BYKdb

Dataset for cluster orphancd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

184 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      MDIDPFADDDKEYRSTGAEEPVVS------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A1T4WWY4      MNSKTQPSGKDSKLD---------------------------------------------
A0A3D3LEQ6      MNPRQSSNSQKGKLD---------------------------------------------
A0A3D3NW23      MNPRQSSKSQKGKLD---------------------------------------------
A0A2E0R252      MNEVDPPQNGYGNEAPASN-----------------------------------------
A0A3E1EF48      -----------------MA-----------------------------------------
A0A2A2PVG8      ---MSRSYAPDSDANETGQ-----------------------------------------
A0A2E0R421      -MIDHHQQPLEENLHSNPQ-----------------------------------------
A0A2E5EJ69      MDFPESHDLGQQTQVEK-------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      MSKPVQAQTRSTAHRSAARVPDQAQAGGNLA-----------------------------
A0A290QD69      MSKSTKS---SSGKRGSSEQPQTKPAGGG-------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      MAETFSKKPVPAAGAWPPQSSSPFGEPPPFAGGSLP------------------------
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      MTHSNLPVPASEYPLAGPMDQDANLLP---------------------------------
A0A3C1VFY9      --------MKEDSALTAPDRHAWGRKF---------------------------------
A0A522AC27      --------MNEPTPTPTHDRSSWAARF---------------------------------
A0A2A2R174      MDQYSQTQVGDTSSDHG-------------------------------------------
A0A1H2DTI1      MEPIPPSAPGTPGGFPPPQAPSSPMTAAMSQAGGRVPGTF--------------------
A0A1V5L462      MQDDFLESSGREGGHTDLGETL--------------------------------------
A0A2A2R3V9      ----MSSITPPPTLSSWSAAF---------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      MILSVWRSESLPSDPNNFSSSYDLDESSGSLDWGERL-----------------------
B5JIS2          MAHSETKKSLRPHASAGYGASGSRNSNTEDTLAGV-------------------------
A0A1H2GQN6      ------------------------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ----------MSLPTSQLPAGTSAINRV--------------------------------
A0A4P5YK43      ---MASSHASLELPPPNQGTSLVDRINI--------------------------------
A0A2A2RPW6      MQTTEDVTQQSPIGGLS-------------------------------------------
B4D1I7          MDAHPAATPARDQDAASWWYLI--------------------------------------
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ------------------------------------------------------------
A0A3B9GA54      ------------------------------------------------------------
A0A520LEH8      ------------------------------------------------------------
A0A2D7B7R6      ------------------------------------------------------------
B1ZT68          MPTSKKPAADRRNP--QANTGF--------------------------------------
W0J7C2          MTTTDTTAGNRPSPGRPRAASI--------------------------------------
A0A2E5K4P7      --------MDSEPPEDSSNSSYRGYRYY--------------------------------
A0A0R2XPB1      MDDLFQDENNTKTVDYTELF----------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      MDDLFQDEQNTKTVDYTELF----------------------------------------
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6EBU2      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6EY06      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6ME53      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A538NUU0      ----MNAPLERPGAAPWSTAF---------------------------------------
A0A2V6NIJ1      ----MNPPPVRPAAAPWSTAF---------------------------------------
A0A2V6C292      ----MNPPPERPAAAPWSTAF---------------------------------------
A0A2V6D2X0      ----MNPPPERPAAAPWSTAF---------------------------------------
A0A2V5ZUK1      --MQVAATRLQNLSTSWSAAF---------------------------------------
A0A2V5XFN9      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A2V6EZC8      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A2V6I7Z5      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A3B9LCP2      ---MQASAAERSTPASWSTAF---------------------------------------
A0A3C0R669      ---MQASAAERSTPASWSTAF---------------------------------------
A0A2V6EID2      -MQAPIPAVERSTPAAWSNTL---------------------------------------
A0A2V6MHB0      -MQAPIPAVERSTPAAWSNTL---------------------------------------
A0A2W5YWL9      ----MNALAERTNPGSWSTAF---------------------------------------
A0A2V5NH62      MPAPAPATTDRPVSAPWSTAF---------------------------------------
A0A2W6A620      --MPAPAATDRPASAPWSTAF---------------------------------------
A0A2V5PIJ4      ---MGNAAPDHPVSPIWTTKF---------------------------------------
A0A2V6K2G8      ---MQPSTAVKNLSTSWSAAF---------------------------------------
A0A2V5W206      ---MQATTAGKNLSTSWSTVF---------------------------------------
A0A2V6MW77      ---MQVATVGKNLSTSWSAAF---------------------------------------
A0A2G4GZN8      MPTPDPSSDNRPPEPSREGNPGYGSYGQGYGQGYGQGYGQGYGAYGAGNY-------RGG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      ------MKNDYS-DNNMGNDNSYGNYGNYAPGN---QY-NQYNSYRYGGGGNYGNYGNYG
A0A2D7F4D9      ------MKNDYTGDQSNMNSNHYGGYSNNYGNP---QY-YNHGSYRYGGN------SGSG
A0A3R7RBR8      ------MKNDYTGDQSNMNSNHYGGYSNNYGNP---QY-YNHGSYRYGGN------SGSG
A0A2E0NH28      ------MKNDYVRGGPDPNTS-----------G---RYGYSSGNYGYNGS----------
A0A350AS32      ------MKNDYVRGAPDPNSGGYG--------G---GYGYG-GGYGYG-G----------
A0A368BGT4      ------MKNDYVRGAPDPNSGGYGSGGYGYGSG---GYGYGNGGYGYGNG----------
A0A2E0V4K6      MSARRLAGAGRELPDEDEVLEFPGR-----------------------------------
A0A2E6NAH3      -------MKNDYIRGAPDPNSGGYGGSGYGYGG------------GNYGYGGSNYGYGGG
A0A2A5VZA5      -------MKNDYIKGGGDPNSGGYG-YGYGYSG------------GS--------GYSYG
A0A424R295      -------MKNDYIKGGGDPNSGGYG-YGYGYSG------------GS--------GYSYG
B4CZV9          -----MIPGTKKPAFT--------------------------------------------
A0A290QE54      -------MSDSPLNPSNASQSG-------DQLV------------E--------------
A0A1H1SWX2      -----MSAPDAPLPTAPARAPGPSLHGNDQQVV------------E--------------
A0A4Q1C9I5      -----MSSPDFS-PHSASVKHGASLHGNEPHVS------------E--------------
A0A3B9FM17      ------------------------------------------------------------
A0A1G3ZL71      -----MPSPLAIPAAPAKPSASTRAPQGGEEHL------------VE-------------
A0A556QP09      ------MSSVQKPSSATKVSGR-------DEEI------------IE-------------
A0A2T6DX88      -----MNDLQAKHP--SLHTAQ-------GEVL------------NE-------------
A0A2T6CWI7      -----MADANAKPPPPPPVDHD-------DETV------------SE-------------
A0A3E1E5C8      -----MPDHTARPF--PPAHDK-------EEPA------------VE-------------
B1ZZ74          -----MSLAEAKPAVQPGGARD-------EETL------------VE-------------
R7E4L8          -----MPVSVIQPEDND-------------------------------------------
A0A4Q3BVY2      -----MSNSSDKPKFD--------------------------------------------
A0A4P6PCA7      -----MFSGNEPPPVYGASHTPPPVDPANPYGA------------AHQPAPFNLKGGG--
A0A0E3YV65      ------------------------------------------------------------
W0J900          -----MAEIPFTKTGPDTGPLHPRPSAPRSEPP------------FEGGSLP--------
A0A2T6DSN5      -----MAKASKTTPSKRNEAQSPTKGFN--------------------------------
A0A2V2SMX4      -----MNQPGAIETVSTTQHQHAWRARF--------------------------------
A0A317ZIW7      --------MSDLFNDDNQAGKVDYAEIL--------------------------------
A0A2D7WMI4      ----------MDENEIGSLSQNPPNQKV--------------------------------
A0A2D6VHX5      ----------MDLEENSNYGDYSPKSKK--------------------------------
A0A2D8I214      --------MEEEIENLNSQGSVRSKSKT--------------------------------
A0A1Z8VL41      --------MDDNFEDIDRPLSTKPKGRI--------------------------------
A0A2E6TNA4      --------MDDNLEDIDRSLSTKPKGRV--------------------------------
A0A1Z8RG47      --------MDDEIDTTEIHSGGRSKSNI--------------------------------
A0A1Z8RJJ5      --------MDDEIDTTEIHSGGRSKSNI--------------------------------
A0A2D7V631      --------MDDDIDSISVNAGGKPKSRI--------------------------------
A0A354RA24      --------MDDDIDSISVNAGGKPKSRI--------------------------------
A0A2E9RV62      -------MDSYSNPDPSQEIIQPASRSR--------------------------------
A0A2E4AY96      --------MDQEHPESFKN---QGDTIK--------------------------------
A0A3B9B9P4      --------MDQEHPESFKN---QGDTIK--------------------------------
A0A2D5Y6N6      --------MDDNFNKMTGDGGASPTGSK--------------------------------
A0A2E7HSS8      --------MEEDFDNFSTP-PQPKGKPK--------------------------------
A0A2D8VCK3      --------MEEDFDNFSSS-PVQKGKSK--------------------------------
A0A350QVY4      --------MEEDFDNFSSP-PVQKGKSK--------------------------------
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      -----MNESLEELDGTSSHVPSGAPGPK--------------------------------
A0A3D4HHL8      -----MTAPPTKSPRYDDVEPKIEWSELI-------------------------------
A0A366HV03      ------------------------------------------------------------
A0A5R8KAF2      ---------MDTTKKKFDFAAAVGNALSYAQHG------------RL-------------
A0A2V2SDN0      -----MENQNHNEPAKANNQLTTPALDLMAPPD------------HF-------------
A0A1V6GL40      ---------MNDQP------VQSFHDRPNTAAR------------LH-------------
A0A2V5X6Z6      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A2V5VGZ7      -----MNDNNHNQPNTPAVDLFAPANRFVSASR------------LY-------------
A0A2V5U130      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A2V6C237      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A3R8L982      --------MPDTTNNRPPPSAKLH------------------------------------
A0A2E7HPU9      -----MRRKKYYEHDEELDLLDEEDGLG-------------------------------G
A0A388PR45      ------MDTPSPKPGQPPEDPSRG-PRGYGSYG------------SY----GGY-----A
A0A388QR61      ------MDAPAPKPGQPQDDAQRG-PRGYGSYG------------NY----GNYGGPA-G
A0A4P5YHI0      ------MDAPAPKPGQPQDDAQRG-PRGYGSYG------------NY----GNYGGPA-G
A0A2A2RS01      -----MAEKTQKPEDDQDDSAARG--RGYGSYG------------NYGNYGGNYGGNYGG
A0A2A2Y1A7      -----MAEKTQKPEDDQDDSAARG--RGYGSYG------------NYGNYGGNYGGNYGG
A0A388PDH9      -----MAETPQKPEDNQDDSASRA--RGYGSYG------------NY----GNYGGAYGG
A0A2G4H1E7      ------MANPEPSSDNRPPEPARGGNRGYGSYG------------SY----GQYGQGY-G
A0A2G4GZA6      ------MPNPDPLSDNRPPEPARGGNRGYGSYG------------SY----GNYGAAN-G
A0A388P514      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
A0A2A2YG59      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
A0A2G4F7D5      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
D5EML0          --------------------------------M------------GK----DDFTIEANA
A0A3C1C1M3      -----MTQPNFPPSNLPPASGQPPGAPIYYGGG------------DP----YSGGMPMDS
A0A2E9EYJ1      ---------------------------------------------------------MAK
A0A258AXR6      --------------------------------------------------------MNES
A0A3D3NZQ6      --------------------------------------------------------MSEA
A0A1T4WVZ9      --------------------------------------------------------MRET
A0A4R7SSI6      --------------------------------------------------------MRDT
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ----------------------NRIGISNVRQALSRWWIMLIFGVLGYFAALYYM-SINP
A0A5E6MKA7      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A1T4WWY4      ----------------------GSSIIRTVLAYEDYWRLMIILVLIGLLGGTCYF-IYAR
A0A3D3LEQ6      ----------------------SSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYAR
A0A3D3NW23      ----------------------SSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYAR
A0A2E0R252      ----------------------GKGIKDYVRWFLRRFWIFLITCLGGYFLGLYVA-SLTP
A0A3E1EF48      ----------------------TKTFADYLNWLKRYAWIAVLTTITGTFYGFYLF-TITP
A0A2A2PVG8      ----------------------SRGLQDYLRWFLRRFWIFLIAVVGGYFLGLYLY-SVTP
A0A2E0R421      ----------------------ARGLQDYVRWFIHRFWILPITIVSGILIGHYVY-THTP
A0A2E5EJ69      ----------------------EFSLRDSVDVVLDHAWLIILIFAACFGGAYYYL-KTAT
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------MLLRKYWWVVAFGVALGTGIAAWLV-ASQK
A0A2E7ALI1      --------------------PPASYLPDWITGFLNRG-----------------------
A0A178IDB9      ----------------------HFSPRNLLNMFLERWWIGLIAGAAIATVFILAQ-PKLA
A0A290QD69      -----------------------FSPKSLLNMFLERWWIGLIVAAAVAAAFVLSQ-PKPE
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      ----------------------RLDIRQILLCIRERWIVAVSLAILVCVLLGVWL-LNQP
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      ----------------------SFRIQRFFTFLLKYWWVPVLTLALSLGGAIWYF-FWEP
A0A3C1VFY9      ----------------------FSRVQRYRNLLLRRWWVLVVCLVLALGIEAVHI-QFTP
A0A522AC27      ----------------------HSRVYRYKRLLKQRWWIPFSCVFIALVIQGALS-WFAP
A0A2A2R174      ----------------------MSLNRELWQVLVEKAWLIACIMAAAAAIGVWVG-VRSP
A0A1H2DTI1      ----------------------MSRLHRYKLLVKKFWWILLFCTAVGIAIQAYKI-AHEV
A0A1V5L462      ----------------------RSLSHRARLLLQSYWWILLLCLSIGLLVQAVRV-KSMR
A0A2A2R3V9      ----------------------FTKLHRYRALVKRRWYVPLLTLSVGLCIQAYRF-AQIQ
A0A3D3LGD3      --------------------MKIERLQDKVQVF-----------------------ERSS
A0A350ARX4      ----------------------QRIYFESKRLLAIWWWIVLLAVAIGIGWQAYRE-LNRE
B5JIS2          ----------------------VTQIRSFFAIIRSRWLSGVVSALVVGSAFAYLF-LNDK
A0A1H2GQN6      --------------MSVSESIDLPHFNDYWRVIRARFGIILTLFILTFGTGYFVSAFVLQ
A0A512M3Y3      ------------MQKGKKLIITFQDVFLFLTRFVKHWKIASLLFSLGLAASLLYY-TYGR
A0A4P5R5J1      ----------------------RVQGIRYVYLLKKRWWVLVLLLSLGLCIGAWTA-MQQP
A0A4P5YK43      ----------------------SIHFRRYFKIISRRWWIPFLLVLVGTGIALYVA-LTTP
A0A2A2RPW6      ----------------------SVALRDFWQALLDKAWLVVCIMLAAAALGVWHG-ARSP
B4D1I7          ----------------------HTKIYRYRALLRKYWWMVLFTTCAGMAIGAWML-AHQQ
A0A353F286      ---------------------------------------------------------MIP
A0A354FSA6      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A3B9GA54      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A520LEH8      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A2D7B7R6      -----------------METGNTNSPQDILRSAKSHYAIVLIIIVACTFTAYMQT-RKMT
B1ZT68          ----------------------RITPRDLLQMFQERWLLGLFLGAIAAGVFVYFQ-PEKV
W0J7C2          ----------------------RRTPRDFLDMFAERWWIGALAGAAAAALIVVFR-PHFE
A0A2E5K4P7      ------GGYGYNYGGYDAEPQEHRSLKDYIIIFRERFWLFLFCFAIIITGVLLYT-LKKP
A0A0R2XPB1      ----------------------QQIVYRAKIVLRRYWWVIPLAITLGVSYKAVES-FVAD
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ----------------------QQIVYRAKIVLRRYWWIIPLAIALGVTYKAVES-FVAD
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6EBU2      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6EY06      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6ME53      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A538NUU0      ----------------------FTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6NIJ1      ----------------------FTRLYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6C292      ----------------------FTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6D2X0      ----------------------FTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V5ZUK1      ----------------------ITRLHRYKSLLLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V5XFN9      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V6EZC8      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V6I7Z5      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A3B9LCP2      ----------------------ITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTP
A0A3C0R669      ----------------------ITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTP
A0A2V6EID2      ----------------------ITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMP
A0A2V6MHB0      ----------------------ITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMP
A0A2W5YWL9      ----------------------ITRIHRYKSLLKRRWWIPLLTICLGLFVQSWLI-FQTP
A0A2V5NH62      ----------------------ITRLHRYKALLQRRWWIPVLTICLGLFVQAWFI-YQTP
A0A2W6A620      ----------------------ITRLHRYKSLLQRRWWIPVLTICLGLFVQSWLS-YQTP
A0A2V5PIJ4      ----------------------VTRFHRYRALLLRRWWILLLTVCMGLFVQAWMV-YQRA
A0A2V6K2G8      ----------------------VTRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V5W206      ----------------------ITRLHRYKSLFLRRWWIPVLTTCLGLFVEAFLI-YQMP
A0A2V6MW77      ----------------------ITRLHRYKALFLRRWWIPVLTTCLGLFVEAFLI-YQMP
A0A2G4GZN8      NYGGGNYGYGNNPGYGKGGAGESNPIQNYLLMLKERYWWILLASLVFLTLSLLNT-YNVV
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      NYGY--GSYGQNADEQG----PQRTFKDYLFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A2D7F4D9      SYGY--GSYGNVSEEQG----PQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A3R7RBR8      SYGY--GSYGNVSEEQG----PQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A2E0NH28      NYGY--GSYGSNSSGYG--TIAQRSISDYFLMLRERVWYLVVAFFIIFSGSILYT-FNKT
A0A350AS32      GYGYG-GGYGAGGGYEGGSSAPQRSFKDYLLMFRERVWYLIVAFFIIFSGSILYT-FNKT
A0A368BGT4      GYGYGTGGYGGYGGGYGGGAGPQRSFKDYFLIFRERIWYLLVSFFIIFSGTIMYT-FNKT
A0A2E0V4K6      ----------------------ARGLPKVFWEMLGKWYFPVMGAILGLFASAYYL-KKTP
A0A2E6NAH3      NYGFGGGYGDGGAGP-------QRSFKDYLLMFRERIWYLIVSLFIIFSGSILYT-FNKT
A0A2A5VZA5      NYGYGGYGGGGEQAP-------QRSIKDYILIFRERIWWLIVSFFIIFSGSLLYT-FNKT
A0A424R295      NYGYGGYGGGGEQAP-------QRSIKDYILIFRERIWWLIVSFFIIFSGXLLYT-FNKT
B4CZV9          ----------------------LHDIFLYVAIASKHARLMVLLICFALTAGLTYY-VFAK
A0A290QE54      ----------------------RRTIRDYLIILRERLWIALPLALLVAVGFGYWK-ARAV
A0A1H1SWX2      ----------------------KRSLRDYYVILRERLWIALPVALLVALSIGYYQ-AQEI
A0A4Q1C9I5      ----------------------RRTLRDYYIMLRERLWIALPVAVIVALGFGYVK-STET
A0A3B9FM17      ------------------------------------------------------------
A0A1G3ZL71      ----------------------RRTLRDYYVIIRERLWIALPLALLVSLGLGYWK-MRET
A0A556QP09      ----------------------RRTLRDYYIILRERLWIALPLALVISIGMAYYQ-SRAT
A0A2T6DX88      ----------------------RRTARDYLIILRERVWIALPIGILVGVILGYLQ-ARVT
A0A2T6CWI7      ----------------------RRTLRDYYIMLRERLWIALPLALLVAVGYAYKN-LQET
A0A3E1E5C8      ----------------------RRSLRDYYIILREKLWIALPLALLVSLSLGYYE-ASRP
B1ZZ74          ----------------------RRGLRDYYIILRERLWIALPLALLVAVPLGYFR-ARET
R7E4L8          ----------------------IFSFRFIFSTARRYWPWILACALLGGGLAYFIC-ARQG
A0A4Q3BVY2      ----------------------PLRLISQVLSYAKHVRLMLLMLAVGVMAGIIVY-LFTT
A0A4P6PCA7      ----------------------GFKPMRLLFVVLRRWYIPVIFGLIGIAVGILRA-LYAV
A0A0E3YV65      -----------------------MSPREILLSIRERALTSFVLALLICSLLGGWL-LSRP
W0J900          ----------------------RLDIRQILLCIRERWIVSTSLATLVCVLLGVWL-LKQP
A0A2T6DSN5      -----------------------FSPRSLLNMFLERWWIGLIAGALGAVAFVLAQ-PKQD
A0A2V2SMX4      ----------------------FTRLQRLRGLLLAKWWIPALGVALGVGIQASRS-ITEK
A0A317ZIW7      ----------------------HKSIYRTKIVLKRFWWVLPVAVSLGVAYKAIES-FLEA
A0A2D7WMI4      -----------------------KGISDFLLILRDRWMLSLTLALPIALGFTYKS-LQVP
A0A2D6VHX5      ----------------------NKTVSEFLLILRDRWLLAVTLALPFSLAYVYKE-LQVP
A0A2D8I214      -----------------------KSIAEILLVIRDRWLLALSLALPISLGYVYLK-FQDT
A0A1Z8VL41      -----------------------RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVP
A0A2E6TNA4      -----------------------RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVP
A0A1Z8RG47      -----------------------KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSP
A0A1Z8RJJ5      -----------------------KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSP
A0A2D7V631      -----------------------KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGP
A0A354RA24      -----------------------KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGP
A0A2E9RV62      ----------------------LRGVFDYFLIIRDRWLLATALSLPIALGFVYKE-YQQP
A0A2E4AY96      ----------------------VRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVP
A0A3B9B9P4      ----------------------VRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVP
A0A2D5Y6N6      ----------------------IKGIGDFILILRDRWLIALTLSLPXALAYIYVK-SQGI
A0A2E7HSS8      ----------------------IKGVSDFLLIIRDRWLLSLALSLPFALGFVFVK-QQVH
A0A2D8VCK3      ----------------------IKGLSDFLLIVRDRWLLAIALSLPCALLWVFYK-QQEP
A0A350QVY4      ----------------------IKGLSDFLLIIRDRWLLAIALSLPCALFWVFYK-QQEP
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ----------------------LKGVIEYLLIIRDRWLLAIALSLPISLWYVYDR-YQEP
A0A3D4HHL8      ----------------------HVWLFRAKLLLKRFWWVFLITISLGVAFQTYDV-LITP
A0A366HV03      ------------MSAPIKKGAPGVDMLHYAVGYLKYGRMMILLLLLGVLAGVCYY-TYSP
A0A5R8KAF2      ---------------------------------------MVIMACLGVLAGLCYF-VYTT
A0A2V2SDN0      ----------------VATSRLFVRLHRHQVLLREYWWVLALILLVTVVPALVIT-LATP
A0A1V6GL40      -----------------------ARLSRFRNLLREKWWVLVLGAMAGAIIKIVLL-WNAP
A0A2V5X6Z6      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSL
A0A2V5VGZ7      -----------------------GRLHRWWLLLRRYWWLIVLILVLGLGPAGFLS-FNSP
A0A2V5U130      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGVLS-FNSL
