017      ------------
A0A3C1UUV7      ------------
A0A350I3V2      ------------
A0A520RGV5      ------------
A0A3D3XF90      ------------
A0A2D7B522      ------------
A0A356NIC2      ------------
A0A2N8HDG3      ------------
A0A146GCJ0      ------------
A0A2T6D6H8      ------------
A0A3D1TI55      ------------
A0A3E1ET42      ------------
A0A2A2YDW8      ------------
A0A352XLN9      ------------
A0A3D0YP62      ------------
A0A3D3DV47      ------------
A0A2E5XJ49      ------------
A0A2E6SBY8      ------------
A0A2E5QMS4      ------------
A0A2E7YXQ3      ------------
A0A2E3H787      ------------
A0A2E7AGN1      ------------
A0A2E7AKY7      ------------
A0A3D4CU34      ------------
A0A2E8M146      ------------
A0A355S8S2      ------------
A0A2D6DVN8      ------------
A0A3C1W2R2      ------------
A0A2E3NAY6      ------------
A0A2E3II01      ------------
A0A368B8C5      ------------
A0A3R7RBB5      ------------
A0A2A2QX62      ------------
A0A4Q3BWH6      ------------
A0A3N5WCF1      ------------
A0A4Q3C1K5      ------------
A0A3R8IT45      ------------
A0A2A2PYE8      ------------
A0A2T6CN73      ------------
A0A2G4G428      ------------
A0A6N6PCD8      ------------
A0A139TV24      ------------
A0A2N8HT11      ------------
R7DS70          ------------
A0A2N8HNL6      ------------
A0A6N6PAZ1      ------------
A0A6I1K459      ------------
A0A139TUL1      ------------
A0A2N8HCB0      ------------
A0A2N8HP04      ------------
A0A2N8HRJ0      ------------
A0A6N2U9Y7      ------------
A0A366HAG0      ------------
A0A2U8DZK4      ------------
A0A2T6DFL8      ------------
A0A1D8AWD4      ------------
A0A4Q1C9S2      ------------
A0A178IH18      ------------
A0A2T6DT99      ------------
A0A1G3ZT33      ------------
A0A3E1E2T2      ------------
B1ZMW1          ------------
A0A3M1I8A3      ------------
A0A4V0XS84      ------------
A0A351WE84      ------------
D5ENH7          ------------
A0A0R2XQ77      ------------
A0A2E9IN28      ------------
A0A6N4WTJ5      ------------
A0A1V5QDZ6      ------------
A0A4Y8P964      ------------
A0A3D4HF88      ------------
A0A6N6ZHN8      ------------
A0A351MR11      ------------
A0A6G6K641      ------------
A0A5B5WI95      ------------
A0A2N8I9W1      ------------
A0A4Q5IH27      ------------
A0A2N8IBZ6      ------------
A0A2N8IJW9      ------------
R6J100          ------------
A0A1V6J089      ------------
A0A3C1BZR1      ------------
A0A7C4KLL2      ------------
A0A1H6KPB7      ------------
A0A2E9ISN4      ------------
B9XAX1          ------------
A0A5R8KKM9      ------------
A0A139TS01      ------------
A0A3E1EJT7      ------------
A0A317ZP96      ------------
A0A7C3I5X9      ------------
A0A2D5WGA5      ------------
A0A2E7SSH2      ------------
A0A349GXM8      ------------
A0A4P5YP61      ------------
A0A6B2LYM4      ------------
A0A6D1VXB3      ------------
I0JYY7          ------------
A0A4R7S1J2      ------------
A0A2A2XV69      ------------
A0A651H7X9      ------------
A0A4Y8P842      ------------
B3DZK9          ------------
A0A5E6MPC4      ------------
A0A6N6PKP9      ------------
A0A6N6Z250      ------------
A0A4V1SB02      ------------
A0A6N6QEJ2      ------------
A0A3C1VB86      ------------
A0A146G2Q9      ------------
A0A2T6D3Y2      ------------
A0A6N6P5E3      ------------
A0A2D5VY59      ------------
A0A2D8UZZ4      ------------
A0A353DV86      ------------
A0A2E5EPT8      ------------
A0A6J4HTK1      ------------
A0A6N6PHJ5      ------------
A0A6M1RXR2      ------------
A0A7C3DXS4      ------------
A0A2V2SDV4      ------------
A0A2V5PK75      ------------
A0A1V6DME1      ------------
A0A3D3DIJ3      ------------
A0A6I1K583      ------------
A0A350EWA4      ------------
A0A5B5WZ91      ------------
A0A2N8HD92      ------------
A0A2N8HIT2      ------------
A0A354EBD3      ------------
A0A355VEB2      ------------
A0A2N8IMT3      ------------
R6K1U5          ------------
A0A2N8IWC2      ------------
A0A2N8I441      ------------
A0A2N8I3A6      ------------
A0A410SCC4      ------------
A0A3R5VEW0      ------------
A0A411SSG2      ------------
B2UKW3          ------------
A0A7C3HWX0      ------------
A0A7C4KPD7      ------------
A0A1M6RLZ4      ------------
A0A354T7G8      ------------
A0A2S7U4L6      ------------
A0A512MBZ2      ------------
A0A2E8MEZ0      ------------
A0A6B3LBV6      ------------
A0A2E3EC33      ------------
A0A2E4GN01      ------------
A0A1Z8XU55      ------------
A0A2E1RQR9      ------------
A0A2E3ISQ4      ------------
A0A2D6W6F4      ------------
A0A2D8Z5A8      ------------
A0A4Q2YKS3      ------------
A0A6N6P3T8      ------------
                            

© 1998-2021Legal notice