A0A2V6C237      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSL
A0A3R8L982      --------------SGDDDLVERRTLRDYYIIVRERLWIALPLALLAALGYAYYK-SREL
A0A2E7HPU9      GTSR------------------RARTRQLIGDILVRWHWMALGLVLGLLGSFYYL-SKAP
A0A388PR45      GYGAPGYGNYGNYAAGGASGGKGGPFTVYLAMLRERWWWVLLSVLVFVTIAVVYT-STII
A0A388QR61      GYGAGGYGAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIV
A0A4P5YHI0      GYGAGGYGAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIV
A0A2A2RS01      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTM
A0A2A2Y1A7      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTM
A0A388PDH9      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLLGVTIALVLT-YQTM
A0A2G4H1E7      AYGA-GYGSYGGGPRGGAGG--ASPISNYLLMLRERYWWVLLTSLVFLTLSLLNT-YNTV
A0A2G4GZA6      GYGY-GNGNYGAYNRGGAGE--GNPIQNYLLMLRERYWWILLSTLVFLTLSLLNT-YNTV
A0A388P514      GYGY---GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
A0A2A2YG59      GYGY---GNYGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
A0A2G4F7D5      GYGY---GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
D5EML0          STTS------------------VFGLTDLLAVVRKHWMSGAFIGLVVAGLFVASV-LTKE
A0A3C1C1M3      GPLQ------------------SLNPMRLLQIARNHWVILLLA--ILFAGGAAAF-YLSR
A0A2E9EYJ1      QSET------------------KLHALDYWQVAXNRYAVILLTXALVXMTALVIA-YLRP
A0A258AXR6      GTEL------------------QKHAMDTWQVVKNRFGLIALSFLLIFAAAAVLT-YIMP
A0A3D3NZQ6      SPDL------------------QNHALDSWRVIRGRAGLIILSFLLVFGSAAMLT-YIMP
A0A1T4WVZ9      SNEL------------------QQQALDSWQVIRNRFGLIILSFLLVFATAAIIT-YIMP
A0A4R7SSI6      GNEL------------------QQQAIDSWQVIRNRFGLIILSFLLVFATAAIIT-YIMP
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      PSSEAIAVLEVNIQTGQ-----------LLGQDLVQERMTPDIILATEASKLMGPAILSA
A0A5E6MKA7      ------------------------------------------------------------
A0A2N8IR72      ----------------------------------------MTDAWNGKAVIVRHSPVLET
A0A2N8IV96      ---------------------------------MVATSNVTANYIPMQYSVLTSAEVLKV
R7E1V8          ---------------------------------MVASSNVTANYIPMQYSVLTSTEVLKV
A0A1T4WWY4      ATYESQALIRANSFLMS-----------SEAAVGNANADRTYRQMRALMDQLNSGYVILE
A0A3D3LEQ6      ATFESTALIRINQFVDA-----------AKAASG-AQRDNNIALMRSLSKQLTSDFYQLE
A0A3D3NW23      ATFESTALIRINQFVDA-----------AKAASG-AQRDNNIALMRSLSKQLTSDFYQLE
A0A2E0R252      VTYQSQATIEIERVKKED----------ADVDEEERIRMGGASEMFSVTEKLRLPNLYTN
A0A3E1EF48      KTYQSWTSIQIARVKQEA----------ADVAEEERIRLGVPAELQATLEKLRMPRIYQN
A0A2A2PVG8      PTYQSSATIEILRVKRDA----------ADIAEEEKIRMTGAAEMLSASERIRLPQIYVE
A0A2E0R421      HTYQSSATIEVLRIKKDD----------ADVDEDEVLRMNGVAEMMSASEKLRMPALYTQ
A0A2E5EJ69      VIYESRATIIVEFAGPTVS---------YDQNSRNDFRLMRFDILNTMAQTVGRREVIDR
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      QIYMSQARMMVSGK--------------INLPEGGSFSEEMTHFMNTQGELMKDEAIRTR
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      PVYRSEVKLLFEPQKDQV----------IGIKEVVDTTTTSNLQLNLHIEQMLSTTFYEY
A0A290QD69      PIYKTEVKLLFENQKDNV----------IGMAGVVETTTNSGMQLQLHIEQMLSRTFYES
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      KVFQASATLLVDRAEKVLGNEM------TKVVDDSVGGSKNDPSFDTHLAQITSREMVQR
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      PTYVSKSRMWETVT--------------LRLPEGAMFSEDMQNFLGTQSELLESGQLRQL
A0A3C1VFY9      PEFISVGQMIVSIK--------------VNIQQGSLYTEELGNFLGTQAALMQGNEVLNR
A0A522AC27      QRFISIGRMIVSIK--------------LSIQETSVYTEELSNFLGTQQALMQSPVVVQR
A0A2A2R174      VVYQSKAVIELDFGEKKVL---------AIDDFEKRDKGGGVDFLNTIANNVRSSAIIKR
A0A1H2DTI1      PNYASTARLMINTK--------------INVTESSVSTTEVGNYMETQIALMTSQKVYTA
A0A1V5L462      DAWESSAQLIIQGN--------------IEIQEADRLREVATNFHDNQLHLMTGQWVSER
A0A2A2R3V9      PTYISSGKLIVSPR--------------MFLPENAVVSDESVNFIGTQLELMQSAEVRSR
A0A3D3LGD3      DNFMANSDVVVKNE----------------------------------FESIIKPETLYP
A0A350ARX4      PVYVSYAEMMVSG---------------RFALPDNVYREELSNFFGTQITLMLSDRVQKQ
B5JIS2          PEHTAVSTMLAQSPLDELLH--------SDQQARERKKDAQENFLQNHLSVMKSRRFSVE
A0A1H2GQN6      KQYGGTVDIRVFKQDKD-----------VQVFSQSDRNAFDPIFFESERSTIESKEILYP
A0A512M3Y3      PTYYSRSLVAYDSVNLPIK---------SETSDGSDGRGKWAHISNVLTSALNSRWLVEH
A0A4P5R5J1      PAFRSSGRMMVAGQL-------------RLGDNAAAYSEELMNFFGTQIELMQSAAVLKG
A0A4P5YK43      NKYRAYSTLGFTSRVE------------TGVGGKAQVVELADGFVEHQLVLMKSPRVRNK
A0A2A2RPW6      VVYQSKAVLYFDSGEVNV----------INIQEVEKREKAGIDLLNSIANNLKSSVILSR
B4D1I7          VVYVSTGRIMASGK--------------INLPEGVTYTEEMNLFISTQRELMQDEAVRQR
A0A353F286      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A354FSA6      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A3B9GA54      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A520LEH8      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A2D7B7R6      AHYRSTALLVVDTQQF------------VESDADASNDVRDLDILTTLVGRISTTPVLSH
B1ZT68          PLYYSEVSLLFETRKDRV----------LNIQDVVDTGVRSTTELNVHAEQLRSQTFFEY
W0J7C2          PIYRTEVSLLFEARKDRV----------LNIQEVVDTTLQTAAELNTHIEQLRSKTFADY
A0A2E5K4P7      KEYKSVAELRMERFGNTPI---------DTGNEKNQDNIGSHEDFNTWANILKSPTITSM
A0A0R2XPB1      PFYKSTSQMIVSGR--------------IALPENDMYAEERDNFIGTQIELMLSDQVQAR
A0A348NQP1      -----------------------------------MYAEERDNFIGTQIELMLSDQVQAR
A0A357FV58      PFYKSTAQMIVSGR--------------IALPENDMYAEERDNFIGTQIELMLSDQVQAR
A0A2V6F9Q9      ---------------------------------------------------MQSAEVRRG
A0A2V6NZZ3      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6EBU2      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6EY06      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6ME53      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A538NUU0      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6NIJ1      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6C292      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6D2X0      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V5ZUK1      PQYQSTSKMMLAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVKHS
A0A2V5XFN9      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A2V6EZC8      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A2V6I7Z5      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A3B9LCP2      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A3C0R669      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2V6EID2      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2V6MHB0      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2W5YWL9      PSFLSTSKMMLAGK--------------LNVNSSAVYSEDNVNFYGTQIQLMQSTEVRRG
A0A2V5NH62      PSFESRSKMMLAGK--------------LNISQSAVYSEDSVNFYGTQIQLMQSQEVRKS
A0A2W6A620      PLFQSMSKMMLAGK--------------MNISQSAVYSEDSVNFYGTQIQLMQSAEVRRS
A0A2V5PIJ4      PSFLSRSKMMLAGK--------------LNISQNAVYSEDSSNFYGTQIQLMQSDQVKQG
A0A2V6K2G8      PSYQSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVRHS
A0A2V5W206      PSYLSASKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVRHS
A0A2V6MW77      PSYLSASKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKHS
A0A2G4GZN8      PEYRATGRLRVFRLSPNINGG--------SSAADDNFKIVSNDDFFTAIEAMRSANIIEG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      KLYTAYSTIELLRDDPTVMLS--------SSGNLEQNEIRTAEDLNTHISKLESITVIQG
A0A2D7F4D9      KLYTAYATIELLRDDPTVM-N--------SASNLEQNEIRSSEDLNTHISRLESVSIIQG
A0A3R7RBR8      KLYTAYATIELLRDDPTVM-N--------SASNLEQNEIRSSEDLNTHISRLESVSIIQG
A0A2E0NH28      KVYTAYVSVQLLRDDPSAMR---------DETEMEPNQILSAEDLNTQISVLESLSIIQA
A0A350AS32      KVYTAVAQVQLLRDDPSAMGNI-------PGMEMEPNQIRSAEDLNTQISVLESASIIVG
A0A368BGT4      KVYTAVSQVQLFRDDASALGAY------GQGAEMELNQILGAEDFNTQIIVFESLNIMQG
A0A2E0V4K6      ERFASTATLLVKQNLSGV----------ISSEEVEDLDLRSDNVMNTIAAQVTRVGILEK
A0A2E6NAH3      KVYTAASQVQLFRDDASALGAI------GQGMEMEQNQILSAEDLNTQISVMESLSIIQG
A0A2A5VZA5      KVYTSVAVVRLLRDDPSAMGV---------SVELAQNQIVGAEDLNTQISLLQSGKIIQG
A0A424R295      KVYTSVAVVRLLRDDPSAMGV---------SVELAQNQIVGAEDLNTQISLLQSGKIIQG
B4CZV9          PVYYAHALIHLE----------------YLARPLDTDKLYEDGRLSAFVAQFTEPQIMLR
A0A290QE54      PMYQARATMQIEKPEKI-----------VTSQEIVDISINSDIELNTYLQVLGSAKLRGK
A0A1H1SWX2      PMYSSTATMQFERPERV-----------VQNEQVVDTAVRSEVDLGTYLQILQSGRLRTM
A0A4Q1C9I5      KMYASTATMQFERPERV-----------VLNEQVVDTSIRHDVDLNTYLQILTSGKLRQM
A0A3B9FM17      -------------------------------------ESHLEGLISRHTEGLNSEKLRIN
A0A1G3ZL71      PMYESRATLQFEREERV-----------MNQQKVVELAPQSEVDINTYVHQLNSGTLRSR
A0A556QP09      PLYRSAATLQIEKPEKV-----------VTTVDVVDTGINSDIELNTYLQVIASAKMRNR
A0A2T6DX88      PLYQSQATMQIEKPEKI-----------VTSQEVVDLSVTNDIDLNTYLQVLNSTKLRTK
A0A2T6CWI7      PRYAATARMQFEKPDRI-----------VMAEGVVDTAVRSEVDMNTHTEVLKSSSLREE
A0A3E1E5C8      KMYAATATMQFEKADTV-----------VTTQGVVDPSVRSELELRSNLEKLNSQRLRTK
B1ZZ74          PLYAAMATMQFEKPETV-----------VTSQVVVDPSVRSDIELNTNIQVLNSARMRSR
R7E4L8          YLYQKTARIMLRDDKQKNAQV-------SEIILSDLGFKPGEANLANESYVVKSSEVMSR
A0A4Q3BVY2      PSYSSTALVTMHSFGAPM------------VDREVAETQQVSSFHRNFLNRLRSAPIQLA
A0A4P6PCA7      PVYQAKAEIEMSVQRPQFIQT-------EVNLEEGGGTLSEDVIFNTRFAKFRSPAMEEI
A0A0E3YV65      KVYQSRSRLLVDRSERVV--DI------AQVVDQSVGGGKNDAMFDTYLAQITSPAMIVR
W0J900          KVFQASATLLVGRIEKVLGNEI------TNVVDDSVGGSKNDPAFDTHLAQITSREMIQR
A0A2T6DSN5      PVYWTEVQLLFEPKEKKV----------LNITEVVDTTTSSSLDLHTHLARLRSETFLDY
A0A2V2SMX4      PSYVSTGRMIVSMK--------------LSIPEGQLYTEEMGNFLGTQAALMQSDVVIHR
A0A317ZIW7      PNYRSNAQMMLSGR--------------ISLPENELYAEERANFFGTQIELMESSQVKSR
A0A2D7WMI4      EFYASSSSFRLIPPPAII----------N-LQKVD-REQQLQPLVSKHLDGLNSQELRAQ
A0A2D6VHX5      EMYQSSSSFVLIPPPKIL----------N-LQKVD-RDQQVNGLISKHLDGLNSQELRMN
A0A2D8I214      EFFQSSSSFRLIPPPAVL----------N-LQKVD-RDTQVQGLVAKHREGLNSQELKAS
A0A1Z8VL41      EFFRSESSFRLXPPPXII----------N-LQKVD-RXSXINTLXSRHLDGINSQXLRVN
A0A2E6TNA4      EFFRSESSFRLIPPVEVI----------N-LQKVD-RSSQINTLISRHLDGINSQELRVN
A0A1Z8RG47      EFYKSSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A1Z8RJJ5      EFYKSSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A2D7V631      EYYASSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A354RA24      EYYASSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRAN
A0A2E9RV62      SIYQSSSSFRLIPPPAIL----------N-LQPVE-QANQLVDLVRKHTEGLNSQELRAR
A0A2E4AY96      EFFSSSSSFRLIPPPAII----------N-LQKVDQQEQQFQLLVGKHRDGLNSQELRMQ
A0A3B9B9P4      EFFSSSSSFRLIPPPAII----------N-LQKVDQQEQQFQLLVGKHRDGLNSQELRMQ
A0A2D5Y6N6      ELFRSSASFRLIPPPAIL----------N-LQKVD-RDQHVQGLVAXHLDGLNSQDLRLN
A0A2E7HSS8      EYYRSSSSFSLIPPPAIL----------N-LRSVD-RDQHVEGLIAKHTEGLNSQQLRTN
A0A2D8VCK3      DKFQSSCSFSLTPPPAIL----------N-LQSVE-RESHLEGLISRHTEGLNSEKLRIN
A0A350QVY4      DKFASSCSFSLTPPPAIL----------N-LQSVE-RESHLEGLISRHTEGLNSEKLRIN
A0A2E4ZYR7      ------------------------------MQPVD-RDKYSARIIGQHLEGLRSGELRNR
A0A2E6TCV1      ELFRSSATFVIQPPLSII----------DNMQPIE-RDKYSARIVGDHLHRLKEKELRQR
A0A3D4HHL8      PSYVSYSQMIVSGR--------------IALPEGAIYSEELSNFFGTQMSLMQSHRVKER
A0A366HV03      AVYHSRSLIDYKFFA-------------LPVAADGVDGSSVARAVRSVQGQLSSRQMIAW
A0A5R8KAF2      PLYSSNAVIYFRVFGSPL----------SDKGMGDSAGSQTSALKYLPWELASDSNVLAA
A0A2V2SDN0      PAYQSDARMWLTGK--------------LDLSEGRLYTEELVNFLGTQADLLRSRVIQER
A0A1V6GL40      PSYVSVGRMIVSMK--------------LAIQPASLYSEELSNFLGTQAALMQCGVVVNR
A0A2V5X6Z6      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQTELLRSPAIQGR
A0A2V5VGZ7      PAYESKARMWLTGK--------------LDIYEGRLYTEELINFLGTQAELLRSPAIQGR
A0A2V5U130      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQAELLRSPAIQGR
A0A2V6C237      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQTELLRSPAIQGR
A0A3R8L982      PMYQSTATMQIEKPERVVTS-----------QEVVDTAVSSDADLNTYLQIIGSQKLRDK
A0A2E7HPU9      KLYEATSTLLVKDSARAAFE--------GQRQDNADINLRSQEALGTIVEQIKNFELFEK
A0A388PR45      PEYRAAGRLRVYRLTPTIGT--------GNTGVDETQRIGSNDDFLTAIESMKSTAVIEG
A0A388QR61      PEYRAAGRLRVYRLTPNLGN--------NNSAVEEAQRIGSNDDFLTAIESMKSSTVIEG
A0A4P5YHI0      PEYRAAGRLRVYRLTPNLGN--------NNSAVEEAQRIGSNDDFLTAIESMKSSTVIEG
A0A2A2RS01      PEYRAVGKLRVFRMAPDVTA--------NNTAANNNFNITTNDDFYTAVESMRSTGIIES
A0A2A2Y1A7      PEYRAVGKLRVFRMAPDVTA--------NNTAANNNFNITTNDDFYTAVESMRSTGIIES
A0A388PDH9      PEYRAIGKLRVFRMAPDVTV--------NNTTANNNFNITTNDDFFTAVESMRSTSIIES
A0A2G4H1E7      PEFQATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEEMRSANIIES
A0A2G4GZA6      PEYRATGRLRVFRLTPTING--------GSSAADDNFRIGSNDDFFTAVEAMRSANIIEG
A0A388P514      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
A0A2A2YG59      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
A0A2G4F7D5      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
D5EML0          KLYQASASMTVELTTANVMDIREV----MDTNVAHVNLL--NTLMNTHLERIKTRAIADA
A0A3C1C1M3      ATEIYQAEARIELSTRRPRIVNKQDAMIEDRGYGDAEEI-----LNTQIQKFNSPSILPF
A0A2E9EYJ1      SEXLGRVQIXVQREARDIEVFRXT----GSVGXXGSDQLPYMTXMQTQFEIXQSRETXKE
A0A258AXR6      RKYRGHVEMTIERITQDINVFDRN----RGDSLAFTQEY-----IKTQFETITKPTTLYP
A0A3D3NZQ6      RKYRGRVEMKIERLQDKVQVFERS----SDNFMANSDVV-----VKNEFESITKPETLYP
A0A1T4WVZ9      RKYRGRVEMKIERLQNKVQVFQRN----TDDFMAPTDVV-----IKNEFESITKPETLYP
A0A4R7SSI6      RKYRGLVEMKIERMQNKVQVFQRS----TDDFMAPSDVV-----IKNEFESITKPETLYP
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      TAQSPEVRALRNAIPPEFSF----------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A2N8IR72      AN----------------------------------------------------------
A0A2N8IV96      VSRKLNLAAEWGMTDEMAAT----------------------------------------
R7E1V8          VSRKLNLAAEWGMTDEMAAS----------------------------------------
A0A1T4WWY4      AARAIGVAGPSTTFDGLRDD----------------------------------------
A0A3D3LEQ6      AAKKLGVATASTTAVDLRAS----------------------------------------
A0A3D3NW23      AAKKLGVATASTTAVDLRAS----------------------------------------
A0A2E0R252      IAASPKFAEREDVA--SEKF----------------------------------------
A0A3E1EF48      VASNPLFANRPEVVPLSRRY----------------------------------------
A0A2A2PVG8      AAKGQLFANRENIA--PAKK----------------------------------------
A0A2E0R421      VAKSYLFENRDDVF--PDRF----------------------------------------
A0A2E5EJ69      AAELIVDR--EQLSPDISQN----------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      AEAYV-----RTTAAEIPVS----------------------------------------
A0A2E7ALI1      ----------KRALPETGSN----------------------------------------
A0A178IDB9      VQ--------SSFSSAEIEQ----------------------------------------
A0A290QD69      VQ--------SSFTPKEIEQ----------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      VV--------ASFTPEEKTR----------------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      ALARL-----SAPRTNAIPL----------------------------------------
A0A3C1VFY9      ARERV-----ASQNPGVT------------------------------------------
A0A522AC27      AHARA-----VAQRPDIV------------------------------------------
A0A2A2R174      VVVGQSLTNHPYFTGGSNAP----------------------------------------
A0A1H2DTI1      AINAL-----KAKNPGFVES----------------------------------------
A0A1V5L462      ASERV-----RALHPEIQKD----------------------------------------
A0A2A2R3V9      ARARV-----QALKPNLVPI----------------------------------------
A0A3D3LGD3      VVDKLDLQLKWELPTRQAAL----------------------------------------
A0A350ARX4      AKDRV-----LMLYPEITPS----------------------------------------
B5JIS2          LA--------SEFTEDEKAS----------------------------------------
A0A1H2GQN6      VIKKLNLVEKWSQRYLHGER----------------------------------------
A0A512M3Y3      TAKTLGLVETPGEYEMIRNR----------------------------------------
A0A4P5R5J1      AETRV-----HALHPDLPVE----------------------------------------
A0A4P5YK43      AQEYM-----REIDAALGVH----------------------------------------
A0A2A2RPW6      VVKANKLTNHVYFTQGTNAI----------------------------------------
B4D1I7          AANLV-----RSNNPELTPC----------------------------------------
A0A353F286      AAEKAQLPVQWGMDMDDVVS----------------------------------------
A0A354FSA6      AAEKAQLPVQWGMDMDDVVS----------------------------------------
A0A3B9GA54      AAEKAQLPVQWGMDMDAVVS----------------------------------------
A0A520LEH8      AAEKAQLPVQWGMDMDDVVS----------------------------------------
A0A2D7B7R6      V---------IEISPELQEH----------------------------------------
B1ZT68          VL--------TSFNKEEAER----------------------------------------
W0J7C2          VL--------ASFSTAEAEL----------------------------------------
A0A2E5K4P7      VETRL-----KASEVDYNN-----------------------------------------
A0A0R2XPB1      AVERI-----RLMDPDLHDA----------------------------------------
A0A348NQP1      AVERI-----RLLNSDLHDA----------------------------------------
A0A357FV58      AVERI-----RLLNSDLHDA----------------------------------------
A0A2V6F9Q9      AAELV-----WSTHPDISPV----------------------------------------
A0A2V6NZZ3      AAALV-----RSTNPELQPV----------------------------------------
A0A2V6EBU2      AAALV-----RSTNPELQPV----------------------------------------
A0A2V6EY06      AAALV-----RSTNPELQPV----------------------------------------
A0A2V6ME53      AAALV-----RSTNPELQPA----------------------------------------
A0A538NUU0      AAALV-----RSTNPELQPA----------------------------------------
A0A2V6NIJ1      AAGLV-----RSTNPELQPV----------------------------------------
A0A2V6C292      AVGLV-----RSTNPELQPV----------------------------------------
A0A2V6D2X0      AVGLV-----RSTNPELQPV----------------------------------------
A0A2V5ZUK1      AEALV-----RSSHPELQPV----------------------------------------
A0A2V5XFN9      AESLV-----RSAHPELQPV----------------------------------------
A0A2V6EZC8      AESLV-----RSAHPELQPV----------------------------------------
A0A2V6I7Z5      AESLV-----RSAHPELQPV----------------------------------------
A0A3B9LCP2      AEALV-----RSTHPEMQPV----------------------------------------
A0A3C0R669      AEALV-----RSTHPEMQPV----------------------------------------
A0A2V6EID2      AEALV-----RSTHPEMQPM----------------------------------------
A0A2V6MHB0      AEALV-----RSTHPEMQPM----------------------------------------
A0A2W5YWL9      AEALV-----RSTHPELHPV----------------------------------------
A0A2V5NH62      AEQLV-----RSTHPEMQPV----------------------------------------
A0A2W6A620      AEALV-----RSTHPELQPH----------------------------------------
A0A2V5PIJ4      AEGLV-----HSTHPEMPTA----------------------------------------
A0A2V6K2G8      AESLV-----RSAHPELQPV----------------------------------------
A0A2V5W206      AESLV-----RSAHPELQPV----------------------------------------
A0A2V6MW77      AESLV-----RSAHPELQSV----------------------------------------
A0A2G4GZN8      VS--------KRLTVAERKQ----------------------------------------
A0A348NPT1      ------------------ER----------------------------------------
A0A2E1KV60      VE--------KRLQEDEFAQ----------------------------------------
A0A2D7F4D9      VE--------KRFQEDELAQ----------------------------------------
A0A3R7RBR8      VE--------KRFQEDELAQ----------------------------------------
A0A2E0NH28      VE--------RRLQDEERAR----------------------------------------
A0A350AS32      VE--------QRIQDDVRER----------------------------------------
A0A368BGT4      VE--------KRLQDEMRER----------------------------------------
A0A2E0V4K6      VAQRPEFAGSEDLVRKPASY----------------------------------------
A0A2E6NAH3      VE--------QRLQDELRLR----------------------------------------
A0A2A5VZA5      VN--------RRMSDEQRKR----------------------------------------
A0A424R295      VN--------RRMSDEQRKR----------------------------------------
B4CZV9          TARALGI---DTNSRDLERK----------------------------------------
A0A290QE54      VI--------QSLTPAEVKM----------------------------------------
A0A1H1SWX2      VA--------QSLTPDEIRL----------------------------------------
A0A4Q1C9I5      VA--------QSLTAEEVRI----------------------------------------
A0A3B9FM17      VAHQ------LDNNPQYKSV----------------------------------------
A0A1G3ZL71      VY--------DSFTPEEKAI----------------------------------------
A0A556QP09      VQ--------ESLTPQERQV----------------------------------------
A0A2T6DX88      VM--------ESFTPEEVKV----------------------------------------
A0A2T6CWI7      VV--------ASFSADEIKV----------------------------------------
A0A3E1E5C8      VV--------ESFTPDEVKI----------------------------------------
B1ZZ74          VV--------ESFTPEEVQI----------------------------------------
R7E4L8          VVKGLGLDVSYWEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTPLNGREFSLSYRAK
A0A4Q3BVY2      AAKRMGLVGDGATSEDILRV----------------------------------------
A0A4P6PCA7      AAEVYFSKYSKKEYEERTSW----------------------------------------
A0A0E3YV65      VV--------DSLSETEKLS----------------------------------------
W0J900          VV--------ASFKPEEKAR----------------------------------------
A0A2T6DSN5      VQ--------QSFSPKEIEM----------------------------------------
A0A2V2SMX4      AHLLV-----IAQNPNFKPQ----------------------------------------
A0A317ZIW7      AIER------VKLTEPEVYE----------------------------------------
A0A2D7WMI4      VVTK------IENSPELKTE----------------------------------------
A0A2D6VHX5      VIAR------INENSDYKTE----------------------------------------
A0A2D8I214      VIQK------ISDNPESKSI----------------------------------------
A0A1Z8VL41      VVQK------ISENPEXKSI----------------------------------------
A0A2E6TNA4      VVQK------ISENPEYKSI----------------------------------------
A0A1Z8RG47      VIQK------VKDNPEYKSA----------------------------------------
A0A1Z8RJJ5      VIQK------VKDNPEYKSA----------------------------------------
A0A2D7V631      VIQK------IKDNPEFKST----------------------------------------
A0A354RA24      VVQK------IKDNPEFKST----------------------------------------
A0A2E9RV62      VLEA------IKDNSFKKST----------------------------------------
A0A2E4AY96      VITK------IENSPELKRE----------------------------------------
A0A3B9B9P4      VITK------IENSPELKRE----------------------------------------
A0A2D5Y6N6      VTQK------IKDTPELKSE----------------------------------------
A0A2E7HSS8      VILR------LRESPEYKSV----------------------------------------
A0A2D8VCK3      VAHQ------LDNNPQYKSV----------------------------------------
A0A350QVY4      VAHQ------LDNNPQYKSV----------------------------------------
A0A2E4ZYR7      IVRA------INEDDHKKAT----------------------------------------
A0A2E6TCV1      VVKA------IESDKAKKSI----------------------------------------
A0A3D4HHL8      ----------ARLRVRAMQP----------------------------------------
A0A366HV03      TA--------HSLGVGRANA----------------------------------------
A0A5R8KAF2      AKELGIVGPSASFEAVKSKQ----------------------------------------
A0A2V2SDN0      ALATVEKQFSNAPPLKPVPG----------------------------------------
A0A1V6GL40      AH--------ERVSAQ-KPE----------------------------------------
A0A2V5X6Z6      AL--------ARLRSELNPD----------------------------------------
A0A2V5VGZ7      AL--------AKLRSERN------------------------------------------
A0A2V5U130      AL--------ARLRSELNPD----------------------------------------
A0A2V6C237      AL--------ARLRSELNPD----------------------------------------
A0A3R8L982      VA--------ESLKPDDIKI----------------------------------------
A0A2E7HPU9      IA--------KDPDVLALEG----------------------------------------
A0A388PR45      VS--------RLLTPAERKL----------------------------------------
A0A388QR61      VS--------RLLTPAERKL----------------------------------------
A0A4P5YHI0      VS--------RLLTPAERKL----------------------------------------
A0A2A2RS01      VS--------RQLTIDEKKR----------------------------------------
A0A2A2Y1A7      VS--------RQLTIDEKKR----------------------------------------
A0A388PDH9      VS--------RQLTIDEKKR----------------------------------------
A0A2G4H1E7      VS--------KRLTTDERKQ----------------------------------------
A0A2G4GZA6      VS--------KRLTADERKL----------------------------------------
A0A388P514      VS--------KRLTADERKL----------------------------------------
A0A2A2YG59      VS--------KRLTADERKL----------------------------------------
A0A2G4F7D5      VS--------KRLTADERKL----------------------------------------
D5EML0          VV--------AALSEDQIQQ----------------------------------------
A0A3C1C1M3      VV------------ASYREL----------------------------------------
A0A2E9EYJ1      VIXNGVDXAGNXXDLKKSWG----------------------------------------
A0A258AXR6      VI--------ETLELAKKWE----------------------------------------
A0A3D3NZQ6      VV--------DKLDLQLKWE----------------------------------------
A0A1T4WVZ9      VV--------DKLDLQKRWS----------------------------------------
A0A4R7SSI6      VV--------DKLDLQKRWS----------------------------------------
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ---------------------------------KPRYMRTEEELAFKPASSVEVYELVSS
A0A5E6MKA7      ------------------------------------------------------------
A0A2N8IR72      ---------------------------------------------------------ALL
A0A2N8IV96      -----------------------------------------------------------N
R7E1V8          -----------------------------------------------------------N
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      ------------------------------------------------------------
A0A3D3NW23      ------------------------------------------------------------
A0A2E0R252      --------------------------HMPWE---------DVPSVSGADMSPET--LGGM
A0A3E1EF48      --------------------------VLPWEPFLAKKPNPEEKPAPGTKQGPAAGDLAGM
A0A2A2PVG8      --------------------------RFPWT---------KQMRFAGEDLSPEM--LGAM
A0A2E0R421      --------------------------HLPWE---------KRQNPTREDISDVS--LGNM
A0A2E5EJ69      --------------------------------------------------------DLRG
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      -------------------------------------------------TSNHQKKLVSL
A0A178IDB9      --------------IQAPY-------------------------RNPDNPSAPPPSLAGI
A0A290QD69      --------------IQNAY-------------------------RNPDSPTAPPPSLADI
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      --------------VLAAW---------------------LDKDDPPLSASQMDGRLSGL
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      ------------------------------------------------------GKDGQP
A0A3C1VFY9      -----------------------------------------------------------P
A0A522AC27      -----------------------------------------------------------V
A0A2A2R174      ----------------------------------------------------SEQMVVSS
A0A1H2DTI1      ------------------------------------------------------------
A0A1V5L462      ------------------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3D3LGD3      ----------------------------------------------------------GK
A0A350ARX4      ------------------------------------------------------------
B5JIS2          --------------IVRAF--------------------------VKGDGVPSMSAFEKI
A0A1H2GQN6      --------------LLRED-----------------------------------EVYGIL
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      ------------------------------------------------------------
A0A2A2RPW6      ----------------------------------------------------SEERLTRQ
B4D1I7          ------------------------------------------------------------
A0A353F286      --------------LLEGI-----------------------------------------
A0A354FSA6      --------------LLEGI-----------------------------------------
A0A3B9GA54      --------------LLEGI-----------------------------------------
A0A520LEH8      --------------LLEGI-----------------------------------------
A0A2D7B7R6      -------------------------------------------YKVDLNDPRSITSASKK
B1ZT68          --------------IQRPY-------------------------RDPTQPDKPVPSLAEI
W0J7C2          --------------IRKAY-------------------------ADPLDPDAAPPPLDAI
A0A2E5K4P7      --------------FMEPY---------------------QKMDKNGGRDEEDPIVAGPI
A0A0R2XPB1      --------------LIATE----------------------------------AYQIDGL
A0A348NQP1      --------------LMVTE----------------------------------AYQNDGL
A0A357FV58      --------------LMVTK----------------------------------AYQIDGL
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ------------------------------------------------------------
A0A2V6EBU2      ------------------------------------------------------------
A0A2V6EY06      ------------------------------------------------------------
A0A2V6ME53      ------------------------------------------------------------
A0A538NUU0      ------------------------------------------------------------
A0A2V6NIJ1      ------------------------------------------------------------
A0A2V6C292      ------------------------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      ------------------------------------------------------------
A0A2V5XFN9      ------------------------------------------------------------
A0A2V6EZC8      ------------------------------------------------------------
A0A2V6I7Z5      ------------------------------------------------------------
A0A3B9LCP2      ------------------------------------------------------------
A0A3C0R669      ------------------------------------------------------------
A0A2V6EID2      ------------------------------------------------------------
A0A2V6MHB0      ------------------------------------------------------------
A0A2W5YWL9      ------------------------------------------------------------
A0A2V5NH62      ------------------------------------------------------------
A0A2W6A620      ------------------------------------------------------------
A0A2V5PIJ4      ------------------------------------------------------------
A0A2V6K2G8      ------------------------------------------------------------
A0A2V5W206      ------------------------------------------------------------
A0A2V6MW77      ------------------------------------------------------------
A0A2G4GZN8      --------------VLEPY------------------------QGGNIFSGPLTEQEVFA
A0A348NPT1      --------------FMAPY------------------------ADALSFTGPLTPTQMLA
A0A2E1KV60      --------------FMAPY------------------------KGVFSFSGPLTAFEILA
A0A2D7F4D9      --------------FMAPY------------------------KGTFSFSGPLTAFEILS
A0A3R7RBR8      --------------FMAPY------------------------KGTFSFSGPLTAFEILS
A0A2E0NH28      --------------FMAPY------------------------ADAFSLTGPLTPVEMLA
A0A350AS32      --------------FMAPY------------------------SDALSLSGPLSPTEVLG
A0A368BGT4      --------------FMAPY------------------------MDTLSFSGPLTPLEVLA
A0A2E0V4K6      ---------------------------MPDWASAFFAREGARESNSEPDTGANLTRVAAM
A0A2E6NAH3      --------------FMAPY------------------------EDTLSLSGPLTPLEILA
A0A2A5VZA5      --------------FLLPY------------------------EGAFSFSGPLTPTEILG
A0A424R295      --------------FLLPY------------------------EGAFSFSGPLTPTEILG
B4CZV9          --------------YLFKF-----------------------------------------
A0A290QE54      --------------LQQPF------------------------LATLEPGQPPPSIHEVV
A0A1H1SWX2      --------------LQRPY------------------------LKDLAPGANPPAVGGLL
A0A4Q1C9I5      --------------LQRPY------------------------LGELAPGENPPPVGQLL
A0A3B9FM17      --------------LLGPF------------------------LK----QGVRVGIASAY
A0A1G3ZL71      --------------LQRSF------------------------LKDLPPGAGPPATGDFM
A0A556QP09      --------------LQRPY------------------------IKDLAPGATPPT-GVDL
A0A2T6DX88      --------------IQRAY------------------------LKNLKPGDPLPGVGSML
A0A2T6CWI7      --------------LQRAA------------------------LKRLPPGSPPTNVGIPM
A0A3E1E5C8      --------------LQRPY------------------------LKNLPPGAGVPSAGEAL
B1ZZ74          --------------LQRPY------------------------LANLAPGASPPSAGGAL
R7E4L8          ESGENVLHGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGRLSVT
A0A4Q3BVY2      --------------IPSLV-----------------------------------------
A0A4P6PCA7      --------------IGLED--------------------------------------LAY
A0A0E3YV65      --------------AWRPY-----------------AEQDAPPPA----APVLRDTLLQI
W0J900          --------------ILAPW-----------------LDKDAPPLS----DSQTDARLASL
A0A2T6DSN5      --------------IQNPY-------------------------RDPQNANAPVPSVRNI
A0A2V2SMX4      --------------PVSLK-----------------------------------------
A0A317ZIW7      --------------SL---------------------------------EQKEEFLNEGL
A0A2D7WMI4      --------------ILAPY------------------------IQ----EGAVTSVAAAI
A0A2D6VHX5      --------------LLAPY------------------------LS----DGTPMKIQNIV
A0A2D8I214      --------------MLAPF------------------------LR----EGIPVGVESTI
A0A1Z8VL41      --------------XLAPF------------------------LX----EGXPIGVAXTV
A0A2E6TNA4      --------------LLAPF------------------------LQ----AGIPTGVASTV
A0A1Z8RG47      --------------LLEPY------------------------LK----EGISMDVGATV
A0A1Z8RJJ5      --------------LLEPY------------------------LK----EGISMDVGATV
A0A2D7V631      --------------LLAPY------------------------LK----EGISMDVGATV
A0A354RA24      --------------LLAPY------------------------LK----EGISMDVGATV
A0A2E9RV62      --------------MLAPY------------------------VH----DQQLPEIASII
A0A2E4AY96      --------------MLKPY------------------------VE----SGIPTSVGSTV
A0A3B9B9P4      --------------MLKPY------------------------VE----SGIPTSVGSTV
A0A2D5Y6N6      --------------LLSPY------------------------LK----DGISIDVGATI
A0A2E7HSS8      --------------LLAPY------------------------LK----DGVIVDLASTV
A0A2D8VCK3      --------------LLGPF------------------------LK----QGVRVGIASAY
A0A350QVY4      --------------LLGPF------------------------LK----QGIRVGIASAY
A0A2E4ZYR7      --------------LLAPY------------------------VK----QGPPPPVASVV
A0A2E6TCV1      --------------LLAPY------------------------VKDKKEQEVLPTVGQVV
A0A3D4HHL8      --------------ELDPC-----------------------------------------
A0A366HV03      --------------SFEEL---------------------------------------RS
A0A5R8KAF2      --------------LRVRA-----------------------------------------
A0A2V2SDN0      --------------MADFL--------------RHGSSVNAANAE----PSELF------
A0A1V6GL40      --------------IG-------------------------------------------R
A0A2V5X6Z6      --------------LAVLL---DGGGRQSELLHLAKALCKRLFAS----GSTSSSNAPPR
A0A2V5VGZ7      --------------LAVLH---NGGGTQSELLHKAKALCKKLIAS----GSSSSSNAPPR
A0A2V5U130      --------------LAVLL---DGGGRQSELLHKPKALCKRLFAS----GSTSSSNAPPR
A0A2V6C237      --------------LAVLL---DGGGRQSELLHLAKALCKRLFAS----GSTSSSNAPPR
A0A3R8L982      --------------LQRPY--------------QQDAIASGSPLP----GPSGLVGGINV
A0A2E7HPU9      --------------LIPPSVNWWPEWSGDLLGGDGEAAIEASKME----TSQLARLIRGW
A0A388PR45      --------------VLEPY--------------QQGNVFTGP-LT----EQEVFARQRGV
A0A388QR61      --------------VLEPY--------------QQGNVFTGP-LT----EQEVFGRQRAI
A0A4P5YHI0      --------------VLEPY--------------QQGNVFTGP-LT----EQEVFGRQRAI
A0A2A2RS01      --------------VIEPY--------------QQGNIFSGP-LS----EQEVFGRQRAI
A0A2A2Y1A7      --------------VIEPY--------------QQGNIFSGP-LS----EQEVFGRQRAI
A0A388PDH9      --------------VIEPY--------------QQGNIFSGP-LS----EQEVFGRQRAV
A0A2G4H1E7      --------------ILEPY--------------QNGNYFSGP-LT----EQEVFAKQRSI
A0A2G4GZA6      --------------VLEPY--------------QAGNIFSGP-LT----EQEVFAKQRGI
A0A388P514      --------------VLAPY--------------QAGNIFSGP-LT----DQEVFVKQRGI
A0A2A2YG59      --------------VLLPY--------------QGGNIFSGP-LT----EQEVFARQRGI
A0A2G4F7D5      --------------VLLPY--------------QGGNIFSGP-LT----EQEVFAKQRGI
D5EML0          --------------LVDPY--------------YDPAIDGENKPD----PAVLLMRRMLS
A0A3C1C1M3      --------------Y----------------------------PD----DPAPEEELTAR
A0A2E9EYJ1      --------------V----------------------------PS----DEDAYRILKRK
A0A258AXR6      --------------L----------------------------PN----RQAALGRLRAN
A0A3D3NZQ6      --------------L----------------------------PT----RQAALGKLRSN
A0A1T4WVZ9      --------------L----------------------------PN----RQSALAKLRGN
A0A4R7SSI6      --------------M----------------------------PN----RQAALAKLRGN
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      --------------------------------NALMIEYIQYKKDIRKVVSGDTLASISE
A0A258AXL1      ---------------------------------EKLALLAKYRSA--------------P
A0A2E6T1E0      ---------------------------------------LTYKRE--------------N
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      --------------------------------------------------------IVLQ
A0A353DI77      ------------------------------------KQFINIREGVNEEGKKSDLQHLLA
A0A1V6GCZ3      ---------MRGTSLIEIVVYSEKPEEAARIANAIADAYKTHRQEQRAQLSRGGIKALEE
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      FGSWITISGRRGTSLIDVRVKHQDAEAARVIADTLLKVYLEKEESQLIGGSDDAFKILKK
A0A5E6MKA7      -MGSLKVEPIRNTRLVRIRCESRQPIVAAQVANGYAESFINFGLDRKLEANRHARKFLAG
A0A2N8IR72      RGLTITRPDSKESSLLEMTLTSSNPQKAEDTLNHLIQVYNQISKDERNKASLKTKIFIRD
A0A2N8IV96      LAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAYKQDREMRENRLVETAIKSLKD
R7E1V8          LAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKTVPEAYKQDREMRENRLVETAIKSLKD
A0A1T4WWY4      -VMPVCRMAILDQSHFQILVVSYDAEVVKKMPQALVDAYERIRLKIRSEYRDTAVKRYAD
A0A3D3LEQ6      -LIPAIRIGFLDQNHIQLRVISYRPRIVREFPQAMIEAYEGARKRLRNEYRDKAIARYVD
A0A3D3NW23      -LIPAIRIGFLDQSHIQLRVISYRPRIVREFPQAMIEAYEGARKRLRNEYRDKAIARYVD
A0A2E0R252      MRGWVTVRWRKDTTLIDLYASHSDPEIARDTLEGLIEEYDRSVESKVAGSSEFALDYILE
A0A3E1EF48      MAGWVSVSVRENTNLVDIFAAHTNPEVARDVLSCLLTEYEKLTAESIAGSEENTINYIVE
A0A2A2PVG8      LKGWVTVRWRTDTTLLDLYATHTDPAIARDSLAAVLSAYEQLSESRVEGSSEYVLEYILD
A0A2E0R421      MRGWVSVRWRPDTKLLDIHVTHTNPEVARDVLVALLSEYERMTESKVADSSEYALDYILE
A0A2E5EJ69      QLGGVSSSLRKMTRFIDVSFRHRDRVFAMNANQAIVEAFVNWDIERKMGRGTNTIAIHTT
A0A2G4I5Z5      -----------MTRLIDVTVELGDRVLSQTLAQAVVDEYIKQINEDRAGIGTNTSQFLMG
A0A4P5QQV6      -MVMLRVEPLPQTSIFALTATGEEPLYTQKFLDAILHEYIATRREMRSQKGEFAAGAIDD
A0A2E7ALI1      LKNRCEVTVRRRTRLLDVRINHEDPKVSAELADTVVDEYLKELTEENRGTKNKRSEGLVK
A0A178IDB9      IRPHINIYQQKGTTIVRIVVTNRDPEAAALIANRFSRKYIDFTVDKAMTSTNSAIIFLKN
A0A290QD69      IRPNVRIEPQRSTTILRIMVWNKDPEAAALIANRFARQYIQYTIDRAMTKTSSAMLLLRG
A0A2E7VDS1      ---------------LRITAIARNGEGAAMIANLAQDEYERIHDVRKGKKHDMAITFLEE
A0A178IFJ2      ITSGVGVQRQGTTFLIRITCKHREPAMAALVATRFAECYIVYLMDRNASANDSAISFLRA
A0A357FSP9      ---------------------------AARVANLFADEFINYNLTLNIDGSMKAVEDLRI
A0A538NJ59      LPVEIRVRQAAKSSVFELEASAADAAYVQAYLSALMIEYLQYKKDIRKVVSGDTLASISE
A0A3C1VFY9      KPVALQVSVLPKTTIFILRATGGNPEYTKAYLQACMDEYRNLKKGMTEHASDTTVAGLTD
A0A522AC27      QPAELSVAITPKTTIFVVRAIGHDPQYVKAFLQACMEEYIKLKREMREKTSDTTLAGLTE
A0A2A2R174      VSGAVDARLRRMTRLIDVTVELGDRMLAQTVAQSVVDEYIKERNEVRAGVGTNTSQFLMA
A0A1H2DTI1      -DVRIDVHPLGSTPILIIRAMSSDAQFAKDFLQADIDAYIALQHDIKVDDKDRAIKDITD
A0A1V5L462      -WVSLWAGRKGTTDIFQLVASGGNARYTQAYLAQIIQAYLEFRRQTRLETSDDVMLSIGE
A0A2A2R3V9      -PVALSAYQQPRTSIFTLQASGSEPNYTQAFLDAVMEEYISRRKETRSEKSQSALLTIKE
A0A3D3LGD3      LRSNLDTQSSIRSDFVIIEFFDKDPALAATIANAVADSYMTRRVEVESKQKESALEMLNK
A0A350ARX4      -WVSLSVVQRSQASIFQLRAQGGSAEFTQKFLDAVMEEYQTFRSEMRSETTETTLIAVTE
B5JIS2          LAGRMDATRQRDREFFTLSFRHPEAEIALMVADRMTAAYLKLVQREIKETNQAAAEMLRL
A0A1H2GQN6      LGRHLKVEPQRGSNIIQITGISEEMEEAPLLANTIAETYIGVRTKNEKDRINRGLDNVAD
A0A512M3Y3      -YVSSIRVTLVPGNILQIEIYAYQPWLVEKWPQAMLDTYKTYTQQQRSRFKDNAVEEYTK
A0A4P5R5J1      -QVKVVVGQLPKAAIFVMNVYAKSPAYASAYVDALMDEYMAKKKEMRQTSGESAAVAIQE
A0A4P5YK43      -PELESSVSKGAGSLFMMTVDSTDLRYASLYVSNWARAFVAYKNEVNTELIEKKFGQTRQ
A0A2A2RPW6      LAYVVDARLRRFTRLIDVSVELGNAKLAQVIGQSVMEEFLKQNAEDRVGAGTNAGHALLA
B4D1I7          -PITLFVAPLPQTSIFNLSAIGTEPQYPQKFLDALMHEYIATRREMRTEKSEDAESSIED
A0A353F286      ----VETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDA
A0A354FSA6      ----VETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDA
A0A3B9GA54      ----VETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDA
A0A520LEH8      ----VETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDA
A0A2D7B7R6      LGANITAKLRGDSLFIDLTANSENRDLAYWSAKYVSTGYTNFLKVNSRSKAMGGLIQLER
B1ZT68          IRPNLTIFARRNTTILVVGVTNRNPENAALIANRFARRYIDYNLDRANSGTNSAIIFLRN
W0J7C2          IRPNVTVFARRGTPILGIQVSNRSPEAAALIANRHARKYIDYNLDNASTRTNSAIVFLRN
A0A2E5K4P7      LHEKRRIIPKRLSLVIQIEYIHPNPEIAATVVNHFAQSFREYQLDQSLKKGISDISKLGT
A0A0R2XPB1      RALSIESNVKRDTSIFVLSAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSARTYDAIVA
A0A348NQP1      RALLIEADVKRDTSIFVLTAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSARTYDAIVA
A0A357FV58      RALSIEADVKRDTSIFVLTAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSARTYDAIVA
A0A2V6F9Q9      -PIELSVAQRPRTSIFELQAIGSSPEYTQLYLSAVMQKYLDFKRGMREGQTQTFTTGITE
A0A2V6NZZ3      -PVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A2V6EBU2      -PVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A2V6EY06      -PVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A2V6ME53      -PVELTVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A538NUU0      -PVELTVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A2V6NIJ1      -PVELSVAQRPRTSIFELQAIGSSPDYIQAYLNAVMQKYLDFKRGMREGQTNTFTTGITE
A0A2V6C292      -PVELSVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTNTFTTGITE
A0A2V6D2X0      -PVELSVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTNTFTTGITE
A0A2V5ZUK1      -PVEIFVMQKPRTSIFDLSAVGSSPEYTQAYLNAAMQKYLDFKRGMREDRGHEITTGITE
A0A2V5XFN9      -TVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHEVTTGITE
A0A2V6EZC8      -TVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHEVTTGITE
A0A2V6I7Z5      -TVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHEVTTGITE
A0A3B9LCP2      -PVDITVSQKPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFKKGMREGQGQTVITGITE
A0A3C0R669      -PVDITVSQKPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFKKGMREGQGQTVITGITE
A0A2V6EID2      -RVEITVVQKPRTSIFDLQAIGRTPDYTQAYLNALMQKYLDFKKGMREGQGQTLITGITE
A0A2V6MHB0      -RVEITVVQKPRTSIFDLQAIGRTPDYTQAYLNALMQKYLDFKKGMREGQGQTLITGITE
A0A2W5YWL9      -PVEINVLQRARTSIFELQAIGSSPDYTQAYLNAAMQKYLDFKRGMRQDQTHTLTTGMTE
A0A2V5NH62      -MVEISVVQKPRTSIFDLVAIGTTPDYTQAYLNAVMQKYLDFKKGMRENQGSTVTTAITE
A0A2W6A620      -LVEITVTQKPRTSIFDLVAIGSTPEYTQAYLNAVMQKYVDFKKGLRENQGSTVTTAITE
A0A2V5PIJ4      -PVEITVSQQSRTSIFDLRAVGAVPEYTQAYLNALMQKYLDFKKGMREGQGHNVTTAITE
A0A2V6K2G8      -PVEIFVLQKPRTSIFDLSAIGSAPEYTQAYLNATMQKYLDFKRGMREDRGHEITTGITE
A0A2V5W206      -PVEITVLQKPRTSIFDLAAVGSAPEYTQAYLNAVMQKYLDFKRGMREDRGHEITTGITE
A0A2V6MW77      -PVEITVLQKPRTSIFDLAAVGSAPEYTQAYLNAIMQKYLDFKRGMREDRGHEITTGITE
A0A2G4GZN8      RQRGI--NPQRQTLVINVDFTHPNRDLARQVARLFCESIKKNSEDDRLMVTNPLIEKARI
A0A348NPT1      QNRKI--LPQRGTLMIGVGYNHPDPVMAARVANLFADEFINYNLTLNIDGSMKAVEDLRI
A0A2E1KV60      KNRKI--IPRRMSLMVNISYTHPNPIVAAKIANLFGDEYINSMLSQNIDASMKAVEDLRK
A0A2D7F4D9      INRKI--IPRRMSLMVNIAYTHPNPIMAAKIANLFGDEYINTMLSQNIDASMKAVEDLRK
A0A3R7RBR8      INRKI--IPRRMSLMVNIAYTHPNPIMAAKIANLFGDEYINTMLSQNIDASMKAVEDLRK
A0A2E0NH28      KNRKI--IPRRMSLMVNVGFTHPDPIIAARVANLFADEFIAYNLTKSVDASMDAVEDLRI
A0A350AS32      RNRKI--MPKRMSLMINIAYTHPDPIIAADVANLFAKEFIDYNLKLNIDGSMKAVEDLRI
A0A368BGT4      ENRKV--IPRRMSLMINLAYSHPDPLIAAEVSNLFAKEFIDYNLRLNIDGSMKAVEDLRI
A0A2E0V4K6      LAQRCDATVRKRTRLLDVTVTHEDPELARTLADAVVDEYLKELAEEDKGSADRRSAGLLG
A0A2E6NAH3      KNRKI--IPRRMSLMVNFTYSHPDPFLAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRI
A0A2A5VZA5      KYRKI--MPQRMSLMVNVAYTHPDAQIAADVANLFAQEFINYNLSENIDASMVAVEGLRI
A0A424R295      KYRKI--MPQRMSLMVNVAYTXPDAQIAADVANLFAQEFINYNLSENIDASMVAVEGLRI
B4CZV9          ------RASLNTEKNIDVEAWPYSADWAHRWTETMVQQFIAYRQERRNEEKNLIVNTYSE
A0A290QE54      GSIGV--QAIKNSFLISITATHRSGEGAALIANRYVDQFMQDLLMNVGGKNEYAVQSLRT
A0A1H1SWX2      GSMSP--LSIRNSFLITITVNNRDPEGAALLANRFVEQFMRYLMENVGGKNEFAVDYLRS
A0A4Q1C9I5      GSMSP--QSIRNSFLIHISVTNRDPQGAALLANRYVEQFMRYLFENAGGKNEDAVNFLRS
A0A3B9FM17      SYRIT-QAGSKSRPRFIITSDARSALGAKYVADVVQKEYEKLHKSTKNEKVEFVKQTLED
A0A1G3ZL71      GQVVA--DAVRGSRLIRITARHRDPAAAALVANRTYQQFVNQLIENAGGSSEFTVEFLQL
A0A556QP09      GVMSV--QSVRSTFLINIAVSHRDPDAAAILANRYIEQFIESLLENVSGGHDYAVKYLRD
A0A2T6DX88      GSTSV--QSVRNSFIIRIVVSHPDPEAAALIANRTVDQFMQYLLDSVSGKNEYAVERLRL
A0A2T6CWI7      GELSV--FPIRNTYLIAVTVTHDDPDAAALVANRFVEVFMKRLYDTAGGRTADAVKFLRE
A0A3E1E5C8      GAVSI--DSTRNSLLISITVRHPDPVAAALVANQYVNQFVGYLMDYYGGKNETGVEYLRA
B1ZZ74          GGVSI--DAARNSLLITVRVVHPDPEAAALVANRYVNQFMTYLIERVGGVNESAVEFLRN
R7E4L8          RPDSK------ESSLLELTLRLSHPQKAEDALNYLIEVYNDHSRREKQMAASRAEEFIVK
A0A4Q3BVY2      -------IRAMDGRTIELTVVAHDKRAVRGFAEAIVTAYQDIQQENYEEYRDEALRRYAE
A0A4P6PCA7      WVRQVGWYKQGNANIVHVSFQSPDPEFAAQLVNVMIEAAGVLMERDNKELSDGAVKWLVD
A0A0E3YV65      IGSSVSAARQGNTFFISINVLQRDPDSAALLASRFASQFIIHLLDRNSAVNNSAIAFLRE
W0J900          IADNVGVVRQGSTFLVRVSYKHREPAVAALVATRFTECYIVYLMDRNTSSNDSAISFLRE
A0A2T6DSN5      VRSAIQIRDDKATTIVRIGAYHRDPEAAALIANRFARKYIDFMLDEAMSGTTSAILWLRN
A0A2V2SMX4      ------VTILPKTTIFLLVGTGDDPVYTQKFLQACMEEYANLKAEMRTQTSDKTLSGLSE
A0A317ZIW7      RSLKIAAEVKDDTSIFALSAITPDRKFSQEFLDAVMAEYINRRSEMRAKTSEKTYDAIAA
A0A2D7WMI4      SYSVSVS--GEGRPVITISSNARSAQAAMIIAREVQTEYEILHRSRSNLKVESAKQTLEG
A0A2D6VHX5      TYNVSVSSPSEGRPRFKINSQSRTGKGAMIIADLVQKEYDKLNSIKKTEQVQTAKGILEL
A0A2D8I214      SYSISVSPPSEGRPRFVISSTSRSAKGAMLVADLVQSEYEKLHKSKKNQQVESVRNLLEK
A0A1Z8VL41      SYSVSVTPPSAGNPRFTISATSRSARGAQIIADTVQLEYEKLHKSRKSEKVESARNLLEL
A0A2E6TNA4      SYSVGVTPPSAGNPRFTISAVSRSARGAQIIADTVQSEYEKLHKSRKSEKVESARNLLEL
A0A1Z8RG47      SYGVSVSPPSEGRPRFTINSNSRSGKGAMIVADIVQSEYEKLHRSKKSQQVESVRNVLEV
A0A1Z8RJJ5      SYGVSVSPPSEGRPRFTINSNSRSGKGAMIVADIVQSEYEKLHRSKKSQQVESVRNVLEV
A0A2D7V631      TYSVGVSPPTEGRPRFTINSNSRSGKGAMIVADVVQSEYEKLHKSKKSQQVESVRNVLEV
A0A354RA24      TYSVGVSPPTEGRPRFTINSNSRSGKGAMIVADVVQSEYEKLHKSKKSQQVESVRNVLEV
A0A2E9RV62      NYSVS--VGGEGRPVFTITATGRSPESVQLVADLVQQYYDESHKKGAGEIVRGARSVLES
A0A2E4AY96      SYSIS--LSEESRPRFTITSNARSAKSAMIIAREVQSEYEILHRSNSSLKVESAIKTLER
A0A3B9B9P4      SYSIS--LSEESRPRFTITSNARSAKSAMIIAREVQSEYEILHRSNSSLKVESAIKTLER
A0A2D5Y6N6      SYSISVSPPSEGRPRFTINSTARSGRGAQIIADVVQSEYEKLHKSKKSLQVENVKNVLQL
A0A2E7HSS8      SYRVD-QSGTKSRPRFIITSDSRSAKGAMIVADLVQKEYEKLHKSSKSEKVEFVKKTLED
A0A2D8VCK3      SYRIT-QAGSKSRPRFIITSDARSALGAKYVADVVQKEYEKLHKSTKNEKVEFVKQTLED
A0A350QVY4      SYRIT-QAGSKSRPRFIITSDARSALGAKFVADVVQKEYEKLHKSTKSEKVEFVKQTLED
A0A2E4ZYR7      NYTVS--LAGEGTPILRINSMARNGEGAAMVANLAQDEYERIHESRQGKKHDTAIAFLEE
A0A2E6TCV1      NYKID--LIGKGTPTLQITAEARNAEGAQLVANLVQIEYERAHKSRKGQNQTKSVAFLDI
A0A3D4HHL8      -VVRVSVSQSPDASIFILSAVGEKPEYTQAYLNALMNEYLSFKREMRSETADRTFLAITE
A0A366HV03      GPLRKIELGLLDGATMQLDVFSTNPNVVREFPQALINQYDSYTREKRFEFFEVALKRYNE
A0A5R8KAF2      --------STMNWSHLQISVMSPDPAVVRVFAKKLIEVYRAQREEAWAKYRNEALIRYAR
A0A2V2SDN0      ---KLKVVESSKSSILELHATGAEPLSTRAFLNAVMAEYLSFKRESREKTSDRAVASLAR
A0A1V6GL40      HAVALNVLVLPKTTIFVLQATGRDRDYTQAFLQACMDEYIALKKEMRSQTSDTTVAGLTE
A0A2V5X6Z6      FPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTTDRTATSLGV
A0A2V5VGZ7      FPFDVKVLEGAKSSTLALRVIGAEPASTRAFLDCLMEEYLSFKKESREKTSDRTAASLAA
A0A2V5U130      FPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTSDRTATSLGA
A0A2V6C237      FPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTSDRTATSLGV
A0A3R8L982      QSVAR-------SYLISITAYNRDPDGAALIANRYVDQFITYLIDSVSGRNEDAVSYLNT
A0A2E7HPU9      TEVSN----RRKTRLVDVVVSHPLPEVASALADKISQTYANELGVERATGRTNSSSVLAQ
A0A388PR45      NPTRQ-------TFVVNVDFTHPNRELARLVAQRFCDVIQKSSEDERLTITHPLVEKARI
A0A388QR61      NPTRQ-------TFVVNVEFTHPNRELARMVAQRFCDVIQKSSEDERLTMTHPLVEKARI
A0A4P5YHI0      NPTRQ-------TFVVNVEFTHPNRELARMVAQRFCDVIQKSSEDERLTMTHPLVEKARI
A0A2A2RS01      NPLKS-------TFVVTVEFTHPNRDLARQVAGIFCKAIQKNSEDERLTITNPLVEKLRS
A0A2A2Y1A7      NPLKS-------TFVVTVEFTHPNRDLARQVAGIFCKAIQKNSEDERLTITNPLVEKLRS
A0A388PDH9      TPLKS-------TFVVAVEFTHPNRELARQVASIFCKAIQKNSEDERLTITNPLVEKLRS
A0A2G4H1E7      NPQRQ-------TLVINVAFTHPTRDLSRKVAQLFCEAIKKNSEDGRLMMTNPLVEKARI
A0A2G4GZA6      NPQRQ-------TLVINIDFTHPNRDLARQVARHFCDSIKKSSEDDRLMVTNPLIEKARI
A0A388P514      NPQRQ-------TLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARI
A0A2A2YG59      NPQRQ-------TLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARI
A0A2G4F7D5      NPQRQ-------TLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARI
D5EML0          VERGE----NEESQVLNIIITHQNPRIAQQVANTYVDEYIAYKAGLRSSSTGEAVNFLER
A0A3C1C1M3      LANRGRFAIIKRTRLVSVTFTDPDPEFAMRACAAYAAGAEAAARAENRSGSNAAVAWLEA
A0A2E9EYJ1      VETQD----VRGTDLIDIEVYDTDPNLAADIANAVADAYRTRRQEEEQSRAQKALALLDQ
A0A258AXR6      LETQS----MLRSDFVTIDYYDQDPQLAATIANEVAKSYMTQRNNIETGKKHKALEVLQQ
A0A3D3NZQ6      LDTQS----SIRSDFVIIEFFDKDPALAATIANAVADSYMTRRVEVESKQKESALEMLNK
A0A1T4WVZ9      LDTQS----SVRSDFVVIEYFDQDPGVAAEIANAVYQSYMTRRVEVETSQKQEALAMLAK
A0A4R7SSI6      LDTQS----SVRSDFVTIEFYDQEPGAAAEIANAVAQSYMTRRVEVESKQKQDALTMLGQ
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      QVLRLERDLKSEQENLVAFQRTNNLAI----------VQQEA-------------TIAGG
A0A258AXL1      LPVGTIVRREPNPDPFLIKTAGPNVVP----------GATGE-------------QVNGA
A0A2E6T1E0      DIISLEESQNVTLKALIQAQTDFDMAR----------SAEVT-------------AVAAA
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ALKQAQADLDKARSDAAAARK----------------LDEEV------------------
A0A353DI77      AAKERESELETARRRAGSYTPA---------------LEAEK------------------
A0A1V6GCZ3      RFAEQEAKVKAAQERVDNLRKELNISDAMASGDGPSPLMTAE-------------TLRKI
A0A3C1UJT2      --------------DLEDLESVGYVDA----------------------------ASEKA
A0A2S7U0Z3      EADGARLEMELAEKSLQFYVSAIKLSE---------------------------------
A0A5E6MKA7      QMDALRKKMAQSEERLADFMAEAGIAH----------LSPQEKAPAEKESVQIRDSLLRA
A0A2N8IR72      RLKELGASLSDVDKKLTEFKTKSDIVK---------DADTTM-------------SADFS
A0A2N8IV96      VLREQEDAVNEKMMALKKLIAESSYLP-------TSWRNGEHRSTLTAGMEEEEFRNAKA
R7E1V8          VLREQEDTVNEKMMSLKKLIAESSYLP-------TTWRNGENRSTLTAGMEEEDFRNAKS
A0A1T4WWY4      EVTEIRKKVAEQLDSRLQFEEQSALANAQIEMERLSNIPVDI-------------VRAKY
A0A3D3LEQ6      ELADVRAKVTSQLDSRLKFEEESALASAQIELERLSDVPVQQ-------------VRVRY
A0A3D3NW23      ELADVRAKVTSQLDSRLKFEEESALASAQIELERLSDVPVQQ-------------VRVRY
A0A2E0R252      SSDKVKEKMLNLERALRLYKRCLELSD---------------------------------
A0A3E1EF48      KCRELQEGIFKIESSLARYQGCVDLSK---------------------------------
A0A2A2PVG8      SSAEIKERLLDLESTLQLYQRCLELSK---------------------------------
A0A2E0R421      NTNRIRKGILDLERAIELYNNCQDLIT---------------------------------
A0A2E5EJ69      AAEELKVKWLEAQEIAHQYVKSNSLAV------------GMT-------------DMKRM
A0A2G4I5Z5      EEIRIKAGLLKAEVAVQEYLKTNSSSL----------IQGQ--------------NIVTE
A0A4P5QQV6      EIERVAAELRKEEDRLLAFQRDNKTGF----------LEQEG-------------NAAAA
A0A2E7ALI1      QAEEARVGLQEATSALAIYNRA---------------IEAHK------------------
A0A178IDB9      QSEEKRSEVESVERAMQDYRARHNMAA----------LGEAT-------------NIVRQ
A0A290QD69      QAEEKRTELQLIERQKQDFRAKHNMAA----------LGENK-------------GVVQQ
A0A2E7VDS1      QMNKSRKLGQAIDANTRDFKRQHNLAF----------IEDEK-------------KDVAD
A0A178IFJ2      QTEDLRKKAEASERALHAYREKSRMVS----------LEESQ-------------NIVVD
A0A357FSP9      RADQQKERVEELELKMAEYREDNNAVS----------LESQE-------------NIAAT
A0A538NJ59      QVLRLERDLKSEQENLVAFQRTNNLAI----------VQQEA-------------TIAGG
A0A3C1VFY9      QMLRLDPEMRKVDDQVAVFLSTNDVAF----------L-EEA-------------SGVAN
A0A522AC27      EILHLQRDLKKSDEELAEFQKTNSVVL----------LQEQG-------------NNYGM
A0A2A2R174      EETRIKEKLLLAERAAEQYLRTNSSSL----------IQSQ--------------NIVTE
A0A1H2DTI1      ELTKAEATLQTDEDDVLGFQKANNIVF----------LQEQG-------------SSLGS
A0A1V5L462      ELRELDVKIQQIQEAIRRFQQENNTIA----------IKELS-------------EKAAG
A0A2A2R3V9      QVDKSEKEINQVDEEMLSFQKENNVIF----------MEEQG-------------NKNAT
A0A3D3LGD3      QITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNSTVPGAE-------------LRTTG
A0A350ARX4      QLYRLEEEIENQENTVVDFQKENNLIF----------LKEQD-------------SSTGA
B5JIS2          QAEQLQAEISELEGKQRDFRERNNVIS----------LEENQ-------------DLLAE
A0A1H2GQN6      QIEKQRTIVTDAKKKVDDMRLQLGVDIIPGTQNESQLLDQEL-------------EGKQK
A0A512M3Y3      DLDRLKTRIASEQNATAKFEEDNHLIEQYIANNGLESVPGEM-------------LTTKN
A0A4P5R5J1      ELVRLEKDMKLEEEEMHGFQQKNNIGF----------LKEDG-------------NSAAT
A0A4P5YK43      EVKRYEQNLEKARESTLIFKKKHNIGD----------IRDAG-------------LAAQD
A0A2A2RPW6      SEAAIKQRLLKAEHAVAEYRRTKNIS-----------LQDTS-------------DIQTA
B4D1I7          EISRVQADVRKEEEKLVTFQRENNVGF----------LEQGG-------------NSAGA
A0A353F286      ESTEQEDLVDDYRKDLTVLIQQYGIPY----------FDGGSAGNRLGLSEQAMFQSAKG
A0A354FSA6      ESTEQEDLVDDYRKDLTVLIQQYGIPY----------FDGGSAGNRLGLSEQAMFQSAKG
A0A3B9GA54      ESTEQEDLVDDYRKDLTVLIQQYGIPY----------FDGGSAGNRLGLSEQAMFQSAKG
A0A520LEH8      ESTEQEDLVDDYRKDLTVLIQQYGIPY----------FDGGSAGNRLGLSEQAMFQSAKG
A0A2D7B7R6      GRELSQKDLEDAQKALIRFQTKNRITN----------LKERK-------------EQLET
B1ZT68          QAEELRAQVEAVESSLQEFRARNNIAA----------LGENQ-------------NVVLQ
W0J7C2          QADETRAQVEAAEKALQNYREKNNLAA----------IGETQ-------------NVVLQ
A0A2E5K4P7      EIQEKEKDVLVLEAKAVNYKTQFTSLG----------LDSEE-------------NIFLR
A0A0R2XPB1      QLKVLEAEVDAGEDAIVEFQQRNNIVF----------IQEQG-------------AAAST
A0A348NQP1      QLKVLEAEVDAGEDAIVEFQQRNNIVF----------IQEQG-------------AAAST
A0A357FV58      QLKVLEAEVDAGEDAIVEFQQRNNIVF----------IQEQG-------------AAAST
A0A2V6F9Q9      HLIQVEKDLRTAEDEMLEFQKENNIGF----------IQEEG-------------NSAAQ
A0A2V6NZZ3      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6EBU2      QLIQVEKDLRAAEDDMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6EY06      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6ME53      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A538NUU0      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6NIJ1      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6C292      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6D2X0      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V5ZUK1      QLIQVEKDLRNSEDEMLEFQKQNNIGF----------IQEDS-------------TSAAA
A0A2V5XFN9      QLVQVEKDLRNSEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6EZC8      QLVQVEKDLRNSEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6I7Z5      QLVQVEKDLRNSEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A3B9LCP2      QLIQTEKDLRTAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A3C0R669      QLIQTEKDLRTAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6EID2      QLIQTEKDLRTAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6MHB0      QLIQTEKDLRTAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2W5YWL9      QLIQVEKDLRAAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V5NH62      QLIQVEKDLRGAEDEMIEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2W6A620      QLIQVEKDLRNSEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V5PIJ4      QLIEVEKDLRTAEDELLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6K2G8      QLIQVEKDLRNSEDEITEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V5W206      QLIQVEKDLRNGEDEMLEFQKQNNIGF----------IQEQG-------------NSAAQ
A0A2V6MW77      QLIQVEKDLRNGEDEMLEFQKQNNIGF----------IQEQG-------------NSAAQ
A0A2G4GZN8      EIETLEDKVRRLNEQKNGLIKNQKLLS----------IAKDT-------------NTLTA
A0A348NPT1      RADQQKERVEELELKMAEYREDNNAVS----------LESQE-------------NIAAT
A0A2E1KV60      RAEQKKNRVEELELKLAEYRELKNAIS----------LDKQE-------------NIAAE
A0A2D7F4D9      RAEQKKNRVEELELKLAEYRELKKAVS----------LDKQE-------------NIAAE
A0A3R7RBR8      RAEQKKNRVEELELKLAEYRELKKAVS----------LDKQE-------------NIAAE
A0A2E0NH28      RADQQRQRVEELELKLAEYREEHNAVS----------LDQQE-------------NIANE
A0A350AS32      RADQQKERVEELDMKLADYREQNNAVS----------LDSQE-------------NIARE
A0A368BGT4      RADQQKDRVEELELKLAEYREQNNAVS----------LQSDE-------------NIAGA
A0A2E0V4K6      QADVARESLQEANSALAVYNRALETHA---------------------------------
A0A2E6NAH3      RADQQKNRVEELELKLAEYREQNNAVS----------LQSDE-------------NIAAV
A0A2A5VZA5      RADQQKERVEEIELKLAEYRERHNAVS----------LDSQE-------------NIARE
A0A424R295      RADQQKERVEEIELKLAEYRERHNAVS----------LDSQE-------------NIARE
B4CZV9          ELKELVGRLDQQFSEKLDFQDQQDFTKTLILVNSINNLPADL-------------TKLQM
A0A290QE54      RAEQLRKEVEVADQRLQTYMKEQRLVS----------LDSSV-------------NIVSD
A0A1H1SWX2      RAKELQQESEAAEGKLQDYRRKHNLVS----------LDNSM-------------NIVGE
A0A4Q1C9I5      RADELRKDSETAEGRLQDYRRKHNLVS----------LDNSI-------------NIISD
A0A3B9FM17      LLDTSLGKEKKIAADMANYKKEHNLPF----------LEDEK-------------RDTGD
A0A1G3ZL71      RATELRKELGEKEALLQDYKKRHNLIS----------LDDSL-------------NIVAD
A0A556QP09      RATQLQEEARIAEQRLQDYMRAQNLVS----------LDNST-------------NIAQA
A0A2T6DX88      SAEQLRKEAEAADQKLQSYMREHNLVS----------LDNSV-------------NIVSD
A0A2T6CWI7      QASRLEREAQEKEQALQQYMTKHQLTS----------LDTSQ-------------SMSDE
A0A3E1E5C8      QADRLGKDAADAEQKLMAYKKEHNLVS----------LGNST-------------NIVGT
B1ZZ74          RADQLRKEAEQADVKLNAYMQAHNLVS----------LDKNK-------------DIVSE
R7E4L8          RIGKLGGQLGGVDKQVIDYKRNSRIVKD---------MDTTL-------------DATFN
A0A4Q3BVY2      QVDRLEAEISQTLSSLSSVERSQNLTEAMLEQQSLLEIPKQL-------------IQTRE
A0A4P6PCA7      QTEVLRKELEAVELELAGKRQDFQIAT----------LEQRR-------------ESLRA
A0A0E3YV65      QTQELRVKAESSERALQQYREKSGMVS----------LDESR-------------NIVVD
W0J900          QTEDLRKKAEASERALQAYREKTRMVS----------LEESQ-------------NIVVD
A0A2T6DSN5      QAEETRSQLEAATRELQEFRERHNMAS----------VGENK-------------GVIAQ
A0A2V2SMX4      EVESLRKELKQSSVQLEAFQGSNSVVV----------LDQQG-------------NSAGN
A0A317ZIW7      KIKSLEDEINQNEDAIVDFQRKNNIVF----------IQEQG-------------SAAGT
A0A2D7WMI4      LLQKEIQKEENIKRQITALKIKRSVPN----------LEDIK-------------RDNAT
A0A2D6VHX5      LLDKSLMEEDRILKEISDIKESNDIPF----------IEDAK-------------KINSS
A0A2D8I214      LLAQSIEKESQLADEMSAYKKNLGLPF----------IEDEK-------------RDTAD
A0A1Z8VL41      LLENRQSEEKRIAQEMSQFKKGKNIPY----------LEDAK-------------NSIFA
A0A2E6TNA4      LLENRQSEERRIAQEMSQFKKGKNIPY----------LEDAK-------------NSIFA
A0A1Z8RG47      LLQKSIDEESRISGEMSGYKKNNQLPF----------LEDEK-------------KDTAD
A0A1Z8RJJ5      LLQKSIDEESRISGEMSGYKKNNQLPF----------LEDEK-------------KDTAD
A0A2D7V631      LLQKSIDEESRISGEMSEYKKANQLPF----------LEDEK-------------KDTAD
A0A354RA24      LLQKSIDEESRISGEMSEYKKANQLPF----------LEDEK-------------KDTAD
A0A2E9RV62      LLEKSQSREDSILEEMTKYKGERELPF----------VEDER-------------LDNAA
A0A2E4AY96      LLDREMKKEKDIQAKISQYKAEKEAPF----------LEDDK-------------KDISA
A0A3B9B9P4      LLDREMKKEKDIQAKISQYKAEKEAPF----------LEDDK-------------KDISA
A0A2D5Y6N6      LLDKSLQEEERISQEQSSFKKKYDLPF----------LEDEK-------------QDTSA
A0A2E7HSS8      LLENSLSKERKIAYDMSEFKKVNQLPF----------LEDEK-------------RDTGT
A0A2D8VCK3      LLDTSLGKEKKIAADMANYKKEHNLPF----------LEDEK-------------RDTGD
A0A350QVY4      LLDTELSKEKKIAADMANYKKDNNLPF----------LEDEK-------------RDTGD
A0A2E4ZYR7      QMTRSRNAETEIDNKVREFKRRHNLAF----------IADEK-------------KDVAD
A0A2E6TCV1      QMAESRKKEDAIIKQINSFKTNHNLTY----------IEDDK-------------KDNAE
A0A3D4HHL8      EMMDLQKEIESGEDEKLNFQKENNIVF----------IQEQG-------------SSVGA
A0A366HV03      ELGLLKKKIDESLQVKTSFERDNEINE----------LLIKQ-------------NSLAQ
A0A5R8KAF2      EVDTLEGLAVDSYKDLSKLERESRMTE----------VKIEQ-------------SRLFM
A0A2V2SDN0      QVNQLANELKAQQEKMYAFQMSNNVVF----------LQEQG-------------SGAGS
A0A1V6GL40      QVMRLEKDLRRAEAEMVQFQSTNSMML----------TQEQG-------------NSPAH
A0A2V5X6Z6      EVTQLKGELEAQQEKLHAFQASNNVVF----------LQEQG-------------NSAGS
A0A2V5VGZ7      EVTQLKSELEAQQEKLHAFQASNNVVF----------LQEQG-------------NSAGS
A0A2V5U130      EVTQLKGELEAQQEKLHAFQASNNVVF----------LQEQG-------------NSAGS
A0A2V6C237      EVTQLKGELEAQQEKLHAFQASNNVVF----------LQEQG-------------NSAGS
A0A3R8L982      SADRLRDEANAAEQRLLDYMRRENLVS----------LDNST-------------NIVRE
A0A2E7HPU9      KSEEAEKLLNQ-------------------------------------------------
A0A388PR45      EIESLEDKIRRLYEKKNGLVKSGDLLD----------IAGTT-------------NSIAA
A0A388QR61      EIESLEDKVRRLYEKKNGLVKSGELLD----------IAGTT-------------NSIAA
A0A4P5YHI0      EIESLEDKVRRLYEKKNGLVKSGELLD----------IAGTT-------------NSIAA
A0A2A2RS01      EIDLIEERLRKLSDKRSDLIKTQKLLS----------IAKDT-------------TTLNT
A0A2A2Y1A7      EIDLIEERLRKLSDKRSDLIKTQKLLS----------IAKDT-------------TTLNT
A0A388PDH9      EIDLIEERLRKLSDKRSDLIKSQKLLS----------IAKDT-------------TTLNT
A0A2G4H1E7      EIETLEDKVRRLFEQKNDLIKNQKLLS----------IAKDT-------------NTLTA
A0A2G4GZA6      EIETLEDKVRRLYEQKNDLIKSQKLLS----------IAKDT-------------NTLTT
A0A388P514      EIETLEDKVRRLYEQKNDLIKNQKLLS----------IAKDT-------------NTLTT
A0A2A2YG59      EIETLEDKVRRLYEQKNDLIKNQKLLS----------IAKDT-------------NTLTT
A0A2G4F7D5      EIETLEDKVRRLYEQKNDLIKNQKLLS----------IAKDT-------------NTLTT
D5EML0          QVAEMREELELQEVELQDYRQQHNL----VSVQQDKGITADR-------------LARLN
A0A3C1C1M3      QALAQRQELEKADQELFDARQTLQM----------DVLAGRR-------------KTIEE
A0A2E9EYJ1      QIKSQEGRLEKARXNMIELMEELNIVD--LSLGEPVWLRGSQ-------------PNTGT
A0A258AXR6      QISDQEGLRSQAQVRSQEARRKAGIVGDWIVGGGSSLNPGGE-------------MRSEK
A0A3D3NZQ6      QITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNSTVPGAE-------------LRTTG
A0A1T4WVZ9      QIAEQEQLRDQARLKMQEAKKKGGIVGEWFSSGTNSTAPGAN-------------LRTTE
A0A4R7SSI6      QISEQEQLRDQARLKMQEARKKGGIVGEWFSNGSNSTAPGST-------------LRTKE
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      SLARLSTELSDGIL-------------------QTQLLESRALG----------------
A0A258AXL1      NTAR--------------------------------------------------------
A0A2E6T1E0      EEAA--------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      --ERLLHAATSIDA----------------------------------------------
A0A353DI77      -------EMAVAEK----------------------------------------------
A0A1V6GCZ3      ESLRIESQAEYVR--------------------QATRLDRLKN-----------------
A0A3C1UJT2      RPDNLTNEQLEIVS----------------------------------------------
A0A2S7U0Z3      -------QIQEKRN----------------------------------------------
A0A5E6MKA7      RLLMLQKQIRLERA----------------------------------------------
A0A2N8IR72      TSQALEKEIFDLET-------------------QIKLASTLAD-----------------
A0A2N8IV96      QAMDFERREKELAS-------------------YVQELQRLPDD----------------
R7E1V8          QAMQFEKDEKELAS-------------------YVQELQRLPDD----------------
A0A1T4WWY4      RLKEHEEISRILQE-------------------QQSSLDVIGKLSLISGFTDEEKDPLEA
A0A3D3LEQ6      KLQEMDGVRQVLKD-------------------QGGTLDTVGTLALLTSMTSDKDDPLSV
A0A3D3NW23      KLQEMDGVRQVLKD-------------------QGGTLDTVGTLALLTSMTSDKDDPLSV
A0A2E0R252      -------EIRGSET----------------------------------------------
A0A3E1EF48      -------RIETTRI----------------------------------------------
A0A2A2PVG8      -------EIDEAER----------------------------------------------
A0A2E0R421      -------EIKLVES----------------------------------------------
A0A2E5EJ69      ELESIGKELTVSKN-------------------EKLKLDTDWKM----------------
A0A2G4I5Z5      EFKSLSERRSAATD-------------------ERRDMERDFEM----------------
A0A4P5QQV6      YLSKLNTRLAELRN-------------------ESQLLDLFDADQQIARDRKMPK-----
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      KVGLLGNDLAQAQL-------------------EQTTLQTLIQL----------------
A0A290QD69      KVTMLGNSLAEAEL-------------------RQTNLRTLIES----------------
A0A2E7VDS1      RKSQYQGAITLAQV-------------------EKLRIQSTLRQIIAIQGRVEQSTRTTK
A0A178IFJ2      RMKAISSALTEAQV-------------------ALLAIEARLQQ----------------
A0A357FSP9      QLSSLNTIKIENKH-------------------LYDNLETRINL----------------
A0A538NJ59      SLARLSTELSDGIL-------------------QTQLLESRALGLE--------------
A0A3C1VFY9      YLSVLYQRLAESKS-------------------EYDLLQSMTLDQNLLLEQGRSPALAGA
A0A522AC27      YLASLTRKLADLKS-------------------EYDLLTTMTLDQN--IERQRQQGVAST
A0A2A2R174      EFKALNERRAVATD-------------------ERRDVERDFEM----------------
A0A1H2DTI1      HLAQLNNQLVDRRN-------------------EYDLLVKLTAKQGDLQGLP--------
A0A1V5L462      RLSELKTRLEDYRT-------------------QLRILESFD------------------
A0A2A2R3V9      YLINLSKQLDDLNT-------------------EFQLLSKLTLDQNIERRSTNTSKPQTT
A0A3D3LGD3      DSMAVTREQAIFQA-------------------DLDVETLSAEIGQLQ------------
A0A350ARX4      YLARLTTQQAELKT-------------------QLLILENLK------------------
B5JIS2          RLKGIDANRIEARL-------------------DRFRLETKLGN----------------
A0A1H2GQN6      QLDDARQDAVARRV-------------------RYEQLKNLSTEDLIDTLP---------
A0A512M3Y3      RMDSMQQVIEMIES--GKLPAVEQLSLLKKFRGTPVPVGTIMRNSRPDEVVSIAAPIAGS
A0A4P5R5J1      YLSILNRRLDELKT-------------------EFNLLQRLDIDQTLDRTPSVA------
A0A4P5YK43      RLNRLTAELDEIVL-------------------VRKRLESYTKDELLEGKMPEILSKNPA
A0A2A2RPW6      DFKAMAEKLNEAKD-------------------EVRLLELEWGM----------------
B4D1I7          YLAKLNTQLAEFKK-------------------EAQLLDLFQLDQKIA------------
A0A353F286      KLANFETQADQIKI-------------------QIGKLV---------------------
A0A354FSA6      KLANFETQADQIKI-------------------QIGKLV---------------------
A0A3B9GA54      KLANFETQADQIKI-------------------QIGKLV---------------------
A0A520LEH8      KLANFETQADQIKI-------------------QIGKLV---------------------
A0A2D7B7R6      KNNSDRLVLDNLKL-------------------ELSRIQNDLEDLESVGYVDAASEKARP
B1ZT68          KVGTVGTALVRAQM-------------------EQVEMRSVLDK----------------
W0J7C2          KMSSLGTAVVAATL-------------------DQIDAKSLIDK----------------
A0A2E5K4P7      ELTVLREHLIKKDD-------------------VRKAVESRWQQ----------------
A0A0R2XPB1      YLAELKRELAELNT-------------------ENRVLTSILNVDAVKMSLLLD------
A0A348NQP1      YLAELKRELAELNT-------------------ENRVLTSILNVDAAKMSLLLD------
A0A357FV58      YLAELKRELAELNT-------------------ENRVLTSILNVDAAKMSLLLD------
A0A2V6F9Q9      YLVKLNQDFARLKT-------------------EYELLQKLDLDQNLDRGEKTKTEASPG
A0A2V6NZZ3      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A2V6EBU2      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A2V6EY06      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A2V6ME53      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A538NUU0      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A2V6NIJ1      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEK--TESSPG
A0A2V6C292      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEK--TESSPG
A0A2V6D2X0      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEK--TESSPG
A0A2V5ZUK1      YLVKLNQQYAQLKT-------------------EYALLNLLDLDQNLDRAQT-KLDS-SS
A0A2V5XFN9      YLVKLNQQYAQLKT-------------------EYALLNLLDLDQNLDRAQN-RTETAAS
A0A2V6EZC8      YLVKLNQQYAQLKT-------------------EYALLNLLDLDQNLDRAQN-RTETAAS
A0A2V6I7Z5      YLVKLNQQYAQLKT-------------------EYALLNLLDLDQNLDRAQN-RTETAAS
A0A3B9LCP2      YLVKLNREYAGLKT-------------------EHDLLSLLDLDQNLDRAQI-KPESLAN
A0A3C0R669      YLVKLNREYAGLKT-------------------EHDLLSLLDLDQNLDRAQI-KPESLAN
A0A2V6EID2      YLVRLNRDYAGLKT-------------------EYDLLNLLDLDQNLDRAQN-KSEMNLG
A0A2V6MHB0      YLVRLNRDYAGLKT-------------------EYDLLNLLDLDQNLDRAQN-KSEMNLG
A0A2W5YWL9      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGQS-TAKPEAS
A0A2V5NH62      YLVRLNQQYAQLKT-------------------EYDLLSLLDLDQNLDRAQG-KNDMPSA
A0A2W6A620      YLVRLNQQYAQLKT-------------------EYDLLSLLDLDQNLDRTSG-KNDGTTP
A0A2V5PIJ4      YLVKLNQSFAALKT-------------------EYDLLSMLDLDQNLDRKQV-QPDGAGS
A0A2V6K2G8      YLVKLNQQYAQLKT-------------------EYDLLNLLDLDQNLDRAQN-KMDSAGG
A0A2V5W206      YLVKLNQQYAQLKT-------------------EYDLLNLLDLDQNLDRAQN-KTEAASG
A0A2V6MW77      YLVKLNQQYAQLKT-------------------EYDLLNLLDLDQNLDRAQN-KTEAASG
A0A2G4GZN8      ERSVLVRDREETRK-------------------QIDENEILVLV----------------
A0A348NPT1      QLSSLNTIKIENKH-------------------LYDNLETRINL----------------
A0A2E1KV60      ELASLNQIKTAAKM-------------------ELDQSETRWNL----------------
A0A2D7F4D9      QLASLNEIKTMAKM-------------------NLDQAEIRWNL----------------
A0A3R7RBR8      QLASLNEIKTMAKM-------------------NLDQAEIRWNL----------------
A0A2E0NH28      QLMTLNAIKSGNKN-------------------QFDAQETQWNL----------------
A0A350AS32      QLASLNEMKLNAKN-------------------VYDMIETKWNL----------------
A0A368BGT4      QLAHLNEIVLTNKN-------------------TYDQFQTKWNQ----------------
A0A2E0V4K6      ------------------------------------------------------------
A0A2E6NAH3      QLSHLNEIELTNKN-------------------IYDQFQTKWDQ----------------
A0A2A5VZA5      QLVTLNQIKLESKN-------------------NYDQLDTKWNL----------------
A0A424R295      QLVTLNQIKLESKN-------------------NYDQLDTKWNL----------------
B4CZV9          RIDEIGRVRVRLQDPAL----------------DSVAKLSLIASADDNDTRLSVGQTVAQ
A0A290QE54      RLKTVNAALSSARL-------------------DRLQLEELNNQI---------------
A0A1H1SWX2      RLRTVNATLTTARL-------------------ARLDIETLLSQI---------------
A0A4Q1C9I5      RLRGYNTSLTDARN-------------------ARIAIENRLAQI---------------
A0A3B9FM17      RKSQFSSEVTKSRL-------------------EQIRINSLLRQILAIKTRIGSNSNSVS
A0A1G3ZL71      QLRRANEARTAARH-------------------ERLRVENLFRQ----------------
A0A556QP09      NLSSVNQALQGARL-------------------DRLAIAEQERL----------------
A0A2T6DX88      RLKSVNAALQTARL-------------------ERLSIEEQVNQ----------------
A0A2T6CWI7      ALKKAHTMRDDARL-------------------RLMAVDEKITQ----------------
A0A3E1E5C8      RLTTVNDALTKARL-------------------ARIDLETQYHQ----------------
B1ZZ74          RLKTISSTLTSAQL-------------------VRLNFENQYAL----------------
R7E4L8          RVQEIGTELFSTRT-------------------ELIQVKVLARLLAD-------------
A0A4Q3BVY2      RLARMRDVRILLTNLENKASAEGSEGGTGSDQ-KIGNMMSLLSLLGSFENEAEVNVGDIV
A0A4P6PCA7      ILADLGTQKAGLEN-------------------QLALRQTEYDYLSEW------------
A0A0E3YV65      RMKALSSTVTGARV-------------------SRVTIEARLNQ----------------
W0J900          RMKAISSALTEAQV-------------------ARFAINARLQQ----------------
A0A2T6DSN5      KVVQLGQSLVGIEL-------------------EQTNLRTILET----------------
A0A2V2SMX4      YLTALNQRLAGLKS-------------------ELELLRTMSVEQTLER-----------
A0A317ZIW7      YLADLKRRLAELKT-------------------ESRTLSSISDS----------------
A0A2D7WMI4      RKSQYQSEITRCNI-------------------EQLRLDSTLSQIRSILKRINSNKE---
A0A2D6VHX5      KKSQFQAKITASKL-------------------DQIQINSILRQILDIRKRISSNKESSI
A0A2D8I214      RKSQYSAEVTTSKL-------------------EQIKIDSLLRQVLQIQARIGSRNSSS-
A0A1Z8VL41      RXSQYQSEITRSKX-------------------XQXKITTLLKQIINVRVNIGVQNESL-
A0A2E6TNA4      RKSQYQSEITKSKL-------------------EQIKITTLLKQIINVRXNXGXQNESX-
A0A1Z8RG47      RKSRYQAEITKCKL-------------------EQIRINSLLRQILQIQMRIGNETSSL-
A0A1Z8RJJ5      RKSRYQAEITKCKL-------------------EQIRINSLLRQILQIQMRIGNETSSL-
A0A2D7V631      RKSQYQAEITRCKL-------------------EQIRINSLLRQILQIQMRIGAQTSSL-
A0A354RA24      RKSQYQAEITRCKL-------------------EQIRINSLLRQILQIQMRIGAQTSSL-
A0A2E9RV62      RKSSYHSEITKAKV-------------------EKVRINSLLRQIIQIQASISSRIQND-
A0A2E4AY96      KKSQYQAEITRCRI-------------------ERLRIESLKSQVLAVDNKI----KSR-
A0A3B9B9P4      KKSQYQAEITRCRI-------------------ERLRIESLKSQVLAVDNKI----KSR-
A0A2D5Y6N6      RKSQYQSEITSSKL-------------------EQIRINSLLRQILQIQVRIGSQSEST-
A0A2E7HSS8      RKSQYSEEVTKSRL-------------------EQIRINSLLRQILAIKTRIGSGSDSV-
A0A2D8VCK3      RKSQFSSEVTKSRL-------------------EQIRINSLLRQILAIKTRIGSNSNSV-
A0A350QVY4      RKSQFSSEVTKSRL-------------------EQIRINSLLRQILAIKTRIGSSTNSV-
A0A2E4ZYR7      RKSQYQSAITQAQV-------------------EKLKIQSTLRQIIAIQGRVERATNAV-
A0A2E6TCV1      RKSQYQNAITTADV-------------------KLLEIDSHLVSIRGIHNKVVQSLKAL-
A0A3D4HHL8      YLAELNQQLAELET-------------------QYRFLDTLSLDAIGERAQ---------
A0A366HV03      IPLDILRVQHRMRQYDEVRGIVQSRSQNSVIA-PLEHLSLLESAKKSSLDENPVGQLVV-
A0A5R8KAF2      VPAELIMTKEVVRRMEEVRLSLDQRGTLGTAPEKLTAEQIFAELSMLTAFEKERELRVG-
A0A2V2SDN0      YLALLNRQLATLRT-------------------ELQLLQLVQPDQ---------------
A0A1V6GL40      YLTTLYQRLVTLKS-------------------EYALLQRLTLDQNLARRQAAGGTFSL-
A0A2V5X6Z6      YLASLNKQLATLRT-------------------ELRLLQSLQPEQ---------------
A0A2V5VGZ7      YLASLNKQLATLRT-------------------ELRLLQSLQPEQ---------------
A0A2V5U130      YLASLNKQLATLRT-------------------ELRLLQSLQPEQ---------------
A0A2V6C237      YLASLNKQLATLRT-------------------ELRLLQSLQPEQ---------------
A0A3R8L982      RLTSVNAALQTARL-------------------ERLAIENLNNQVEA-------------
A0A2E7HPU9      -------------K-------------------ENALANYQIILLTL-------------
A0A388PR45      QRSKLIQDREDYRK-------------------QLDEIGIVVALVAQ-------------
A0A388QR61      QRAKLIQDREEYRK-------------------QVDEVGIVVALVKQ-------------
A0A4P5YHI0      QRAKLIQDREEYRK-------------------QVDEVGIVVALVKQ-------------
A0A2A2RS01      ERGVLVRNREDARK-------------------QIDELEIIWKLILE-------------
A0A2A2Y1A7      ERGVLVRNREDARK-------------------QIDELEIIWKLILE-------------
A0A388PDH9      ERGVLVRNREDARK-------------------QIDELEIIWKLILE-------------
A0A2G4H1E7      ERSVLVRDREETRK-------------------QIDENEILVLVIAS-------------
A0A2G4GZA6      ERSVLVKDREETRK-------------------QIDENEILVSVIAS-------------
A0A388P514      ERSVLVKDREETRK-------------------QIDENEILVSVIAS-------------
A0A2A2YG59      ERSVLVKDREETRK-------------------QIDENEILVSVIAS-------------
A0A2G4F7D5      ERSVLVKDREETRK-------------------QIDENEILVSVIAS-------------
D5EML0          DAL----------T-------------------DAEIRQLSVETRQR-------------
A0A3C1C1M3      SLLHFNESLSEVEA-------------------KASMEQ-----KML-------------
A0A2E9EYJ1      ASLVMAAKQREFAA-------------------EEAIQNLRSTIKSL-------------
A0A258AXR6      DSMVISREQALMIA-------------------DQEILTLQSEIDQV-------------
A0A3D3NZQ6      DSMAVTREQAIFQA-------------------DLDVETLSAEIGQL-------------
A0A1T4WVZ9      DSMVVTREQALLNT-------------------ELEVQALQAEIAEL-------------
A0A4R7SSI6      ESMVMSREQALLQA-------------------DLEVQSLRAEIDEL-------------
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      -----------LEANGPVGAGVSVGLNGPLLGADSEIPS---TGTSERQGASRDLELLKL
A0A258AXL1      ----------------RLSPEVG--AATPEASTTTIVTPQVAKRANEWEYIEGQLHSSER
A0A2E6T1E0      ----------------RVFHETKQYGTIPEVATDTEVRK-----------IRGDLALAEA
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      -------------------ASTLADNLKESERKQGLISVETGLPDSGIARQIEHYNEAYL
A0A2V6N5E0      -----------DLDQNLDRAQNKTEAASGQGSDNQGMPFSDVGPEGDYLKAKQQIQLLKA
A0A2V6NH44      -------------------------------------PFSDVGPEGDYLKAKQQVQLLKA
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      -------------------------------------------------------NIAEQ
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      -------------------------------------------------------MLLRV
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------IPLVAGNPLIQDMRKS--------------LAEREA
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      -----------LGKELGPEGLAQAITTDAPDTLLTSLLDQ--------------LTMAEQ
A0A3C1UJT2      -----------------------LIPSVAKNEDFKSINGL--------------YKAAKT
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      -----------KAALADGRAGVPENPYTLEIKKLLLKEVA--------------------
A0A2N8IR72      -----------NLKESERKHGLISVETGLPDSGIARQIEH--------------YNEAYL
A0A2N8IV96      -----------KLLDYVISSDLLNAETVGADALRKTYAEF--------------SDKLKE
R7E1V8          -----------KLLDYVISSDLLNAESVGAKALRETYAEF--------------SDKLKE
A0A1T4WWY4      GRVVRK-----GG---AVAPFTFSSPSTDKKFTQVVVQPNMVDGLKSWQELERTKRATEE
A0A3D3LEQ6      GRIVRR-----TGDPRTSAPATFQTPEMAKEYNQIVVQPDMVEGIEPWRELDKKKRSLEE
A0A3D3NW23      GRIVRR-----TGDPRTSAPATFQTPEMAKEYNQIVVQPDMVEGIEPWRELDKKKRSLEE
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      -----------IQQYSNNVERLLTVQSILDDKQVSALRTQ---------------ELEKR
A0A2G4I5Z5      -----------TRRVGGKVSELLILASISRAPEVAALKEK--------------LQVQEA
A0A4P5QQV6      -----------PDGGDLREGDPRIPSATGPLLEYERARQR--------------IETLKA
A0A2E7ALI1      ------------------------------------------------------LLELEA
A0A178IDB9      -----------IEDYRKRGQSLYEISAIIGFGNVASLKTQ--------------YENILA
A0A290QD69      -----------VEDYQKNNKNILEISDIASYGNVSEMKTR--------------IDTLRA
A0A2E7VDS1      DNEHAR-----TNDEMEKIKEYFEISAVETYGNVQALRQK--------------LLDLET
A0A178IFJ2      -----------AESVIAKNSSPLELASITEFSSLASVQSQ--------------LDELVA
A0A357FSP9      -----------IESFRRAGRNLSELPFIAEQGQVSQLLSQ--------------ISAIKI
A0A538NJ59      -ANGPVGAGVSVGLNGPLLGADSEIASTGTSER-QGASRD--------------LELLKL
A0A3C1VFY9      GMPGGLGTGNGILANAALGGQSTLFAPSTMGMQYLSIKQQ--------------ILLLKA
A0A522AC27      SSEAGSERGG--------GGRNANYE--------LTYQKR--------------TVLL-A
A0A2A2R174      -----------TRRVGVKVAELLTLSTVSRVPEVVALKEK--------------LQAQEA
A0A1H2DTI1      -----------VVAGASNSQQESRMRLAAATTEFFKAQQK----------AQERITELET
A0A1V5L462      -----------ENVSLDQIQDVVNLDTIESSQNYRNTKRQ--------------HQQLLA
A0A2A2R3V9      TKNPATTNTAEKRTPDSEEIKAAAGDLLSPESEYRNSNQQ--------------IQLLLL
A0A3D3LGD3      -----------TLEGDELVARAGGLKL--DNANVAQMTGE--------------LQRLEV
A0A350ARX4      -----------TGDITTSVVEQSPLIEAESVALLNKTQQE--------------WTQLKA
B5JIS2          -----------VKAALGEDGRPFDNPFLANFANNERLRQE--------------LDKLNG
A0A1H2GQN6      -----------SLGLNDANIDQIRQQELQGSANIQSLLKG--------------------
A0A512M3Y3      TVAGLSSDSPSAPIPAVPAGASAGAMMIAAMSQPKIVVPSMVEELEPWERTERDLRVARQ
A0A4P5R5J1      -----------TGAEGQLNRMDSLAGAPGPLAEYLKVKQA--------------INQLKA
A0A4P5YK43      KDAASAVTAGPDKSKTADPLAPFRQNSYTEHKLNLKAREA--------------------
A0A2A2RPW6      -----------SQKVGNSVDELLKLPMISRSPEVAALKEK--------------LQSHEA
B4D1I7          -----------ADESRAGDKDGERNPRLTGQPEMEYTHAR------------QQIEVLKS
A0A353F286      -----------QLTSEELISYAAGLDLPQNQVTAYALQNR---------------SAVDR
A0A354FSA6      -----------QLTSEELISYAAGLDLPQNQVTAYALQNR---------------SAVDR
A0A3B9GA54      -----------QLTSEELISYAAGLDLPQNQVTAYALQNR---------------SAVDR
A0A520LEH8      -----------QLTSEELISYAAGLDLPQNQVTAYALQNR---------------SAVDR
A0A2D7B7R6      -----------DNLTNEQLEIVSLIPSVAKNEDFKSINGL--------------YKAAKT
B1ZT68          -----------IDEYRKEGKDLFEIPAILGYGQVSALRTR--------------YAELQA
W0J7C2          -----------IEEYQAGNRDLLEITQIRTSGQVADLNNS--------------LISLLT
A0A2E5K4P7      -----------LLAYEAEGRSLLDLGFISNTTHVATLVAR---------------NSLKK
A0A0R2XPB1      -----------QWQGAEDTSSATTGGSAGDNQSYQLSKKQ--------------LQVLHA
A0A348NQP1      -----------QWQGAEDTSIAASGGSDGDDQSYQYSKKQ--------------LQVLHG
A0A357FV58      -----------QWQGAEDTSIAASGGSDGDDQSYQYSKKQ--------------LQVLHG
A0A2V6F9Q9      --------------ASPTDQAGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V6NZZ3      --------------PSANDQVGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V6EBU2      --------------PSANDQVGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V6EY06      --------------PSANDQVGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V6ME53      --------------PSANDQVGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A538NUU0      --------------PSANDQVGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V6NIJ1      --------------ASPTDQVGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V6C292      --------------ASPTDQVGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V6D2X0      --------------ASPTDQVGMPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V5ZUK1      --------------GQASDNQGLPFADVGPEADYLKAKQQ--------------AQMLKA
A0A2V5XFN9      --------------NQPVENGGLPFSDVGPEADYLKAKQQ--------------VQLLKA
A0A2V6EZC8      --------------NQPVENGGLPFSDVGPEADYLKAKQQ--------------VQLLKA
A0A2V6I7Z5      --------------NQPVENGGLPFSDVGPEADYLKAKQQ--------------VQLLKA
A0A3B9LCP2      --------------GQTAEDQGLPFAGVGPEGDYLKAKQQ--------------LQLLKA
A0A3C0R669      --------------GQTAEDQGLPFAGVGPEGDYLKAKQQ--------------LQLLKA
A0A2V6EID2      --------------GQSTEDQGMPFSGVGPEGEYLKAKQA--------------VQLLKA
A0A2V6MHB0      --------------GQSTEDQGMPFSGVGPEGEYLKAKQA--------------VQLLKA
A0A2W5YWL9      P----------SASASEQT--GMPFSDVGPEGDYLKAKQT--------------VQLLKA
A0A2V5NH62      P----------NTQSNDDKPPGMAFSDVGPEGDYLKAKQA--------------LQLLKA
A0A2W6A620      P----------STQSTDEKAPGMAFSDVGPEADYLKAKQT--------------LQLLKA
A0A2V5PIJ4      T----------NTQPSDDSA-GMAFTDRGPEGDYLKAKQA--------------LQVVKA
A0A2V6K2G8      A----------N--PGSDNQ-GLPFSDVGPEGDYLKAKQQ--------------VQLLKA
A0A2V5W206      --------------QGSDNQ-GMPFSDVGPEGDYLKAKQQ--------------IQLLKA
A0A2V6MW77      --------------QGSDNQ-GMPFSDVGPEGDYLKAKQQ--------------IQLLKA
A0A2G4GZN8      -----------IASYESEGRPVGDIPQIRADNDVAAAQTA--------------ISGSKI
A0A348NPT1      -----------IESFRRAGRNLSELPFIAEQGQVSQLLSQ--------------ISAIKI
A0A2E1KV60      -----------IQDYLRQNKDLWELPFISQQIRVASLTEQ--------------ISNIRI
A0A2D7F4D9      -----------TQDYQKQGKELWELPFISEQIRVATLIEQ--------------ISAIRI
A0A3R7RBR8      -----------TQDYQKQGKELWELPFISEQIRVATLIEQ--------------ISAIRI
A0A2E0NH28      -----------IESYRRDGRDLWELSFIADQSRVAFMLQE--------------VSKTKI
A0A350AS32      -----------VESYRREQRDLWELSFISEQSRVASLLES--------------ISQAKI
A0A368BGT4      -----------VETYRKEGRNLWELAFVAEQLRVSSLLQQ--------------ISSTRI
A0A2E0V4K6      ------------------------------------------------------ALEVEE
A0A2E6NAH3      -----------IETYRLEGRNLWELPFVAEQSRVASLLQQ--------------VSSTRI
A0A2A5VZA5      -----------IETYKREERKLWQLTFVAEQSRVSRLLES--------------ISATRI
A0A424R295      -----------IETYKREERKLWQLTFVAEQSRVSRLLES--------------ISATRI
B4CZV9          PQSGQSADKKDAAANNSVVVVPSLLKSLHPWDELAQQQQQ-----------------VKK
A0A290QE54      -----------ASFKKDA-RNLLEIAAISNHGTIPAVSSQ--------------LSELTR
A0A1H1SWX2      -----------EKMQKENPANLLEIGYISAYGNIPVLKNN--------------LAELNK
A0A4Q1C9I5      -----------ERMQQAG-GNLLDIDYISAYGNVAALKTQ--------------LTDLQN
A0A3B9FM17      SKD--------IKDDIAVIKEFFEIDAIEQFGNIPALRQT-----------LYDLEKTRR
A0A1G3ZL71      -----------VEAYRQNGRDLLELSEITGYGNIPALRNQ--------------LSELLQ
A0A556QP09      -----------VERYQAEKRNLLEITAIAAYGSVPDLSKQ--------------LETLNR
A0A2T6DX88      -----------VASYKREGRDLLQISSIANHGTIPAIRTQ--------------LADLQR
A0A2T6CWI7      -----------VEAYQKEKRNLFEVVEIANYGAVPSLRAQ--------------LSTLQQ
A0A3E1E5C8      -----------VEAYRKEGRNLMEIAYIAGHATVPTLKNQ--------------LSNLHQ
B1ZZ74          -----------VEAYRKEGRNLVEIQFIAGHGTVPTLSAQ--------------LSSLLQ
R7E4L8          -----------RSRQQDMIPANIGIQDAGIAKQIELFNDNFL------------------
A0A4Q3BVY2      PNGQFKGSLTSVKTPETNIVSPAEVDSIEPWRKLEKERRL------------------LI
A0A4P6PCA7      -----------EESGRSIETLPTGLPKEQQLYELLGVWQT------------------AL
A0A0E3YV65      -----------AEFIMAGGGDPLELAAATEFANLSAVQSQ--------------LDTLRT
W0J900          -----------AESIISKNSDPLELASVTEFSSLASVQSQ--------------LDGLIA
A0A2T6DSN5      -----------IETYQKNNRDLMEIPQIASFGGVGALRGE--------------LENLKA
A0A2V2SMX4      -----------RQQGGGVLPAPEPVADVNNSASSSLSAND--SSQNDYFKAKQQIALMEA
A0A317ZIW7      -----------SEVEELILKDVPTPDDGSSDGTIVSAIGS-KEDNEKYTEAKNQLDQLKA
A0A2D7WMI4      ----SSNS---IEERFELFSEIFKIDEIENFANIPALRSS-----------LFELYKQRR
A0A2D6VHX5      DSTNTGVD---VESNIAQIKQYFEIDVIEGFGSIPSLRQE-----------LLEHELQRK
A0A2D8I214      ----RSKD---IDNDIALIKDFFEIDAIESFGNVPSLRKT-----------LFDLEKTRM
A0A1Z8VL41      ----KSQD---IETDIAMIKEFFEIDAIESYGSVPALRKN-----------LFDLEKTRR
A0A2E6TNA4      ----KSQD---XEXDXAXIKEXFXIDAIESYGXVPAXRKN-----------LFDLEKTRR
A0A1Z8RG47      ----QSAD---VAGDIAVIKEFFELDAIESYGNIPSLRQT-----------LYNLELTRK
A0A1Z8RJJ5      ----QSAD---VAGDIAVIKEFFELDAIESYGNIPSLRQT-----------LYNLELTRK
A0A2D7V631      ----KSDD---VEGDIAVIKEFFELDAIETYGSIPSLRKT-----------LYDLETTRK
A0A354RA24      ----KSDD---VEGDIAVIKEFFELDAIETYGSIPSLRKT-----------LYDLETTRK
A0A2E9RV62      ----GASKD--VNANIDAIKEYFKIDAIESFGNVPALQKR-----------LFDLEQSHK
A0A2E4AY96      ----KVES---IEERYALFGEFFKIKEINQFGRIAFLRED-----------LQKLYSTRK
A0A3B9B9P4      ----KVES---IEERYALFGEFFKIKEINQFGRIAFLRED-----------LQKLYSTRK
A0A2D5Y6N6      ----SSQD---IDDDIAVIKEFFEIDAIESYGSIPSLRQN-----------LYDLESKRR
A0A2E7HSS8      ----SSKD---VNDDIAVIKEFFEIDAIEEYGNIPSLRQT-----------LYNLEKTRR
A0A2D8VCK3      ----SSKD---IKDDIAVIKEFFEIDAIEQFGNIPALRQT-----------LYDLEKTRR
A0A350QVY4      ----SSKD---IKDDIAVIKEFFEIDAIEQFGNIPALRQT-----------LYDLEKTRR
A0A2E4ZYR7      ----KDNEHARANAETDKIKEYFEISAIEGYGNVQTLRQK-----------LLDLETIRK
A0A2E6TCV1      ----TATGPARTTAKIKIIEDFFKISAIAEYGNVNSLRTE-----------LQEHEKTRK
A0A3D4HHL8      -------A---VAELAKAKRKNNTEVVPAENHSGAALTSELYKLSEQYLVAKKELNLLKA
A0A366HV03      ----PASG---DLKDALLVPSNSPAPLAAPSIVVQPSMVEGLNSWQMLERDKRKVET---
A0A5R8KAF2      ----DLLR---RQSQQGMVDKPEGAPAQPVPASFVVQPNM--VEGLRPWQDLEKKRRVIE
A0A2V2SDN0      -------W---VEIGSRTRPSGPGEPP-AGEASPQDIMAGLTGPQSDLFRANQQIRLLKD
A0A1V6GL40      ----GNEP---LAEGNDSLPDTNAVALTAGGTPGQSSTAAGDRGDTAYLQAQQQLLLLRV
A0A2V5X6Z6      -------W---IETGHKGVPSG----------EMLASLAE---PQLELFKANQQMQLLKA
A0A2V5VGZ7      -------W---IEAGHKVVPSSESLPDQATEKEMLASLAE---PQLELFKANQQMQLLKA
A0A2V5U130      -------W---IETGHKGVPAGESLPDPATEKEMLASLAE---PQLELFKANQQMQLLKA
A0A2V6C237      -------W---IETGHKGVPSGESLPDQAAEKEMLASLAE---PQLELFKANQQMQLLKA
A0A3R8L982      -------F---RKDNKDL----IELNIISTYGTVPALRAQ--------------LAEHLR
A0A2E7HPU9      -------E---DLEKREA------------------------------------------
A0A388PR45      -------Y---RAAGRDL----SEIPLVRSDADVAAARAK--------------MTDAQT
A0A388QR61      -------Y---RVAGRDL----AEIPLVRADVEVTNTRNK--------------VAEETA
A0A4P5YHI0      -------Y---RVAGRDL----AEIPLVRADVEVTNTRNK--------------VAEETA
A0A2A2RS01      -------Y---KTAGKDA----YDIAQVRTDERVAALGPK--------------VTELRV
A0A2A2Y1A7      -------Y---KTAGKDA----YDIAQVRTDERVAALGPK--------------VTELRV
A0A388PDH9      -------Y---KKATKDV----YDIAQVRTDERVAALGPK--------------VTELRV
A0A2G4H1E7      -------Y---EQEGRSL----GDIPQIRADTDVATTLTA--------------LSASKI
A0A2G4GZA6      -------Y---EKESRPL----GDIPQIRADTDVAAVQMV--------------ISASKI
A0A388P514      -------Y---EKEGRPL----GDIPQIRADSDVAATQTA--------------ISASKI
A0A2A2YG59      -------Y---EKEGRPL----GDIPQIRADSDVAATQTA--------------ISASKI
A0A2G4F7D5      -------Y---EKEGRPL----GDIPQIRADSDVAATQTA--------------ISASKI
D5EML0          -------Q---IAAADGVIDRLMEIPYIGERDAVNAVYAQ--------------LSELKR
A0A3C1C1M3      -------D---ALSEGKLPAEIPG------AADVAASLDR--------------WRQAMT
A0A2E9EYJ1      -------T---QLEGAELIKSAVDLGV--KNETLNSGWSE--------------YQTLEL
A0A258AXR6      -------S---KLTPDELIDQASGLRL--ENQNITAITVK--------------LQDLKV
A0A3D3NZQ6      -------Q---TLEGDELVARAGGLKL--DNANVAQMTGE--------------LQRLEV
A0A1T4WVZ9      -------S---KLSDEELVARSSGLKL--ENANVTNMLAE--------------LTRLQV
A0A4R7SSI6      -------S---KLEGDELVSRASGLKL--ENTNVTGMMAD--------------LNKLQV
                                                                            

A0A4Q3AQI1      -----------------------------------------------RRQDAEAVEAIRR
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      -QRERLSKFLRPKHPKIAQLDTQIQRAEKLIELFRNQSREQIAAA--QQVLKLKMNGIQT
A0A258AXL1      -EYERLSNSLLPGHEKMRELRKQIENYQFSLDAEWKKQIASFHLE--KEHLQQRLESLQD
A0A2E6T1E0      -ELAELLKRYLDKHPKVIEKRGKIESLIEGLASSQKRIFDSIINK--AELAKATALNLKG
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      -EYQKIAGSAGSQNPITVSLKDRMNSTRAAANKALSNYRSNLDLK--LNQLIDKRNSLTE
A0A2V6N5E0      -ERETLAKDLRPNHPKILKLNDEITKQDKLIQLFRADALEKLKTR--RESIGKQMENLQA
A0A2V6NH44      -ERDTLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAFEKLETR--RKSIGKQMENLQG
A0A432FDF6      -TLANHGIDLGEEHPRIKGLKKVVATLEGQIDNRIKGILAGLGLR--VNSSQAQVEQLQR
A0A522ACN3      -RLLALRKEHGEDHPEVINTQKQIDLLNTKIEARVSGIMYSLSNQ--VEIARSEVGALKR
A0A353DCA1      --------------------------MKQMV-----------------------------
A0A3C1AXQ2      -----VNSGRGREHPEVEGVDSQILLSKQLILDAVKSHLSALQTR--MDFAIKRRASLQN
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      --------------------------------------------Q--LSMAEQQFQNSKE
A0A356FSV4      ----------------MIQLLQRLQESEIELTEAVTNSTDKIYAA--YIEAKRNFEVSSQ
A0A3D3DET9      -EQQELGRYLRPNHPKMIAMQEDIARREELLKILRTQSEEQLKNR--KELLAVEIEILEK
A0A355SVK9      -------------EVELVSAVEN--------------SVGKVDSA--YAEAKTNFELASR
A0A2E5D7I3      --------------------------------------------------------VELK
A0A2V5NYE2      -------------HPKIIAATEEIAHLERLLPIYREQSNEQLTNK--LNSLDMQIKNRRK
A0A2V6FIP7      -LLANLLKRYKDKYPDVIRVREEIASLKESIQKESQKVRQAIRAE--AELAKAKETTMAS
A0A353DI77      -AVQDLSIRYGPKHPKIISATDHIDLKTKILLSAMMDVLSNDLETDYWRGFQDQIDDVKN
A0A1V6GCZ3      -RLIALEADYGPENTEVLKCKGLAEDLHKKIKSRVEGIMLGLDTR--VLSLSNSLVNLQQ
A0A3C1UJT2      -TVRNLEVDLKSKHPLMIDALRNVNNTRRVLLETISDVPKGLYAQ--IKYQQEFIEELTQ
A0A2S7U0Z3      -QVIILRQRYLPKHPARIQEEALYTDLLESFGGAIKRSSGKPSEKSYWLEYKDEMDALEK
A0A5E6MKA7      -RYQQMEETYKPEYPGMTRLHAEIEGLKGELAQEKEGSVADLEAD--FEAAKANYEGLEQ
A0A2N8IR72      -EYQKIAGSAGSQNPIAVSLRDRMNSTRAAANKALSNYRSNLDLK--LNQLIDKRNSLTE
A0A2N8IV96      -KENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLKSK--LEMVAASRKHWEA
R7E1V8          -KENLKAQNIGARHPKMLALLETERILGEKLNKELIGLRSSLKSK--LEMVSASRKHWEA
A0A1T4WWY4      -KLRLIQTKFLDDHPEVIKLKDELKQVESALDIELKVALTSFDLE--KARLTEKLEELDG
A0A3D3LEQ6      -KMAQSRAKFLDDHPEMIKLREELRETVSALELELQVARRAFDLE--YEKLKEQLVELEA
A0A3D3NW23      -KMAQSRAKFLDDHPEMIKLREELRETVSALELELQVARRAFDLE--YEKLKEQLVELEA
A0A2E0R252      -AIAQMEKRYLPKWPALVEAKELGAILKKNFSKELDQVIRLSDEE--KAFWEQHSESFSS
A0A3E1EF48      -AIIEMEKRYLPKWPDLIEAKELLALLLNRFSTELAQVIAGSAEE--QRFWKENASVLAG
A0A2A2PVG8      -QVAEMEKRYLPKWPALVEAKELLKILQDRFVQEFNQVMNLSEEE--RKYWETSLASLQG
A0A2E0R421      -RIAGMEKRYLPKWPALVESKEHSKILKQRFSAELERVLRLSEEE--RQFWEDAGTSIAD
A0A2E5EJ69      SEISQLEERYREKHPKMIAARKEVVDLGARLQEAILAAPSKVHTT--ILTLSSQIDSQQG
A0A2G4I5Z5      -TLANHQLRYREKHPEMIKAKTELESIRQQFEVEVLKAPLRLNQQ--LQAAIDKEKGLEL
A0A4P5QQV6      -ERAGYARDLTPRHPIMVELDEQIAQQQQLIDTFRKQSTEELKRR--RDATTLEIRNLET
A0A2E7ALI1      IKVSDLARRYRAKHPKMISTVAKLEDSRKKFMSEFLVAASSAADK--SYWEGAGAELQQI
A0A178IDB9      -ERTALAERYLEEHPRMRQNALALADTRARLDAAVDLAIAETHAR--LNLARQHEQRLRS
A0A290QD69      -ERRQLDERYLSEHPRMKQNQLAMEDAEAGFKSAVDLAIAELKNR--FNFAKQHELRLRT
A0A2E7VDS1      -TRKAFEVKYLEKHPKMSANTRAVQELHRLLRLEVKTAIKDLTNR--VSEMASQESEFTK
A0A178IFJ2      -RKAVMAEKYGRRHPAMIDQERSIQALEKLRGDLILTAVANLRNQ--REKALENERQLQR
A0A357FSP9      -GISSSSKRYREKHPVMIEQQQTLQESEVELAAAVKDSVDKLSSA--LVEAKSNFELASQ
A0A538NJ59      -QRERLSKFLRPKHPKITQLDTQIQRAEKLIELFRNQSREQIAAA--QQVLKLKMNGIQT
A0A3C1VFY9      -EQDRFGEFLKPKHPKMVAMNEESEKMGRLLGIYRDQSVEQLEAK--KSALALQIKNLEN
A0A522AC27      -EKERLEEYLRPKHPRLIGINEEIAQQERLLNTYRKQTSEYLENL--KKSLELQITNVEK
A0A2A2R174      -VLVNHQLRYKEKHPEMIKARAELESIRQQFEAEVLKAPLRLGLQ--LQAAIEKEKGLEA
A0A1H2DTI1      -QMKEEEEYLRPAHPKRVALAAQIADLKRSITLSKEQNIEEANVR--RETLALEIQHLEA
A0A1V5L462      -MKEQFGIYLKPKHPRMMDIEAELEILSNRIRIFRAQAFGQIEEE--KSALRNRIDTLLP
A0A2A2R3V9      -QRDELSQYLKPKHPKIIALNAEIQRQQTLLDMFKKQSIEQLNNR--REGLRLQIQNLQE
A0A3D3LGD3      AREGLVNQGRGRRHPEVLANDSQITKYKELIAAAAKDHLAGLQNR--LESARKRKEALEA
A0A350ARX4      -QLEEYSLYLKPKHPKIIDLELNIERATNLIDILERQTTDSLDDR--KDQLRRQIQNLDA
B5JIS2          -QREVMALRYGRNHPKMRDLDSRIEAVEGNLNRNMEMALKDLEGQ--YTNVVSLEKRLDD
A0A1H2GQN6      --------GFGEEHPRVQSLRAAVGRAQEQLKSLAEGKRRALLID--LNVSEEKLKLLEA
A0A512M3Y3      -KREQAAQTYLPGHEIMRNLDREITDLEASLSSEVNTAITSFRLQ--KEQMAARMQELSK
A0A4P5R5J1      -DRQEFLQTLKPKHPAVVALDEQIAKNEAMLGTYKQLGQDAITSR--RGAIKTQIESLDD
A0A4P5YK43      -EYFRYQATLKPKHPFLVSLQNEIQRTRQELQFQLDNIEERRRAE--IEKLRKDEIGLRP
A0A2A2RPW6      -ALSNLQLRYKDKHPTMIQARNELSTLKAQFEVEIRRAPERLKLM--REGAMAKEKKLEQ
B4D1I7          -ERAEYAKDLRSKHPIMVELDRQIAQQQQLIDAFRKQSAEDLQHR--REATRLEIENLEK
A0A353F286      -MLDLEAQGIGKKHPDMVTMKQRAEGALAKAHEEVISLKEVLKTK--LDLVEQQVLKMRE
A0A354FSA6      -MLDLEAQGIGKKHPDMVTMKQRAEGALAKAHEEVISLKEVLKTK--LDLVEQQVLKMRE
A0A3B9GA54      -MLDLEAQGIGKKHPDMVTMKQRADGALEKAHEEVISLKEVLKTK--LDLVEQQVLKMRE
A0A520LEH8      -MLDLEAQGIGKKHPDMVTMKQRADGALEKAHEEVISLKEVLRTK--LDLVEQQVLKMRE
A0A2D7B7R6      -TVRNLEVDLKSKHPLMIDALRNVNNTRRVLLETISDVPKGLYAQ--IKYQQEFIEELTQ
B1ZT68          -QRKLLGEKYLRLHPKMTQNELETTETKRLLDEAAAQAIANLETR--NRIAAQHEIRLRA
W0J7C2          -QRTLLAEHYLGEHPKMKQNEAETRETRRMLAESIAKAVADLRAR--YDVSAHYLQRLQA
A0A2E5K4P7      EELGLLAARYRSKHPKMLQALQAQALVKKELDNAILMARNKAEAE--HLLATVHYKEAQR
A0A0R2XPB1      -QLDEFSIYLQPKHPKIIGLKNQIERTENQLEIQRDQTLRRIRER--QSVLNNTAANLTL
A0A348NQP1      -QLDEFSIYLQPKHPKIIGLKNQIERTENQLEIQREQTLTRIRER--QSVLNNTAANLSL
A0A357FV58      -QLDEFSIYLQPKHPKIIGLKNQIERTENQLEIQREQTLTRIRER--QSVLNNTAANLSL
A0A2V6F9Q9      -ERDTLSQDLRPRHPKIIKLNDEISKQEKLIAVFRADAVEKLETR--RKSIGKQMENLQS
A0A2V6NZZ3      -ERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETR--RKSIGKQMENLQG
A0A2V6EBU2      -ERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETR--RKSIGKQMENLRG
A0A2V6EY06      -ERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETR--RKSIGKQMENLQG
A0A2V6ME53      -ERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETR--RKSIGKQMENLRG
A0A538NUU0      -ERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETR--RKSIGKQMENLRG
A0A2V6NIJ1      -ERDTLSLDLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETR--RKSIGKQMENLQG
A0A2V6C292      -ERDTLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETR--RKSIGKQMENLQG
A0A2V6D2X0      -ERDTLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETR--RKSIGKQMENLQG
A0A2V5ZUK1      -ERDTLAKDLRPNHPKILKLNDEVAKQDKLIELFRADTLERLKTR--RESIGKQMENLQG
A0A2V5XFN9      -ERDTRAKDLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTR--RESIGKQMENLQA
A0A2V6EZC8      -ERDTLAKDLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTR--RESIGKQMENLQA
A0A2V6I7Z5      -ERDTLAKDLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTR--RESIGKQMENLQA
A0A3B9LCP2      -ERDTLAKDLRPKHPKIVKLNDEISKQEKLIDLFRADTVEKLETR--RKSIGKQMENLRA
A0A3C0R669      -ERDTLAKDLRPKHPKIVKLNDEISKQEKLIDLFRADTVEKLETR--RKSIGKQMENLRA
A0A2V6EID2      -ERDTLAKDLRPKHPKILKLNDEISKQEKLIDLFRADTVEKLETR--RKSIGKQMENLQA
A0A2V6MHB0      -ERDTLAKDLRPKHPKILKLNDEISKQEKLIDLFRADTVEKLETR--RKSIGKQMENLQA
A0A2W5YWL9      -ERDTLAKDLRPKHPKILKLNDEITKQEKLIQLFRSDAVEKLETR--RKSIGKQMENLLG
A0A2V5NH62      -ERETLSKDLRPKHPKIIKLNDEVTKQEKLIELYRQDTVEKLDTR--RKSIGKQMENLQT
A0A2W6A620      -ERETLSKDLRPKHPKIIKINDEITKQEKLIELYRQDTVEKLETR--RKSIGKQMENLQT
A0A2V5PIJ4      -ERDTLAKDLRPRHPKILKLNDEIAKQENLIKLFREDSIEKLDTR--RKSIGVQMENLEK
A0A2V6K2G8      -ERDTLAKDLRPNHPKIIKLKDEISKQEKLIELFRADTLEKLKTR--RESIGKQMENLQT
A0A2V5W206      -ERETLAKDLRPSHPKILKLNDEITKQDKLIQLFRADALEKLKTR--RESIGKQMENLQA
A0A2V6MW77      -ERETLAKDLRPNHPKILKLNDEITKQDKLIQLFRADTLEKLKTR--RESIGKQMENLQA
A0A2G4GZN8      -RVSQMTETYTDQHPKLVAEREALKQLERQLKEATTQAIKSRRSS--LDNAKARHEAILR
A0A348NPT1      -GISSSSKRYREKHPVMIEQQQTLQESEVELAAAVKDSVDKLSSA--LVEAKSNFELASQ
A0A2E1KV60      -AMSTMSKRYREKHPEMRSLLQQLQESQSELDYAVQNAVDNLNAS--FKEAKDNFAQASK
A0A2D7F4D9      -AISTKSKRYREKHPEMRSLLQQLQESQSELEYAVQNAVDNISGY--FAESRDNFKQASK
A0A3R7RBR8      -AISTKSKRYREKHPEMRSLLQQLQESQSELEYAVQNAVDNISGY--FAESRDNFKQASK
A0A2E0NH28      -EISSLGKRYRSKHPVMIQLLQRLQESEIELTEAVTNSTDKIYAA--YIEAKRNFEVSSQ
A0A350AS32      -QISSLSKRYREKHPVMIQLLQQLQESEAELSSAVQNAVNKLDSS--FSESKSNYEVASQ
A0A368BGT4      -SISSASKRYREKHPAMIELLQTLQEGELELELAVQNSVDKIYAG--YSESKSNFEMASL
A0A2E0V4K6      VKVADLARRYRGKHPKMIAASAKLAAAKGSFLEEFLVAARSPVDK--SYWEGVSDQLGTI
A0A2E6NAH3      -EISSLGKRYREKHPAMIQLLQTLQEGELELSRAVQNSVDKIYAG--YSESKSNYEVASL
A0A2A5VZA5      -EISSYSKRYREKHPIMIQLLQTLQESEIELQEAVTNSVDKLYAS--YIEAKSNFELSSK
A0A424R295      -EISSYSKRYREKHPIMIQLLQTLQESEIELQEAVTNSVDKLYAS--YIEAKSNFELSSK
B4CZV9          -EISEGLRKYLPTAGAMKPLYQQLDVINQRLDAEVEVATNRFNLE--YQELLNKKHDLEA
A0A290QE54      -QQSVLAQRYFERHPKMIELEKSIKAAREQLTRATDLAIADLHAS--LEKSRANEKSLEQ
A0A1H1SWX2      -QQAILSERYLERHPKMIELANSIDVVTAQITRNIEQSISDLRTQ--YVKLQDTEASYIK
A0A4Q1C9I5      -QQSILSERYLERHPKMINVANSIDVLTAQIKTDIAQAIAALRAQ--HETLKQTEASYVR
A0A3B9FM17      -DYEETGSGYLERHPKMLENARSVQQVKSALRQSVTSAIEDLRDK--HIQLSAQEKEFAD
A0A1G3ZL71      -TQKVLSDRYLERHPRMIELARQIATVRADLEKSIQLAVADLSAS--LEKARDGEQTFEK
A0A556QP09      -DHSLLAERYLERHPKVINVVNAIHVAQEQLDTAIRLSIADLKTS--LERAVAREKTLEK
A0A2T6DX88      -QQSVLSERYFERHPKMMDLARAIKVSQDQLASAIDLAIADLQAS--LEKARANEKSLEQ
A0A2T6CWI7      -EQNILSERYYERHPRMIDVANRIDVTEKELAKAVQLAIDDLRAR--QAEARQAYESFSA
A0A3E1E5C8      -NQSVLGERYLERHPKMVDLANQVTVVQDQLEKAVDLAVADLATQ--LSEARQSEANLQT
B1ZZ74          -SQSVLAERYLERHPKMIDLANSIAIVQEQLGKALDLAIADLGTR--LNEARENERTLQE
R7E4L8          -QHKKLFASAGRQNPMVSSLAENMKEMRESIGRSIANYCNALEVR--MGELEKERNELNR
A0A4Q3BVY2      SQIRQNSTIYQPGHRVMKDLEKKLEDTERALETEFKMLRQKFDLN--FAGLTEKEKQLEA
A0A4P6PCA7      DEFQRVSEKYTEKHPRYQEAKRAEERALSRLDQFVEVSWKAIQNE--LTLLKTKISQMQS
A0A0E3YV65      -QRATMGERYGVRHPSMIENDRSREALERLRTELITAAMSNLRNQ--RAKALNEETQLQS
W0J900          -KKAVMSEKYGRRHPAMVEQERSIQALEKLRGDLVRAALSTLRNQ--REKAVENERQLQE
A0A2T6DSN5      -ERRMLSETYLDEFPKMKENALATENTEKRLQANIELAIAELRSR--YEVAGQHEKRLRQ
A0A2V2SMX4      -QKQDWSEFLRPKHPKMVALDEDISRRRRLLGIFKDQSSEQLQTL--QKTLELQIANMER
A0A317ZIW7      -DLEEFEIYLKPKHPKIIGLKDQIERTSNQLEILRRQAFERIGER--KLVIERRIDNLND
A0A2D7WMI4      -DYQEVGTGYLSKHPKMLSNARQIQDTYGRINKQVKDAIFDMDNR--KLQLQALANDFTV
A0A2D6VHX5      -TYVETGTGYGPNHPKMIENARQVQEVQELLRKEVTLAIEDLRDR--HIQLDAQEREFMG
A0A2D8I214      -RYQEGSPGYLERHPKMLENARQVNEVKNSLIKEVTSAIEDLKDK--RVQLTAQEKEFQQ
A0A1Z8VL41      -DYQELEPGYLERHPKMLSNAKQVKDVKKALALEVKSAIDDSRDK--LLELQHQEGEFTM
A0A2E6TNA4      -DYQELEPGYLERHPKMLXNAKQVKDVKKELAXEVKSAIDDSRDK--LLELEHQEGEFTK
A0A1Z8RG47      -NYQETGTGYLERHPKMMENARQVLEVKQSLNLAVKSAIEDLRDK--YIHLVAQENEFAK
A0A1Z8RJJ5      -NYQETGTGYLERHPKMMENARQVLEVKQSLNLAVKSAIEDLRDK--YIHLVAQENEFAK
A0A2D7V631      -NYQETGTGYLERHPKMMENARQVSEIKTTLNLEVKSAIEDLRDK--HIQLNAQEKEFAT
A0A354RA24      -NYQETGTGYLERHPKMMENARQVSEIKTTLNLEVKSAIEDLRDK--HIQLNAQEKEFAT
A0A2E9RV62      -LY---GQKYLANHPKMIETARQIKDVERILQLEVKASIEDLKNS--YHQLEAQEQEYAN
A0A2E4AY96      -NYQEVGTGYLEKHPKMLANARQIRDTNMQILSEIRNAISDLYER--ENQLLALEDKFSI
A0A3B9B9P4      -NYQEVGTGYLEKHPKMLANGRQIRDTNMQILSEIRNAISDLYER--ENQLLALEDKFSI
A0A2D5Y6N6      -DYQETGSGYLERHPKMIENARQVQLVKQALNKEVKSAIEDLRDK--HIQLTAQEKEFAS
A0A2E7HSS8      -DYEETGSGYLEKHPKMLENARNVLQVKNALKDEVTSSIEDLRDK--HIQLSAQEKEFGD
A0A2D8VCK3      -DYEETGSGYLERHPKMLENARSVQQVKSALRQSVTSAIEDLRDK--HIQLSAQEKEFAD
A0A350QVY4      -DYEETGSGYLERHPRMLENARSVQQVKSALRQSVTSAIEDLRDK--HIQLSAQEKEFAD
A0A2E4ZYR7      -EHE---VKYLELHPKMSSNTRAIMELHRLLRLEVKTAIEDLTNR--VSELASQEREFTK
A0A2E6TCV1      -TYE---AKYLENHPKMKENALAIGELHKILLNEVQVAIEDLTNQ--KNELNVQKAKFVY
A0A3D4HHL8      -QRDEYLTYMKGKHPKLAAVNLEIERKENEMSVLKRQALHELKDE--KEVLQSKISHLKD
A0A366HV03      -EIAEASRVYLEDHEILKALRTKQRQIDESLTTELEVERKRFEVE--RLRLGDQLKELEA
A0A5R8KAF2      EELMEANKRYLPAHAIVKGLEEDLANNTRALAAELEVMRRRFELD--FQQQTQKIATLEK
A0A2V2SDN0      -KRDELSKGLRPMHPKILKLNEDIAAQEKLVEGSRSEVMKQLVNR--RDGLQLEVKNLEK
A0A1V6GL40      -EQQELGRYLRPNHPKMIAMQEDIARREELLKILRTQSEEQLKNR--KELLAVEIEILEK
A0A2V5X6Z6      -KRDELSRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHR--RQAIELQVQNLEA
A0A2V5VGZ7      -KRDELSRFLRPLHPKILKLDEQIATQEKLVEISRDEALKQLAHR--RRAIELQVQNLEV
A0A2V5U130      -KRDELSRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHR--RQAIELQVQNLEA
A0A2V6C237      -KRDELSRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHR--RQAIELQVQNLEA
A0A3R8L982      -TQAVLSERYLDRHPRMIEIDNSIRVTRQQLAAAIALAIADLQAT--LEKARAREASLAI
A0A2E7HPU9      -TFSELDLRYLSKHPKLIAAKNALEEYAFRFLREFDQVRKAAADK--SYWDKNKSEWDKQ
A0A388PR45      -RVRAMEEIYTDLHPKMIAERQALAQLSAEFQRAVKTKADSLAAA--QVDLRAKLDNAVE
A0A388QR61      -KTRAMEEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKADSMQTT--WLDLQAKLANSVE
A0A4P5YHI0      -KTRAMEEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKAESMQTT--WLDLQAKLANSVE
A0A2A2RS01      -LVSTMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQAS--VQNARSSYDAIVA
A0A2A2Y1A7      -LVSTMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQAS--VQNARSSYDAIVA
A0A388PDH9      -LVSTMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQAS--VQNARSSYDAIVA
A0A2G4H1E7      -RMSQMTEKYTDQHPTLVAEREALNQVDRQLREAVVQAVKSRRAS--LENAKARHEAILR
A0A2G4GZA6      -RVSQMTETYTDQHPKLVAEREALKQLDLQLKESISQAIKSRRSS--LENAKARHEAILR
A0A388P514      -RVSQMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSS--LENAKARLEAILR
A0A2A2YG59      -RVSQMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSS--LENAKARLEAILR
A0A2G4F7D5      -RVSQMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSS--LENAKARLEAILR
D5EML0          ERL-VLDERYLRKHPKIVENEAAMKSVSTELSRAIRQAEQQSTIE--YQTVQKEVSDLTA
A0A3C1C1M3      ERDALLSR-YTPEHPAVEAQDKAVALYKEQANQALNRAKNTAAAN--LALYQEQAGSLQK
A0A2E9EYJ1      SRAALIXSGVGVKHPKIVNIDSQLNLRMNQLLDAVETHKKALTTQ--LAMAEQQYENSKE
A0A258AXR6      AREGLVNEGRGRLHPQVLSVDSQMAEYQSLILGAAKAHVAGLQNR--LDASRKKRESLKI
A0A3D3NZQ6      AREGLVNQGRGRRHPEVLANDSQITKYKELIAAAAKDHLAGLQNR--LESARKRKEALEA
A0A1T4WVZ9      TREGLVNAGRGRRHPEVMGVDSQIALSKQLILDAVKAHLAALQTR--LDFSIQRRETLRS
A0A4R7SSI6      TREGLVNAGRGRKHPEVIGVDSQIILSKQLILDAVKSHVAALQTR--LEFAIKRHTALQS
                                                                            

A0A4Q3AQI1      PKLADESQPTSYLLDREKSTETNL------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      --------------------MYGK------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ----------------------------EYENLQRSVSRLQALYDLVFNRLKEVDVSIGI
A0A2V5UAD5      SIKE----SLGKV-----LAANDR--IADAERMKMNISRIQFHYDRVVNLLQNVDISRNI
A0A258AXL1      KLPE----YRKLI-----AGYDDF--RRDYKLQSSGHLAWEAAYVGMKGRLAAMDYTGPE
A0A2E6T1E0      VLEI----RKSEQ-----QAMNQK--SIQYFALEREAKQSETLYNLALQRLKETELQEKD
A0A2D5W0Q9      ------------------PNIKSQ-------------------------SLVERDLQAHL
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ---------------------------------------NRALYESVLKRLSETNVSNDI
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      RLTE----TAIK--------------EQEIIPLIREHKVKEELYLMLLSKEQENALAMAV
A0A2V6N5E0      NIKE----WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTTNLKDIDVSQVT
A0A2V6NH44      NIKE----WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYDRLTNDLKSVDVSQVI
A0A432FDF6      DVDA----AKKRE-----SDMRKT--GREYFDAKRELSNTTRIRDTILFRIMQEEVDLAL
A0A522ACN3      QVED----AKRVD-----RDKAEK--CRPYFEKKRELEEAIRLRTILNMRIAQERTDINL
A0A353DCA1      --RE----KKDGT-----VDLSMR--QHQYNSAKEEYEQSRMMYREMSVKQQQQRVLLKM
A0A3C1AXQ2      SNED----AKKGM-----LDQQSA--QNDYKTAADEVAYIESLLLQLKSTYFQTKAELEL
A0A3D0IZR7      ---------MRGQ-----LRADRSDRLAPYNEARRDFETQSQLLEVLMSRYRQQSVESRI
A0A520LRZ3      TKEK----TEKAS-----LKERKD--NINYIEAKKEYELSKEMLNGMQSKLAKEKIDAAG
A0A356FSV4      RLAE----KENEL-----IQLSKT--RVDYNTLYREFEVQQGFLTAIVSRMTMQKAQINL
A0A3D3DET9      DLKA----WDARN-----QEFQHK--NAEYQALKANVQRIRALYDQLLATMQTLDVNKEI
A0A355SVK9      RLAE----KESEL-----IQLSKT--RVEYSSLERELNVQQGFLQALVSRLTEEKAQVTL
A0A2E5D7I3      EVQS----NESEG-----LATARRLLLARTQVLDGETKSRMSVFNSILVALEESKVNSID
A0A2V5NYE2      DIKE----QEEQV-----LEINRK--TAEWQRLKDNKQRIQAAHDSLQATMDKLDVGKEA
A0A2V6FIP7      ELKK----KEQES-----FELSQL--RIQYDVLSRQADQSKLLYNIVLQRMKETDLTS--
A0A353DI77      EENF----RELRN---------AM--KLRASLLTNSVETKNELYNTLLSRVGVLKTDA--
A0A1V6GCZ3      EVGR----ATTND-----VTQANL--TRPYFEAKRALEELQRFRQVLDAKIAFEKIDVEL
A0A3C1UJT2      SIEN----QTSKL-----FEWEQL--YMQQAALEQDLEIGTKLIDNIKDQIQSIEFTAES
A0A2S7U0Z3      IIDGDGPDKSDAADKWVLLSQGAL--ASRAKLLNNTSEQTRDKYQSISQRMTEIDVADNQ
A0A5E6MKA7      EFQH----SMEKV-----RGESKA--LAHYALLKREADTDREMYSSVMRRMRETDITSAL
A0A2N8IR72      RLTE----------------TAIK--EQEIIPLIREHKVKEELYLMLLSKEQENALAMAV
A0A2N8IV96      TVAQ----KEEDL-----QKHVLQ--VPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
R7E1V8          TVAQ----KEEAL-----QKHVLQ--VPMYEQASRDYDAALDQLKDLDSRYKDEIARLRV
A0A1T4WWY4      KLPE----YHKAI-----KSYDTK--KLDYDLMEKSQLAWDKAYEKLSQRIESLEFDGDK
A0A3D3LEQ6      KLPD----YYKAA-----KSYDEK--KLAYELMEKGQLAWDKAYEQLSRQIEGLEFGSDE
A0A3D3NW23      KLPD----YYKAA-----KSYDEK--KLAYELMEKGQLAWDKAYEQLSRQIEGLEFGSDE
A0A2E0R252      MDAD-----TRID-----SQIQIA--STRASVLERELEAEQQIYDNLITKLKEGNVSKGF
A0A3E1EF48      LEGE-----ALIA-----AQLRTV--ASRASILSKALETEQGIFENLNTKLKEADVTRGI
A0A2A2PVG8      APME-----ALTN-----AKRQVV--STRSNVLERELEAEKAVYDNLILQLKEGNVTRGF
A0A2E0R421      VEGE-----ELAT-----DQMQIV--ATRSRSLGRELESEQDIYNNLIAKLKEGNVTKNF
A0A2E5EJ69      RLEA----QEKKV-----AADQQK--EIEYKHLKAQAESLQAMYQRVLGAKQESSVTEGI
A0A2G4I5Z5      AVKE----QEKKL-----SLLNSQ--RSGFDHLQAEVMQNRKLHDTVIQRLKELDIVSGN
A0A4P5QQV6      TVKE----WEAKA-----ASNSER--LTQHAGIQAGISRMRAQYENLSRSKGSVEITRNV
A0A2E7ALI1      ANDE----EAGLA-----SARRLL--LARTQVLDGETKSRMSVFNSILVALEETKVN---
A0A178IDB9      EYAA----AEKQA-----QDLDRI--TIDYKFLEEDAVSKRQAYNSILSRLNETTIVSQL
A0A290QD69      DYAE----TEKQA-----QELDKI--TSEYKYIEDESNIKSKNYQDILSRLSEISIISQL
A0A2E7VDS1      AMDA----VQRES-----QKLDDI--ETRINEMTREKEIHEKTHDIMLNRLNEVKVTRAL
A0A178IFJ2      QLAD----SEKAS-----LALDRQ--AVEYNVLRREAETNRATYTQVLSRLNEASLTAQL
A0A357FSP9      RLAE----KELEL-----IKLSKT--RVAYSSLQREMDVQQGFLQALVQRMTQERAAVNL
A0A538NJ59      SIKE----SLGKV-----LAANDR--IADAERMKMNISRIQFHYDRVVNLLQNVDISRNI
A0A3C1VFY9      QTKQ----WGRQN-----IELGHK--SAEYASLKAKSQRLQALYDQLLATFQTLNVNKDA
A0A522AC27      DVVE----WDAKN-----LSISQR--TAEYQKLKAGQSRVQALYDRLLATMQTLDVNKEI
A0A2A2R174      AFKE----QEKKL-----SDLNAR--RSGYEHLQADVTLHRSLHDAVIKRLRELDIVSGD
A0A1H2DTI1      MVKE----YEPKA-----ISLGAK--LAEFERLKSKRSMDQSLYESLLQSVQKIDLNRRL
A0A1V5L462      EINK----WEEEV-----IQYSLG--VADLETMNSNLSRLLSTRESLIRRKERLDIGRNV
A0A2A2R3V9      LIKS----EEVKA-----LDVNRR--MADYQRMKSKRQRLQAFYERLVSSVQSVDLSQNI
A0A3D3LGD3      SNQD----AKSEL-----LGQQSA--FNEYKTAKDDVTDIEAILRTLKTRYFETKAGLEI
A0A350ARX4      VIAQ----WEKQA-----LSISRK--SAEFERLQYRLDRSRNTYQRLLDSIQAIQSNQNI
B5JIS2          DFRK----KFTES-----IEVGRL--ADQFLVIGSEVDAKREALTSLLRRVSNANVVSNL
A0A1H2GQN6      DVASL---RDKLR-----QEKSDK--MAPFQEAVKERDRQQYILDQYEIRYKQENLDQQS
A0A512M3Y3      KMPD----YRRVL-----NDFDHY--KREYSLMSSGKLLWESAYADLSKRLTAMDYTG--
A0A4P5R5J1      NIKT----WETKA-----LDLAKR--VADFDKIKSKIERTKVHYDRLNGQLRSMDVYKNL
A0A4P5YK43      RVEE----MRREV-----FEKSTV--LNEFEKLKKEEDYLEKELDRQKRSLLALESTPTN
A0A2A2RPW6      ELRE----QEKKL-----GQLSLL--RIEYDRLQREAASERKLYDTVINRLREIDLTGNI
B4D1I7          TIKE----WEAKA-----LDLSQR--LAEYGSLQANVTRARAQLESLSRSKGNVEINRNV
A0A353F286      MVDA----RQEDA-----ITLSLK--QTSYTQAKEQYEQARGMLREMKFKHSEAKILLKM
A0A354FSA6      MVDA----RQEDA-----ITLSLK--QTSYTQAKEQYEQARGMLREMKFKHSEAKILLKM
A0A3B9GA54      MVDA----RQEDA-----ITLSLK--QTSYTQAKEQYEQARGMLREMKFKHSEAKILLKM
A0A520LEH8      MVDA----RQEDA-----ITLSLK--QTSYTQAKEQYEQARGMLREMKFKHSEAKILLKM
A0A2D7B7R6      SIEN----QTSKL-----FEWEQL--YMQQAALEQDLEIGTKLIDNIKDQIQSIEFTAES
B1ZT68          ELEQ----AERSA-----HELDKT--SVDYKFLEQDAATKRATYSRIVDRLNEASVASQM
W0J7C2          ETTG----SEAQA-----RELDKI--SIDYKFLEQDANAKRATYARIMDRLTEAGITSRM
A0A2E5K4P7      DVAI----KEQEY-----LALEKN--REEYGGLTRKLEQARKSLEHLRMLKFKEDVRTDT
A0A0R2XPB1      EIAI----WEKSA-----LEHGRL--IAEFERLQSRLERSKAASVNSQDSLQAIDTNQNL
A0A348NQP1      EIAI----WEESA-----LDNGRL--IAEFERLQSRLERSKAASVNSQDSLQAIDTNQNL
A0A357FV58      EIAI----WEESA-----LDNGRL--IAEFERLQSRLERSKAASVNSQDSLQAIDTNQNL
A0A2V6F9Q9      NIKE----WETKA-----LDLSQR--LAQFNRIKGKMDRTKQLYDRLTNDLKAVDVSQVV
A0A2V6NZZ3      NIKE----WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVI
A0A2V6EBU2      NIKE----WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVI
A0A2V6EY06      NIKE----WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVI
A0A2V6ME53      NIKE----WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVV
A0A538NUU0      NIKE----WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVV
A0A2V6NIJ1      NIKE----WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYDRLTNDLKSVDVSQVV
A0A2V6C292      NVKE----WEVKA-----LDLSHR--LAQFNRIKGKVDRSKLLYDRLTNDLKSVDVSQVV
A0A2V6D2X0      NVKE----WEVKA-----LDLSHR--LAQFNRIKGKVDRSKLLYDRLTNDLKSVDVSQVV
A0A2V5ZUK1      NIKE----WEAKA-----LDLSQR--LAQFNRIKGKSDRLKQLYDRLTNNLKEIDVSQVV
A0A2V5XFN9      NVKE----WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVV
A0A2V6EZC8      NVKE----WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVV
A0A2V6I7Z5      NVKE----WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVV
A0A3B9LCP2      NIKE----WEAKA-----LDLSQR--LALFNRVKGKVDRLKTLYDRLTNNLKEVDVSQVV
A0A3C0R669      NIKE----WEAKA-----LDLSQR--LALFNRVKGKVDRLKTLYDRLTNNLKEVDVSQVV
A0A2V6EID2      NIKE----WEAKA-----LDLSQR--LAQFNRVKGKVDRLKVLYDRLTNNLKEVDVSQVV
A0A2V6MHB0      NIKE----WEAKA-----LDLSQR--LAQFNRVKGKVDRLKVLYDRLTNNLKEVDVSQVV
A0A2W5YWL9      NIKE----WEAKA-----LDLSQR--LGQFNRIKGKVDRTKQLYDKMTNDLKSVDVSQVV
A0A2V5NH62      NIKE----WETKA-----LDLSQR--LAQFNRIKGKAERLKTLYDRLTNSLKDVNVSQSV
A0A2W6A620      NIKE----WEAKA-----LDLSQR--LAQFNRIKGKAERLKTLYDRLTNNLKDINVSQSV
A0A2V5PIJ4      SIAE----WEKKA-----LDLSQR--LAQFNRIKGKADRLKTLYDRLTNNLKEVNVSQVV
A0A2V6K2G8      NVKE----WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKDIDVSQVT
A0A2V5W206      NIKE----WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTTNLKDIDVSQVT
A0A2V6MW77      NIKE----WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVV
A0A2G4GZN8      NLLA----KEEEI-----SRLQAA--NVDLERVDKEIRASEEFLGRMKLSYEDAKLRSST
A0A348NPT1      RLAE----KELEL-----IKLSKT--RVAYSSLQREMDVQQGFLQALVQRMTQERAAVNL
A0A2E1KV60      RLVE----KERDM-----IELSKT--RVEFNSLIRDLEVEQMTYQKLISLMAEEKIQVNI
A0A2D7F4D9      RLLE----KEREM-----IELSKT--RVEFNSLIRDLEVEQMTYQKLTALMAEEKIQVNI
A0A3R7RBR8      RLLE----KEREM-----IELSKT--RVEFNSLIRDLEVEQMTYQKLTALMAEEKIQVNI
A0A2E0NH28      RLAE----KENEL-----IQLSKT--RVDYNTLYREFEVQQGFLTAIVSRMTMQKAQINL
A0A350AS32      RLAE----KEQEL-----IELSKT--RVEYNSLLRDLDVQQSFFIALTSRMTQEKAQVNL
A0A368BGT4      RLAE----KEREL-----IELGKT--KIEFNSLLRDLEVQQSFFQALNLRMTTEKAQVNL
A0A2E0V4K6      KDGG----EAEVA-----IARRLL--LARTQVLDGETKSRMSVFNSILVAMEESKVNQ--
A0A2E6NAH3      RLAE----KEKEL-----IELGKT--KIEFNSLLRDLEVQQSFFQALNQRMTTEKAQVNL
A0A2A5VZA5      RLAE----KESEL-----IALSKT--RVEYNTLLRDLDVQQSFFQALNSRMTQEKAQVSL
A0A424R295      RLAE----KESEL-----IALSKT--RVEYNTLLRDLDVQQSFFQALNSRMTQEKAQVSL
B4CZV9          KLPE----YQELS-----RKHAKL--LSQLSIFDASRVPYDTYLANMQREINEVEFAGEK
A0A290QE54      EYAL----NEKEQ-----IRLRDL--SIDFKSLENQAAVAKGNYTQILDRLSQATTSSNL
A0A1H1SWX2      EYQA----AEKDN-----LRLGDL--SVDFKSLENQAQVAKSNYLEILNRLNQVTTSKNL
A0A4Q1C9I5      EYKE----AEKEQ-----LRLGEL--SVEFKSLENQAAVAKNNYLQILDRLAQATTSKNL
A0A3B9FM17      EMEK----VQKQS-----EQLSEI--EETLKNFERELAVVQRSTDSIHSRLNDVNIEQAL
A0A1G3ZL71      EYAQ----HEKDQ-----IKLNEL--KPEYGSLENEALAKRTAYLQVLDRLNQTTTSKNL
A0A556QP09      EYAA----QEKEQ-----LRLRDL--SIEYRSLENQAQVAKSNYSQILDRLSQATTSKYL
A0A2T6DX88      EYQL----HEKEQ-----MHLRDL--AVDFRSLENQATVAKSNYSQILDRLSQTTTSSKL
A0A2T6CWI7      EFAQ----REKDA-----MRLGEL--RVEFNSLVQQSQVARENYQNIFKRLTDTTTVKNL
A0A3E1E5C8      EYDR----AEKES-----LHLGDL--SVEYNSLENQANVAKSNYVQILNRLNETTTTRNL
B1ZZ74          QFAK----AEKES-----LDLGAL--APEFNSLQNQAQVSKANYLSILDRLNQTTTTKNL
R7E4L8          LLSD----------------MASK--DEGLVPLLREQKVMEELYLMLLKKREENALALAT
A0A4Q3BVY2      RVPE----YHAIT-----EQVGKS--SHVYSTIAAKQQMWDKARERLAQKLATVTFAEDF
A0A4P6PCA7      RMENIETELRDLD-----KQIADG--KRRLLKLERKRDAAETSYRSILQRTENTRLAA--
A0A0E3YV65      QLAQ----AEKES-----FRLDEM--AVQFNVLRREAETNRATYAQLLNRLNETSITAQL
W0J900          KLAD----AEKAS-----LGLDRL--AVEYNVLRREAETNRATYTQVLGRLNETSLTAQL
A0A2T6DSN5      DFAD----AEKRL-----QELDRA--TDRYKFLEDDYNRKNQALNSIEGRLQEATIVSRL
A0A2V2SMX4      DVRE----WDAKC-----LEISRK--TAEYQRLKNDSQRVQGLYDRLLATMQTLDVNKQI
A0A317ZIW7      EIAI----WEQSA-----LENGRL--IAEFERLQSRLERSKAAYERNQEALRAIDTGQSL
A0A2D7WMI4      AMTT----VQDEA-----NFLSKI--DDNISSMERELEIVQTSSGQMQKRLNDVTIEQAF
A0A2D6VHX5      AMDK----VQTES-----RRLGHI--EEAISKAERTLAVVRSSTDIIRKRLDDVRIEAAL
A0A2D8I214      AMEK----VQQDS-----MKLSEI--EEWLINKERELTVVRTSTDQIQKRLNEVRIEQAL
A0A1Z8VL41      AMQE----VQSQS-----NELSEI--EERLEDYKRELSVVRASTDQIHKRLNDVKIEQSL
A0A2E6TNA4      AMQK----VQLQS-----NELSEI--EERLEDYKRELSVVRASTDQIHKRLNDVKIEQSL
A0A1Z8RG47      AMQK----VQEDS-----RKLSEI--EEKLINFERQLAVVRKSTDQIHDRLNDVRIEQAL
A0A1Z8RJJ5      AMQK----VQEDS-----RKLSEI--EEKLINFERQLAVVRKSTDQIHDRLNDVRIEQAL
A0A2D7V631      AMQK----VQEDS-----RKLSEI--EETLTNFDRQLAVVRKSTDQIQSRLNDVRIEQAL
A0A354RA24      AMQK----VQEDS-----RKLSEI--EETLTNFDRQLAVVRKSTDQIQSRLNDVRIEQAL
A0A2E9RV62      EMDK----VQVEA-----VELSEM--EKDLEVLDRKLQIQRGSTDTIQRRLQDVVIQIEL
A0A2E4AY96      AMND----VQIEA-----KDVSLI--DDTLRNFERELQIVQTSSAQMQKRLNDVTIEQAF
A0A3B9B9P4      AMND----VQIEA-----KDVSLI--DDTLRNFERELQIVQTSSAQMQKRLNDVTIEQAF
A0A2D5Y6N6      AMAK----VQEES-----RTLSEI--EEKLKNLDRQLAVVTRTTDQIHNRLNDVRIEQAL
A0A2E7HSS8      EMAK----VQLES-----EKLSEI--EDRLKNFTRELAVVQRSTDGIQSRLNEVKIEQAL
A0A2D8VCK3      EMEK----VQKQS-----EQLSEI--EETLKNFERELAVVQRSTDSIHSRLNDVNIEQAL
A0A350QVY4      EMAK----VQKQS-----EKLSEI--EETLKNFERELAVVQRSTDSIHARLNDVKIEQAL
A0A2E4ZYR7      AMLA----VQKES-----QKLDDI--EVQILGMTREGLVHRTTYDQMLKRLNEVKVTREL
A0A2E6TCV1      LREK----IKKQA-----QQLGQK--EQQIARLEQDLTLERQTFSSLHKRKKEVEVTGAL
A0A3D4HHL8      VIDE----QEVKA-----LDYSRR--LAEFERINSRLDRQKSLLENLTASIQSIDINLNL
A0A366HV03      KLPE----YSEMT-----EKLNKL--RQDYKLGHEGDLAWTKAYTDLSKMIATINFGGDK
A0A5R8KAF2      RLPE----YYQTN-----EEAGLA--GEQYMSASQGRAMWGRARDKLSDKLSMISFTQDL
A0A2V2SDN0      VFRE----WEGKA-----LEASRK--MVDYDRLRQDVQRTQAAYDKLLSVISTVDVGKSV
A0A1V6GL40      DLKA----WDARN-----QEFQHK--NAEYQALKANVQRIRALYDQLLATMQTLDVNKEI
A0A2V5X6Z6      AFKE----WDAKA-----IESSRK--MADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV
A0A2V5VGZ7      AFKE----WDAKA-----IESSRK--MADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV
A0A2V5U130      AFKE----WDAKA-----IESSRK--MADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV
A0A2V6C237      AFKE----WDAKA-----IESSRK--MADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV
A0A3R8L982      EYTA----NEKEH-----LRLRDL--SVEYKSLENTAAVAKSNYAQILDRLSQVNTSRNL
A0A2E7HPU9      DLDQ----LSRLQ-----VARRLL--TARATVLTSGIASQREVYNSLNTQLAE--LNAKK
A0A388PR45      ILRQ----KDEAI-----NRLQAA--AVELEKIDKDIRANEEFLGRMKLNYEEAKLRTAT
A0A388QR61      ILRQ----KDEAI-----NKLQAA--AVELEKIDKDIRANEEFLGRMKLNYEEAKLRTAT
A0A4P5YHI0      ILRQ----KDEAI-----NKLQAA--AVELEKIDKDIRANEEFLGRMKLNYEEAKLRTAT
A0A2A2RS01      NLER----KDDEI-----YRLQAA--NNELERVDKEIRGQEEFLARQKQNYEEQKLRSST
A0A2A2Y1A7      NLER----KDDEI-----YRLQAA--NNELERVDKEIRGQEEFLARQKQNYEEQKLRSST
A0A388PDH9      NLER----KDDEI-----YRLQAA--NNELERVDKEIRGQEEFLARQKQNYEEQKLRSST
A0A2G4H1E7      NLVA----KEEEI-----SKLQAA--NVELERVDKDIRASEEFLGRMKLSYEDAKLRSST
A0A2G4GZA6      NLVA----KEEEI-----SKLQAA--NVELERVDKDTKASEEFLSRMKLSYEEAKLRSSN
A0A388P514      NLLA----KEEEF-----SKLQAA--NVELERVDKDIKASEEFLGRMKLSYEEAKLRSST
A0A2A2YG59      NLLA----KEEEF-----TKLQAA--NVELERVDKDIKASEEFLGRMKLSYEEAKLRSST
A0A2G4F7D5      NLLA----KEEEF-----SKLQAA--NVELERVDKDIKASEEFLGRMKLSYEEAKLRSST
D5EML0          RIQE----TEGRV-----LVAERS--LLEYKRMERDVDQKREMFNKLMNRYRETRIAQQM
A0A3C1C1M3      KNEELLETASKLD-----RDILEG--EMRITALNRTRSAADASYLGLLTRIQEARLSADE
A0A2E9EYJ1      SKER----TEKMS-----LQERKQ--NVRYIEAKKEYELSKEMLNGMQSQLAKETIDSAG
A0A258AXR6      YNDD----AKQEL-----QNMSSL--YTEYKTAKDEVTYLEDLLVKMRSRYFEEKAGIEL
A0A3D3NZQ6      SNQD----AKSEL-----LGQQSA--FNEYKTAKDDVTDIEAILRTLKTRYFETKAGLEI
A0A1T4WVZ9      SNEE----AKSEM-----LDQQSA--QNDYKTAADDVAYIENLLLQLKSSYFETKAGLEL
A0A4R7SSI6      SNED----AEKEM-----FDQQSA--QTDYKTAVDDVAYIENLLLQLKSSYFETKAGLEL
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      -----------DLATA-QMAPIKPKKMLTLFLGIVGGLGAGFGLAFFVNFLDDSIKSQDD
A0A660Q3A0      ---EPERIRIVERAEV-PTSPVTPRKLQSIFIAALIGLGLGIGLVFGLEYLDDTIRYPEE
A0A2V5UAD5      ---DQGTLAILD--PASEAVRSYKQDVSLLAMTLVAGLLAGFGCVFLVAVRDDRFITLTD
A0A258AXL1      ---VQVEFQFKGFTDVRDDIPVSPNKQKLLTYALALSIGLGLGGPVLTERLRFTSSFVGE
A0A2E6T1E0      ---IVQNMHVIDLATAQMS-PIKPKKLLTLFLGIVGGLGAGFGLAFFVNFLDDSIKSQDD
A0A2D5W0Q9      HPQSNA------------------------------------------------------
A0A1Z9KB52      -------------------------------------MGXXLVIPIALEVIDNRIKSPWD
A0A2V5U7A0      AVSN-MQIMQSAERPRSPDAPN---IPINLTMYAALGLFLGVGMAFALEYIDSHLNTPEH
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ----------------------------------------------------------DD
A0A3D4CZT6      -----------------------------LSLGAAVGLIFGIAIAFSLEYLDTSVKTLED
A0A4V1S9Q4      -----------------------------------------VGIAFFLEYLDTSVKSLED
A0A355VK99      TESN-ARVLEAAHGPNLPISPK---TIKYVAGGTAGGALLSILAFMGVAMLNNKVNNKHD
A0A2V6N5E0      GSEDQVSIMEMATPPISV-RPG---LIKSLLIGFGIGALAGLAILILLDRIDDRMASFSE
A0A2V6NH44      DTGDQISIMEPATPPVSV-RPG---LLKSLLLGFGGGALVGIMILLLLDRIDDRMASYGE
A0A432FDF6      PKESTVEITDDADLPIKAVRPN---IPLNIALGVVVGLVLGVGLAFFIEYLDTSVKTIDD
A0A522ACN3      PHTTMVEIIDRATPGARPVRPN---KPLNIALGVIIGLVVGVGLAFFIEYLDTSVKTIDD
A0A353DCA1      PRTP-ITLHERAKKAKAPAYPN---VTLNLLLGAGVGLIFGIGIAFLLEHLDTSVKSLED
A0A3C1AXQ2      VKSP-ATIYAIATPEGKPAKPN---VALNLALGGVLGLMLGVGLAFFLEYMDTSVKSLDD
A0A3D0IZR7      ETRP-VQVVNRAEPAVRPVKPS---LKLNLALSMVVGLILGLSLAFFIEYLDTSIKTMDD
A0A520LRZ3      QRTP-MVIHEIAEAADPG-NPARPNIKLHLVLGAAVGLVFGIGMAFFLEYLDTSVKSLDE
A0A356FSV4      KNPN-ARIVDEALPPLRHSSPN---LFLNIALGAFGGVVVGLGLVFGIAFLDDRVKSAFD
A0A3D3DET9      SPES-VETIEAASPA----YAARLDLWKGAVNGALLGLALGLGLLLVLDRLDDRVGSFTE
A0A355SVK9      KNPN-SRVIDEALPPMRHSSPN---IPMNLAAGFLGGLAAGAGFVLLIAFLDDRVKSAFD
A0A2E5D7I3      EEVI-AELHSRAAPSDSAVFPNRLRVQ---AVGGIGGVASGLGLVLLLLXLDNRFXTVSQ
A0A2V5NYE2      APES-VTIHQKASPA----VPNRPQLSRKLATGALVGLALSVVLLLILDRLDDRVNSVTE
A0A2V6FIP7      -KDKAQNMRVVDKAVV-PMNPIKPRVVLTLFLGVIGGLGVAMGLAFFVNYLDDSIKSQDD
A0A353DI77      -EGVEAEVIKHEDAPR-AWAPFSPNRKKIMVKTTMLGLCGGLALAFMFQFVDNKIHGVAD
A0A1V6GCZ3      PKTLMVEVVDRAMPGL---RPVRPNKPLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDD
A0A3C1UJT2      -EGTTIELAEKATEPS----TIEPNKTQRIILGVLLGLGLAYGYLYLMNMMDQSIKSVEQ
A0A2S7U0Z3      -SMNNLKVVEPAFIGL----AKESVRLIYLAAGSIFGIFTGFAAAFGLSILDYKIYDVRS
A0A5E6MKA7      ---NASNVEVVESAEV-PNMPSRPKKARNLLLGFLGGGMGGIGLAIGLAKFDTRLRGKEE
A0A2N8IR72      -TESNARVLETAHG---SNLPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHD
A0A2N8IV96      ---PREAIEMYQLPTY-PAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMED
R7E1V8          ---PREAIEMYQLPTY-PAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMED
A0A1T4WWY4      ---APLSLEFRGFTNLRSEMPVSPNKSKLFMMGCLLGLGLAGGVPFLLRRFDSSVVELSE
A0A3D3LEQ6      ---SAVSLEFRGFTDIRSEAPVSPNKSKLLMLGCLLGLGMAGGVPFLLKQMDSTVTDLNE
A0A3D3NW23      ---SAVSLEFRGFTDIRSEAPVSPNKSKLLMLGCLLGLGMAGGVPFLLKQMDSTVTDLNE
A0A2E0R252      ---DSKQFDVVQPPSL-PANPTGPNKKKITMKYLFGGAALGVGIILLLGFLDPTVRTVAD
A0A3E1EF48      ---ATRQFEIIQPPTL-PGGPIAPSMNDIVGRFSGGGFLLGIACIFLIGFLDPSIRTVGE
A0A2A2PVG8      ---ASRQFEVVQPPTM-PAAPVAPIKTRMLVQFAGGGAALGIAIIMLLGFLDPTLRTVAE
A0A2E0R421      ---AGKQFDIVQPASL-PGGPIGPNKKSIMSKYTMGGVAVGVALILLMGFLDLTIRTVSE
A0A2E5EJ69      ---QNRTVEVYNPASL-PGAPVSPRKSVIMMVAMIVGCGLSFMLVFIVQQLDKTVKSIDE
A0A2G4I5Z5      KNKNEVRIIEPASLPL---TPIRPNKKMLLIYALALGTALSVGLIWLLVQLDTTIKSVDH
A0A4P5QQV6      -DQEIISVRQKATPAQ----TARFGVARTLTTGFVLGLLGGIVCLLGISMFDDRIDSVVD
A0A2E7ALI1      -SIDDEVIAELHSRSAVPSSPVFPNRLRVKAVGGLGGIAGGLGLVFLLLRLDNRFRTVSQ
A0A178IDB9      ---ENVNIKVLDKALV-PGAPSNSPSSQILLQAGAFGFILFLGLPIGIGLMDTRVKSSHD
A0A290QD69      ---DNVNITIHDKALV-PGFPDTGTPKEVIKQAAALAFVLFFGIPVGLGFLDTRVKSSHD
A0A2E7VDS1      -PQEDDPLKRDSPAVT-PTSPFEPDKSSIHRTGALIFLACFILIPMAFEFIDNRVKSPWD
A0A178IFJ2      -GNSNIKIAERARPPT---VPLEPNPKKILLSIGFLGVLIVIGYPVGMELLFNRIKTWTD
A0A357FSP9      -KNPNSRVIDEALPPL---RHSSPNIVMNLAAGFFGGLAVGAGLIFVVAFLDDRVKSAFD
A0A538NJ59      -DQGTLAILDPASEAV----RSYKQDVSLLAMTLAAGLLAGFGCVFLVAVRDDRFITLTD
A0A3C1VFY9      -SPETVTIYQPASDAF----PDTTLLKKGLMFAGLLGLGLGLAILILMDRVDDRMSSFTE
A0A522AC27      -SPESVTIMEPAFDAV----PERPPIIQSLFKAGLIGLGASLAILLLLDRLDDRMNSYTD
A0A2A2R174      KSKSEVRVIEPANLPL---TPIRPNKKMLLLYALAAGTALSVGVIWLLVQLDTTIKSVDH
A0A1H2DTI1      DEQRFTLMEPPSDATS-----IKDQYQVRLLSAGLGGLIVGMAILFIIDRFDDRINSTTE
A0A1V5L462      DTELISVLVPATSAVL-----RQVDKRREIAKGGALGLGMGAAIVFLLAALNNRITSADD
A0A2A2R3V9      ---DQEMISIMEHPGL--AQPVHVGMSGMLLNGFLLGLLAGVGILFLLDRIDDRINSFTE
A0A3D3LGD3      -FKSPATIYAKAEP---EGRPAKPNVALNLALGGILGLMFGFGLAFALEFMDTSIKSLDD
A0A350ARX4      EQDTIGILAHASRAGV-----QPPQVGKKVAEGAAFGLAVGIVIIAAISFLDVRIRNSDE
B5JIS2          ----PVDVMRVVDPAF-IAKPKLAKRKLVAAFTVLLAGGAFFGVPLGMQLFDQRLKCATD
A0A1H2GQN6      PSQPATVISPANTNPN----PVRPILWLNITLSGVAGLLLGLSVAFFIEYLDTSVKSLND
A0A512M3Y3      -IDVRVEFEWQGFTYLRNDVPISPNKQKLLLYGVMLGVGCAAGGCFGLEKLRSTTSLVTE
A0A4P5R5J1      -AQDTVLILEHATKPE-Q---IQMELNKLLLIGGFGGLALGLLVLFVLDKMDDRIGSFFE
A0A4P5YK43      ----EETISTVEEGVG-LEKPVGPNRPKIILLGLLLGLFSGIGIVYVLYRLDDRLDLAED
A0A2A2RPW6      --EKKSEFRIIEPASL-PSIPIRPNKKMILLYALMVGMAASVGLIWLLVQVDSSIKSVDH
B4D1I7          ----DQDIISIRQRAS-AATPQKPGAVKTVGTGIGLGLFVGLLLLVLIDQLDDRVASYTE
A0A353F286      ---PRDPITLHEKPKK-ASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLED
A0A354FSA6      ---PRDPITLHEKPKK-ASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLED
A0A3B9GA54      ---PRDPITLHEKPKK-ASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLED
A0A520LEH8      ---PRDPITLHEKPKK-ASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLED
A0A2D7B7R6      -EGTTIELAEKATEPS-T---IEPNKTQRIILGVLLGLGLAYGYLYLMNMMDQSIKSVEQ
B1ZT68          ---ENTNIKIFDPAYV-PGGPIGDALAILIAKASFIGVGLFVLIPLGMGLMDTRIKTVSH
W0J7C2          ---ANTNIAIFDPAWV-PDAPSDTGALEIAVKAGAAGLGLLFVLPLGIGLLDSRLRTPAQ
A0A2E5K4P7      ---KNSSVNIYVDGVA-PTKHFTPSLTLNLAFGTIGGAGFGLFMVFFTAFIDNRVKSPFD
A0A0R2XPB1      -QQETVSILVNARKPI-P---AGVGLVQQFAMGALFGVVLAAGILFVLAAIDNRILTASE
A0A348NQP1      -QQESVSILVNARKPI-P---AGVGLVRRFAMGGLFGLILAAGVLFVLAAMDSRILTASE
A0A357FV58      -QQESVSILVNARKPI-P---AGVGLVRRFAMGGLFGLILAAGVLFVLAAMDSRILTASE
A0A2V6F9Q9      DAGDQISIMEPATPPV-S---VRPGLIKSLLLGFGGGAVAGILILLVLDRIDDRMASYGE
A0A2V6NZZ3      ETGDQISIMEPATTPV-S---VRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGE
A0A2V6EBU2      ETGDQISIMEPATTPV-S---VRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGE
A0A2V6EY06      ETGDQISIMEPATTPV-S---VRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGE
A0A2V6ME53      DTGDQISIMEPATSPV-S---VRPGLLKSLFLGFGGGALVGIMILLLLDRIDDRMASYGE
A0A538NUU0      DTGDQISIMEPATSPV-S---VRPGLLKSLFLGFGGGALVGIMILLLLDRIDDRMASYGE
A0A2V6NIJ1      DSGDQISIMEPATPPV-S---VRPGLLKSLLVGFGGGALVGIVILLLLDRIDDRMASYGE
A0A2V6C292      DSGDQISIMEPATSPV-S---VRPGLLKSLLLGFGGGALVGIMILLLLDRIDDRMASYGE
A0A2V6D2X0      DSGDQISIMEPATSPV-S---VRPGLLKSLLLGFGGGALVGIMILLLLDRIDDRMASYGE
A0A2V5ZUK1      GGEDQVSIMEMATTPV-S---VRPGLIKSLLIGFGAGALLGLGILILLDRIDDRMASFSE
A0A2V5XFN9      GGEDQVSIMEMATAPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSE
A0A2V6EZC8      GGEDQVSIMEMATAPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSE
A0A2V6I7Z5      GGEDQVSIMEMATAPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSE
A0A3B9LCP2      DSGDQVGIMDMATPPI-S---VRPGLIKSLLIGLGCGLLAGIGILILLDRIDDRMASFGE
A0A3C0R669      DSGDQVGIMDMATPPI-S---VRPGLIKSLLIGLGCGLLAGIGILILLDRIDDRMASFGE
A0A2V6EID2      DSADQVSVMEMATPPI-S---VRPGLIKSLLIGLGCGLLAGIGILFLLDRIDDRMASFGE
A0A2V6MHB0      DSADQVSVMEMATPPI-S---VRPGLIKSLLIGLGCGLLAGIGILFLLDRIDDRMASFGE
A0A2W5YWL9      DTGDQISIMEAATAPI-S---VRPGLLKSLLIGLGCGALAGFGILLLLDRIDDRMASFSE
A0A2V5NH62      DSGDQVSIMEMASGPV-S---VRPGLIKSLLIGLGIGALAGIAILLLLDRIDDRMASFGE
A0A2W6A620      DSGDQISIMEMAGAPI-S---VRPGLLKSLLIGLGCGALAGIGILLLLDRIDDRMASFGE
A0A2V5PIJ4      DTGDQIAIMENATAPV-S---VRPGLIKSLLMGLGAGILGGLAVLFLLDRIDDRMASFGE
A0A2V6K2G8      GSEDQVSIMEMATAPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSE
A0A2V5W206      GSEDQVSIMEMATPPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSE
A0A2V6MW77      GGEDQVSIMEMATSPV-S---VRPGLIKSLLIGFGIGALAGLAILVLLDRIDDRMASFSE
A0A2G4GZN8      -SGTSTSISILDAPSV-SDKPINKNYYFSALVGIGSGLLFGVVLIIVIGTLDDRIKSAKD
A0A348NPT1      -KNPNSRVIDEALPPL-RH--SSPNIVMNLAAGFFGGLAVGAGLIFVVAFLDDRVKSAFD
A0A2E1KV60      -KNANARIIDKAFPPP-EDQPSSPNVFLNLAGGFFGGIFFGLGLVFAVALLDDKVKSVFD
A0A2D7F4D9      -KNANARIIDKAFPPR-EDRPSSPNVFLNLAGGFFGGMIFGLGLVFAVALLDDKVKSVYD
A0A3R7RBR8      -KNANARIIDKAFPPR-EDRPSSPNVFLNLAGGFFGGMIFGLGLVFAVALLDDKVKSVYD
A0A2E0NH28      -KNPNARIVDEALPPL-RH--SSPNLFLNIALGAFGGVVXGLGLVFGIAFLDDRVKSAFD
A0A350AS32      -KNPNARIVDEAFPPM-KH--SSPNVVMNLAAGLFGGVAVGMGLVFIVAFLDDRVKSAFD
A0A368BGT4      -KNPNARIVDEAFPPP-EDQPSSPNIVLNLFAGFFGGIAFGVGLIFSVAFLDDRVKSAFD
A0A2E0V4K6      -IDDEVIADLHSRAST-PETAVYPNRIRSYFAGGAGGAACGVGLILLLLRIDNRFRTVAQ
A0A2E6NAH3      -KNPNARIVDEAFPPR-EDQPSSPNVVLNLAAGFFGGIATGVGLIFAVAFLDDRVKSAFD
A0A2A5VZA5      -KEANARVVDDAFPPL---RHSSPNITVNLLVGVFGGLAVGGGLVFIVAFLDDRVKSAFD
A0A424R295      -KEANARVVDDAFPPL---RHSSPNITVNLLVGVFGGLAVGGGLVFIVAFLDDRVKSAFD
B4CZV9          ---ERINLKYSGLLEV-RDDPVSPNRLRIMLLSFVGGLVLALGIPFLIEYLDHTMTNLEE
A0A290QE54      ---ERISVRPLDPATP-AGAPYTPDIRSIAKTSIGLFVLVFVGVAIGLSFIDDRIKSSWD
A0A1H1SWX2      ---ENIPVKPLDRALP-KGSPDTPNIRNIVKTSIGLGLVVFAGVAIGLSFLDDRVKSAWD
A0A4Q1C9I5      ---ENIPVKPLDQALP-AGAPYTPNLRNIIKTSLGLGLLVFVGVAVGLSFVDDRVKSAWD
A0A3B9FM17      PSEQDEPLRVDSVAYE-PGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWD
A0A1G3ZL71      --DSRVPLRVIDRATP-SHAPYTPNLARVVRTSTIVGLLIFFGVAFGLSVVDDRIKSAWD
A0A556QP09      --E-KIPVRPLDPALP-AGKPYTPDLGRIARTAVGVGVLVFFGVAIGLSFIDDRIKSAWD
A0A2T6DX88      --E-KIPVRPLDRATP-TPAPYTPNMTRVIRLSVIVGLLVFVAVAFGLSIVDDRIKSAWD
A0A2T6CWI7      --D-KIPLHPLDHAVA-NRWPVSPNRQKITRTAIGLGLMVFLGVALGLSFIDDRIKSAWD
A0A3E1E5C8      --E-KIPLHPLDAAVV-PGGPYEPDLARIIRTCLGVGLLVFFAAGLGLAFLDDRIKSAWD
B1ZZ74          --E-KIPLHPLDHAVV-PGAPFTPNLNAIIRLCVGVGVMVFFGVAFGLSFIDDRIKSAWD
R7E4L8          ---TEPSARILEPAFG-SNAPVAPRLSLMTMGGMAGGAFASLLALLAGNALNTKVRDKKD
A0A4Q3BVY2      --DWVELRFKGLVSLR-DEVPISPSKFKVAIIALTLGVAGAFGVPTALNLLNTSASTVPQ
A0A4P6PCA7      -EQDTAFVKVLREATV-PRIPVAPDKKKIVIVTVFLFGIIGAGLAILMDFMMNRVGSVTD
A0A0E3YV65      ---ANSNVRVADGGTP-AGLPLEPDPRKIAITLLVLGLGVFVAYPVALELIFNRVKGWSD
W0J900          ---GNSNIKISERAQI-PTFPIEPDPKKIFRALGFLGLLIIIGYPVGMELIFNRVKTWTD
A0A2T6DSN5      ---ENVNIRILDRANV-PSVPANGTPKDTALQASALGLFLLFGIPLGLGLLDTRVKSPSD
A0A2V2SMX4      -NPESVTIYEKATQA----YPDRVNLPMKLALGAVAGLGLSLLVMLFVDRLDDRMASFTE
A0A317ZIW7      -SQETVSVLEDASPA----YPAGQGTVIRLAEGAAYGIVLAIGVLALISFLDNRIFSAAD
A0A2D7WMI4      PQDQDDPLQKEQFAFV-PGGPYSPDKNGIYKKSFGIFVGIFFVVPFLLEFIDNRIKSPWD
A0A2D6VHX5      PSEQDDPLQKDQLAFT-PXSPYSPDYNKIKQQGVLIFVGIFLVIPIALEVIDNRIKSPWD
A0A2D8I214      PSEQEEPLHKEQYAFL-PGGPYTPDKAKIKRTGIYIFLGLFILIPVSLELVDNRVKSPFD
A0A1Z8VL41      PSEQDDPLHKENFASL-PGGPFSPDKNAIKQKGLXIFFAVFIIVPILLEFVDNRVKSPWD
A0A2E6TNA4      PSEQDDPLHKEQFASL-PGGPFSPDKNAIKQKGLIIFFVVFIIVPILLEIVDNRVKSPWD
A0A1Z8RG47      PSEQEEPLHKEQFATQ-PSAPYTPDKNQIRQSGFMIFFSVFFALPILLEFVDNRVKSPWD
A0A1Z8RJJ5      PSEQEEPLHKEQFATQ-PSAPYTPDKNQIRQSGFMIFFSVFFALPILLEFVDNRVKSPWD
A0A2D7V631      PSEQEEPLHKEQFAYQ-PFAPYTPDKNKIRKSGFIIFFAVFFALPILLEFVDNRVKSPWD
A0A354RA24      PSEQEEPLHKEQFAYQ-PFAPYTPDKNKIRKSGFIIFFAVFFALPILLEFVDNRVKSPWD
A0A2E9RV62      PQEQDDPLHKGNIAY--PGIQISPNLPEIHKTGFMIFAALFVLIPFGFEFIDNRIKSPWD
A0A2E4AY96      PQEQDNPLQKEQFASL-PASAYSPDKAAIQKKAATVFLAIFILFPFLLEFIDNRIKSPWD
A0A3B9B9P4      PQEQDNPLQKEQFASL-PASAYSPDKAAIQKKAATVFLAIFILFPFLLEFIDNRIKSPWD
A0A2D5Y6N6      PSEQEEPLNKEQFAYL-PGAPFTPDKNKIKRDGTMLGLAIFVIIPFLLEFIDNRVKSPWD
A0A2E7HSS8      PSEQDEPLRMESFANE-PGGPYSPDKQKIKEQGIMIFSVLFILIPICLEFIDNRVKSPWD
A0A2D8VCK3      PSEQDEPLRVDSVAYE-PGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWD
A0A350QVY4      PSEQDEPLRVDSVAYE-PGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWD
A0A2E4ZYR7      PQDEDDPLRRGDVAMT-PATPISPDKAAIRRTGILIFVACFILIPIGFEFIDNRIKSPWD
A0A2E6TCV1      PEAQTDPLQISDVATV-PYLPVSPDKAAIKTKGILIFFACFVLIPIAFEFIDNRVKSPWD
A0A3D4HHL8      -DQEFLTILENASPA----YAVRISIVKNLVMGVVAGVFMGVGILFIISILDSRIISVED
A0A366HV03      -DRVDLQFREFALLRD-VD-PVSPTKSKLAILAAVLGLGLAIGVPLGLEQLNDKITSLAA
A0A5R8KAF2      -DWVEMHFKEFVNLR--DVEPTSPNKMKLLMISLMLAIGGAIGAPTLVNLMHTGVETLQQ
A0A2V2SDN0      -DQENVSVLEPASPAG-RAS----KLVRNLALAFAMALVLGAGLLWVLSKLDDRFVSSTE
A0A1V6GL40      -SPESVETI---EAAS-PAYAARLDLWKGAVNGALLGLALGLGLLLVLDRLDDRVGSFTE
A0A2V5X6Z6      -EQENVGIL---EPAS-VAAPTH-RLFRNMAIALVGSLLLGFGLLYCIGLFRDDFASLAE
A0A2V5VGZ7      -EQENVGIL---EPAS-VAAPTH-RLFRNMAIALVGSLLLGFGLLYCIGLFRDDFASLAE
A0A2V5U130      -EQENVGIL---EPAS-VATPTH-RVLRNMAIALIGSLLLGFGLLYCIGLFQDDFASLAE
A0A2V6C237      -EQENVGIL---EPAS-VATPTH-RRLRNMAIALVGSLLLGFGLLYCIGLFQDDFASLAE
A0A3R8L982      -EKLPVRRLDRALPA---GAPYSPNPRSITQTSVALGLLVFFGVAFGLNLIDDRIKSAWD
A0A2E7HPU9      -GETAVEVELDSFSEL-PRKPSSPKQLTTLGAGTILGSVLGFALAFLLANLDNKFHTVSQ
A0A388PR45      -SGISTSIRVMDKPSV-SDKPVNKNFSVNALAGLALGFFAGVGLVLLLGTLDDRLKSVRD
A0A388QR61      -SGISTSIRVMDKPSV-SDKPVNKNFTFNALAGLLLGLFSGVGLVVLMGMLDDRIKSVKD
A0A4P5YHI0      -SGISTSIRVMDKPSV-SDKPVNKNFTFNALAGLLLGLFSGVGLVLLMGMLDDRIKSVKD
A0A2A2RS01      -SGTSTSIKIQEMPSV-ADRPVNKNYYMNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKD
A0A2A2Y1A7      -SGTSTSIKIQEMPSV-ADRPVNKNYYMNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKD
A0A388PDH9      -SGTSTSIKIQEMPSV-ADRPVNKNYYMNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKD
A0A2G4H1E7      -SGTSTSISILDAPSV-SDRPINKNYYYAALIGFGSGLLFGIVLVFVLGALDERIKSAAD
A0A2G4GZA6      -SGTSTSINILDAPSV-SDKPINKNYYLNALVGMGSGLLFGVVLIVVIGTLDSRIKSAKD
A0A388P514      -SGTSTSISILDQPSV-SDKPINKNYYFNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKD
A0A2A2YG59      -SGTSTSISILDAPSV-SDKPINKNYYFNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKD
A0A2G4F7D5      -SGTSTSISILDQPSV-SDKPINKNYYFNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKD
D5EML0          -NLNNMLVLDRANLP---MQPLTMSRTQMVAAAIVLGAVFLVGCPLVIELIDGRLTSFQD
A0A3C1C1M3      -NTATVKLASEVAP----ARQIFPRPARVLLMALLLGLAVGFGLAILTEILEDRVGGIDD
A0A2E9EYJ1      -QRTPLVIHELAEPQD-VDKPARPNXKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDE
A0A258AXR6      -VKSPATIYSDAEPE---GKPAKPNVPLHLALGGVLGLMFGLGLAFFLEYMDTTVKSLDD
A0A3D3NZQ6      -FKSPATIYAKAEPE---GRPAKPNVALNLALGGILGLMFGFGLAFALEFMDTSIKSLDD
A0A1T4WVZ9      -VKSPATLYAKAEPE---GKPAKPNVALNLALGGVLGLMLGVGLAFFLEYMDTSVKSLDD
A0A4R7SSI6      -VKSPATIYAIATPE---GKPAKPNVALNLVLGGVLGLMLGIGLAFFLEYMDTSVKSLDD
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      VESYLKLPFLGYIPNIK-TTSVIERDLQSH-----------------------LHPQSNS
A0A660Q3A0      VTEGLGLPFFGVIPTAQWDPDDLATHLLSN-----------------------IASNSGV
A0A2V5UAD5      VIEKLGDAVLGQVPEVR---KRRRKSPLPL-----------------------LEIDDDR
A0A258AXL1      AEKYCQYPACGIVPLME---IDDRRL-VPQ-----------------------LPDGKES
A0A2E6T1E0      VETYLNLPFLGYIP--------NIKT-TSI-----------------------IERDLQA
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      IETFVGEDLLTGIQKIS---EIDELRRPKI-----------------------VGDDLDD
A0A2V5U7A0      VWRAVDLNTLGVVPDLD---SLGHRPLISYAPASRAKLLPTRMGQTQLDDISTRGKDLIV
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      VEHYLGVPVLAVIP--------------------------KDVG--VLHKQSGMSP----
A0A3D4CZT6      VERYLQVPVLAVIP--------------------------TDVG--VLHKQSGMSP----
A0A4V1S9Q4      VERYLQVPVLAVIP--------------------------KDVG--VLHKQSGMSP----
A0A355VK99      LPSVNRQPVIAELP--------------------------QMSK--KESRNTKLFIQDEH
A0A2V6N5E0      FQHHFSENILGQIP---------------------------KEK--TKGKVDLLQPDDAR
A0A2V6NH44      FQRHFSENVVGQIP---------------------------KEK--VKGRMALLQPDDPR
A0A432FDF6      VERALNAAVLGVIP--------------------------QNVG--SLLDEGDESP----
A0A522ACN3      VERTLQSPVLGVIP--------------------------QNVG--YLFEEGSESP----
A0A353DCA1      VERYLQVPVLAVIP--------------------------KDVG--VLHKQSGMSP----
A0A3C1AXQ2      VERFLGVPVLAVIP--------------------------KDVA--VLHRASGFNP----
A0A3D0IZR7      VERFLGISVLAVIP----------------------------------KGAKFLTSDDPN
A0A520LRZ3      VEHFLELPVLAVIP--------------------------QAVG--VLHRQSGLSP----
A0A356FSV4      IEGTIGLPLIGIIP------------------------QIKKLD--STTKAQAVASNVDR
A0A3D3DET9      LQDLFDENVLGQVP------------------------REKLVA--SKRQPSLILPEDTR
A0A355SVK9      IEGAIGLPLLGVVP------------------------QIKKLD--AHSKAQAVASNVDR
A0A2E5D7I3      VEXETGMPVLAAVPVLE---AKKLEAAEXSESXSXAKTXEGEGA--PREMVSLARDVVFR
A0A2V5NYE2      LQDLFDEPILGQVP------------------------QERAPA--RRAEIKLIEPEDSR
A0A2V6FIP7      VETYLRLPFLGYVPNIK---TNSVLERDLQ-----------------------AHLHPQS
A0A353DI77      IEQTFGISILSAIQKLP------------------------------------PEEELLK
A0A1V6GCZ3      VERALQCPVLGVIPQNVGLLVDEGTESPH-------------------------------
A0A3C1UJT2      AEKILQLPVLAAVPVSE---INGKPTDSRL-----------------------VMIESPN
A0A2S7U0Z3      AEEATGLTCMAAIPASS---KFGRQDKWQS-----------------------ILSHDPH
A0A5E6MKA7      VERALGLPVLGMVPDTE---KLRAKGIDEIPADLPMALA--------------THVSPDS
A0A2N8IR72      LPAANRQPVIAELPQMS---KKESKNTKL------------------------FIQDEHS
A0A2N8IV96      VERALQVPVLGIIPKNVPILHSSDV----------------------------MGPD---
R7E1V8          VERALQVPVLGIIPKNVPILHSSDV----------------------------MGPD---
A0A1T4WWY4      FEGTLGINGIGLVPLSD-PKELESLNRAPT-----------------------VGANVPN
A0A3D3LEQ6      FEETLGIPGIGLVPLTD-PEVLEEVNRSQT-----------------------VGSKVPN
A0A3D3NW23      FEETLGIPGIGLVPLTD-PEVLEEVNRSQT-----------------------VGSKVPN
A0A2E0R252      LEVLTGTPVIGAMPASK---NTERKGSLAL-----------------------DAEDEQS
A0A3E1EF48      LERDARLPVIGAVPSSSSKGDGTKRELVLL-----------------------SRKD--P
A0A2A2PVG8      VEQFCGIPVVAGLPAFK---KRESRAESLE-----------------------LARDAQS
A0A2E0R421      LEGMTGKPVLGAIP--D---EKNPGEGVLV-----------------------LNCKDTP
A0A2E5EJ69      AERLFGVPVVGAVPKNP---EIKDDQGRLF-----------------------VTKAPNS
A0A2G4I5Z5      AERLLGIPVLGAVPKNK---LIKNGKGRLF-----------------------ISDDPQS
A0A4P5QQV6      FQATFPDRLLATIPHVS---CAVGAVDVAP-----------------------LLPDDER
A0A2E7ALI1      VEEETGMPVLSAVPVLE---LRKIEAAEK------------------------SHKKKEK
A0A178IDB9      VETGLDHPLLGGIKTMK---KLTEAERPNV-----------------------FRLHKDD
A0A290QD69      VESGLNQTLLGGIKAMK---KLSETERPNV-----------------------FRLGKDE
A0A2E7VDS1      IEVFLGRDLIAGIPKIS---TIKEAERPLI-----------------------VGNELDD
A0A178IFJ2      VERYIGLPLLSEFPVLK---NLPGDTLNHL-----------------------VLQDRDP
A0A357FSP9      IEGTVGLSMLGVVPRIK---KLDSNSKAQA-----------------------VASNIDR
A0A538NJ59      VIEKLGDAVLGQVPEVR---KRRRKSPLPL-----------------------LEIDDDR
A0A3C1VFY9      LEELFDEDVLGNVPREK---SPDKNTVLPL-----------------------LQPDDLR
A0A522AC27      LQDLFDEEVLGQIPHEG---LEKGQKHLGL-----------------------IHAEDPR
A0A2A2R174      AERILGLPVLGAVPKNK---LIRDGKGRLF-----------------------ISDDPQS
A0A1H2DTI1      LRDYFSERILGQMPFEV---SLGDRSNRRL-----------------------IQPGDDR
A0A1V5L462      LRRMFSSKVIGLIPQTK---AKITV----------------------------LRKEADD
A0A2A2R3V9      LRDHFEEPVLGQIPMDP---TLARKKGGPSL----------------------LVQDDRR
A0A3D3LGD3      VERFLGVPVLAVVPKNV---GILHRATG-------------------------FNPD---
A0A350ARX4      LAKRFDHPVIGVIPEEL---QNANGQIDLL-----------------------QVNDSRH
B5JIS2          IEKEFGKGLLGGIPKLS---RVKVADRPHV-----------------------VRDNLDL
A0A1H2GQN6      VEKTLGVPVLGIIPRGV---KP-------------------------------LNKEPKD
A0A512M3Y3      TEKLTGLNAVGVVPLLA---NSAQVETLAINEH--------------------GLANADV
A0A4P5R5J1      FRERFPEPLLGQVPREL---TKAGLDL--------------------------LASNDPR
A0A4P5YK43      IEESLQEPVLGQIPAVD---RKNHADGPLL-----------------------ANRLEPN
A0A2A2RPW6      AERVFGLPVLGAIPKNK---LITDGKGRLF-----------------------ITDDPQS
B4D1I7          FQSYFRERVFAQIPHSP---SDGRSESPAI-----------------------LMPEDER
A0A353F286      VERYLQVPVLAVIPKDV---GVLHKQSG-------------------------MSPD---
A0A354FSA6      VERYLQVPVLAVIPKDV---GVLHKQSG-------------------------MSPD---
A0A3B9GA54      VERYLQVPVLAVIPKDV---GVLHKQSG-------------------------MSPD---
A0A520LEH8      VERYLQVPVLAVIPKDV---GVLHKQSG-------------------------MSPD---
A0A2D7B7R6      AEKILQLPVLAAVPVSE---INGKPTDSRL-----------------------VMIESPN
B1ZT68          VEDALGEVLLGAVKTID---GLGEIERAHV-----------------------YRLHKDD
W0J7C2          VEDSLQEPLLGVVKHMG---KLGETERARI-----------------------FLSHASH
A0A2E5K4P7      IEQVIKLPLVGVIPQIR---KLDSFKKARI-----------------------IESAKDN
A0A0R2XPB1      LSAQFKDPLIGVIPFEV---NHDGDVNSVL-----------------------LRKNDDR
A0A348NQP1      LSAQFKDPLIGAIPFEA---SNDGDENSVL-----------------------LRKNDDR
A0A357FV58      LSAQFKDPLIGAIPFEA---SNDGDENSVL-----------------------LRKNDDR
A0A2V6F9Q9      FQRHFLENVVGQIPKEK---AKGKMPL--------------------------LQAEDPR
A0A2V6NZZ3      FQRHFSENVVGQIPKEK---VKGTMAL--------------------------LQPDDPR
A0A2V6EBU2      FQRHFSENVVGQIPKEK---VKGTMAL--------------------------LQPDDPR
A0A2V6EY06      FQRHFSENVVGQIPKEK---VKGTMAL--------------------------LQPDDPR
A0A2V6ME53      FQRHFSENVVGQIPKEK---VKGTMAL--------------------------LQPDDPR
A0A538NUU0      FQRHFSENVVGQIPKEK---VKGTMAL--------------------------LQPDDPR
A0A2V6NIJ1      FQRHFSENVVGQIPKEK---VKGTMAL--------------------------LQPDDPR
A0A2V6C292      FQRHFSENVVGQIPKEK---VKGTMAL--------------------------LQPDDPR
A0A2V6D2X0      FQRHFSENVVGQIPKEK---VKGTMAL--------------------------LQPDDPR
A0A2V5ZUK1      FQHHFSENVLGQIPKEK---AKGRVEL--------------------------LQPDDQR
A0A2V5XFN9      FQHHFSENVLGQIPKEK---TKGKVDL--------------------------LQPDDAR
A0A2V6EZC8      FQHHFSENVLGQIPKEK---TKGKVDL--------------------------LQPDDAR
A0A2V6I7Z5      FQHHFSENVLGQIPKEK---TKGKVDL--------------------------LQPDDAR
A0A3B9LCP2      FQRQFSENVLGQIPKDK---TKGEVTL--------------------------LQPDDAR
A0A3C0R669      FQRQFSENVLGQIPKDK---TKGEVTL--------------------------LQPDDAR
A0A2V6EID2      FQHQFSESVLGQIPKEK---TKGKLTL--------------------------LQPDDAR
A0A2V6MHB0      FQHQFSESVLGQIPKEK---TKGKLIL--------------------------LQPDDAR
A0A2W5YWL9      FQHHFTENVLGQIPKEK---SKGKVQL--------------------------LQADDPR
A0A2V5NH62      FQHHFSENVLGQIPKEK---TKGRVSL--------------------------LQPDDAR
A0A2W6A620      FQHQFSENVLGQIPKEK---TKGRVTL--------------------------LQPDDAR
A0A2V5PIJ4      FQHQFSENVLGQIPREK---VKGDVML--------------------------LQQDDAR
A0A2V6K2G8      FQHHFSENVLGQIPKEK---TKGRVDL--------------------------LQPDDMR
A0A2V5W206      FQHHFSENILGQIPKEK---TKGKVDL--------------------------LQPDDAR
A0A2V6MW77      FQHHFSENILGQIPKEK---TKDKVDL--------------------------LQPDDAR
A0A2G4GZN8      VEGSLGLPLIGTIPRAT---VTSGPDRALL-----------------------ARQDKDR
A0A348NPT1      IEGTVGLSMLGVVPRIK---KLDSNSKAQA-----------------------VASNIDR
A0A2E1KV60      IEASIGLPMLGIIPKVK---KLDSVSKSHI-----------------------VASSSDR
A0A2D7F4D9      IEASLGLPILGIIPKVK---KLDSVSKSHI-----------------------VTSTTNR
A0A3R7RBR8      IEASLGLPILGIIPKVK---KLDSVSKSHI-----------------------VTSTTNR
A0A2E0NH28      IEGTIGLPLIGIIPQIK---KLDSTTKAQA-----------------------VASNVDR
A0A350AS32      IEGTIGLPMLGIVPRIK---KLDTNSKAQA-----------------------VASNVDR
A0A368BGT4      IEGTIGLPMLGVIPRIK---KLDSNAKAQA-----------------------VASNVDS
A0A2E0V4K6      VEEETALPVLAAVPVLS---AKRLS----------------------------AAEKSNK
A0A2E6NAH3      IEGTIGLPMLGVIPRIK---KLDTSTKAQA-----------------------VASNVDR
A0A2A5VZA5      IEGTIGLPLLGVIPRIK---KLDSSTKAQA-----------------------VAANVDR
A0A424R295      IEGTIGLPLLGVIPRIK---KLDSSTKAQA-----------------------VAANVDR
B4CZV9          VEHSFRLRGLGVVPQTE---ATDMFLPATA-----------------------VASDDTT
A0A290QE54      VEHFIGVHLLGIVPDLS---GLKDDDKYSL-----------------------VLKNREA
A0A1H1SWX2      IEGFIGAHLLGIIPELG---DVPDTEKHSL-----------------------VNSNRTS
A0A4Q1C9I5      IEGFIGAHLLGIIPELG---DVPDTEKHSL-----------------------VNSNKAS
A0A3B9FM17      IEVFVGNDLIGGIPKIS---EVEERERPLI-----------------------VGNDLDD
A0A1G3ZL71      VESYLGVHLLGIIPELA---HVATDSLHTL-----------------------AILSKAT
A0A556QP09      IEHFIGANLLGIIPDLS---SLKDSEKYKL-----------------------VLDNKNT
A0A2T6DX88      VESFIGVTLLGIVPDLS---SLKDDEKYSL-----------------------VRRSEEA
A0A2T6CWI7      VESFVGANLLGIVPDLG---NLKDEEKYTL-----------------------MLTEKQV
A0A3E1E5C8      VESYIGANLLGIIPDLS---AVTDDDKYSL-----------------------LLKGPQT
B1ZZ74          VESFIGASLLGIIPDLA---ALKDDEKYSL-----------------------LLSGKQA
R7E4L8          LAGLTDLPLAGELPLLS---GKERKKLPLV-----------------------VTNGRSF
A0A4Q3BVY2      LEQLTGLEGIGIVPMTS---KEMLEDVARS---------------------PAQGASVPN
A0A4P6PCA7      LKD-LGLHVLGILPRES---KYM------------------------------TRADIAK
A0A0E3YV65      VENYLGLPLLAELPLLN---KIKTEFLPHL-----------------------LTRAADQ
W0J900          VERYIGLPLLSEFPVLK---KLPDDKLNHL-----------------------VLQDTDP
A0A2T6DSN5      VEAGLEQVLLGGIKTMK---KLSETERPNV-----------------------FRLGKDD
A0A2V2SMX4      LQELFDEEILAQIPREG---KAREVSGLPL-----------------------ITQNGSP
A0A317ZIW7      ITNHFDEPLLGAIPFEK---NHDGDHTMVL-----------------------LRKSDER
A0A2D7WMI4      IEVFLGRELISGIPKIS---NIIENERPLI-----------------------VGNDLDD
A0A2D6VHX5      IETFVGEDLLTGIQKIS---EIDELRRPKI-----------------------VGDDLDD
A0A2D8I214      VEVFIGKDLIGGIPKIS---DVEEAHRPLI-----------------------VGNDLDD
A0A1Z8VL41      VDVFIGKDLIGGIPQIS---QVEETKRPLI-----------------------VGNDLDD
A0A2E6TNA4      VDVFIGKDLIGGIPQIS---QVEETKRPLI-----------------------VGNDLDD
A0A1Z8RG47      VEVFVGHDLIGGIPKIS---EVDERERPLI-----------------------VGNDLDD
A0A1Z8RJJ5      VEVFVGHDLIGGIPKIS---EVDERERPLI-----------------------VGNDLDD
A0A2D7V631      VEVFVGHDLIGGIPKIS---EVEERQRPLI-----------------------VGNDLDD
A0A354RA24      VEVFVGHDLIGGIPKIS---EVEERQRPLI-----------------------VGNDLDD
A0A2E9RV62      IEVFLGQDLIAGIPKIS---EVKEVDRPLI-----------------------VGNELDD
A0A2E4AY96      IQVFLGRDLISGIPKIS---NIDEQERPLI-----------------------VGNDLDD
A0A3B9B9P4      IQVFLGRDLISGIPKIS---NIDEQERPLI-----------------------VGNDLDD
A0A2D5Y6N6      VEVFIGRDLIAGIPKIS---EVEENQRPLI-----------------------VGNDLDD
A0A2E7HSS8      VEVFIGNDLIGGIPKIS---EIEERERPLI-----------------------VGNDLDD
A0A2D8VCK3      IEVFVGNDLIGGIPKIS---EVEERERPLI-----------------------VGNDLDD
A0A350QVY4      IEVFVGNDLIGGIPKIS---EVEERERPLI-----------------------VGNDLDD
A0A2E4ZYR7      VEVFIGRDLIAGIPKIS---TIKEADRPLI-----------------------VGNELDD
A0A2E6TCV1      IEVFIGRDLVAGIPKIS---TIKEADRPLI-----------------------VGNELDD
A0A3D4HHL8      VENRFDQPLMGIIP--F---QKYDGDILNP-----------------------IKADDDR
A0A366HV03      LEKLTGLKGLGIVPTSS---STFLESVTRG-----------------------IESDPRK
A0A5R8KAF2      LENVTGLTAVGVIPRTT---KEVLEDIARS-----------------------PSIGAKS
A0A2V2SDN0      LAEDLPEKVIGQVMDIQ---LVKPEGELRR-----------------------EALAAQR
A0A1V6GL40      LQDLFDENVLGQVPREK---LVASKRQPSL-----------------------ILPEDTR
A0A2V5X6Z6      LTHQLSEEVVGQIPAIS---IKKPKRRLGV-----------------------EALEKQR
A0A2V5VGZ7      LTHQLSEEVVGQIPAIS---IKKPKRRLGV-----------------------EALEKQR
A0A2V5U130      LTNQLCEEVVGQIPAIS---IKKPRRQLGV-----------------------EALEKQR
A0A2V6C237      LTNQLCEEVVGQIPAIS---IKKSKGRLCV-----------------------EGLEKQR
A0A3R8L982      VEHFIGANLLGIIPSLG---DIKDHDRYKLFAVGPNAADESGGGNNNSEGAPDRRRDPER
A0A2E7HPU9      VELMSGLPILATIQHI---------DLKVL-----------------------AQLKDEK
A0A388PR45      LEGGLGIPVLGTVPKVS---ETAGPDRALL-----------------------ARQDKDR
A0A388QR61      IEAGLGVQVLGTVPKVA---ETTGPDRALL-----------------------ARQDKDR
A0A4P5YHI0      IEAGLGVQVLGTVPKVA---ETTGPDRALL-----------------------ARQDKDR
A0A2A2RS01      VEMGLGLPLLGTVPKVT---EAVGPDRALL-----------------------ARQDKDK
A0A2A2Y1A7      VEMGLGLPLLGTVPKVT---EAVGPDRALL-----------------------ARQDKDK
A0A388PDH9      VEMGLGLPLLGTVPKVI---EAVGPDRALL-----------------------ARQDKDK
A0A2G4H1E7      IEGSLGLPLIGTIPQVV---RASGPDRALL-----------------------ARQESDR
A0A2G4GZA6      VEGSLGLPLIGTIPRVA---NVSGPDRALL-----------------------ARQDKDR
A0A388P514      VEDSLGLPLIGTVPRVA---NVSGPDRALL-----------------------ARQDKDR
A0A2A2YG59      VEDSLGLPLIGTVPRVA---NVSGPDRALL-----------------------ARQDKDR
A0A2G4F7D5      VEDSLGLPLIGTVPRIA---NVSGPDRALL-----------------------ARQDKDR
D5EML0          VEQGSHKALLGDVRFYG-------QKKGDA-----------------------VYQAVLQ
A0A3C1C1M3      IEIGTGVKILAVLPHVK---TRKRKEIATT-----------------------SLTHQFG
A0A2E9EYJ1      VEYYLDLPVLAVIP----------KDINVL-----------------------XXEXGLS
A0A258AXR6      VEHYLGVPVLAVVP----------KEVGVL-----------------------HRSSGFN
A0A3D3NZQ6      VERFLGVPVLAVVP----------KNVGIL-----------------------HRATGFN
A0A1T4WVZ9      VERFLGVPVLAVVP----------KDVAVL-----------------------HRTSGFN
A0A4R7SSI6      VEKFLGVPVLAVIP----------KDVAVL-----------------------HRASGFN
                                                                            

A0A4Q3AQI1      ------------------------------IENFRVIRTN--L-LSMGALTKAPHV----
A0A4P6PD26      ---------------------------------MVSCASN--K-PCFLRGGSHRGA----
A0A1Z8SVB5      ------------------------------IQMNSNVRGS--------------RS----
A0A2V5W3Y0      ------------------------------AESYRNVRSS--I-FFMPYEGPRPKT----
A0A432FAS4      ------------------------------AESFRTIRAA----ISLSQRAGDLQV----
A0A660Q3A0      ------------------------------AEAYRNVRSA----LIFSGAEEYTKA----
A0A2V5UAD5      HVY---------------------------AESYRNLRSA--L-LYQGTDGQRPRV----
A0A258AXL1      DAKVTTHA----------------------NESFRIIRSS--L-PFYALPDNPKQV----
A0A2E6T1E0      HLHPQSNS----------------------AESFRTVRAA--I-ALSQRAGD-LHL----
A0A2D5W0Q9      ------------------------------AEGFRTVRAAVSL----VHKSDKFKV----
A0A1Z9KB52      SL----------------------------TESFRSMYGK--I-QM-NSHATGSKS----
A0A2V5U7A0      AHNPLSIY----------------------SEAYRTIRTA--L--LLSQPGGNRKV----
A0A257LYL4      -------------------------------------RTN--I--EFNRKNPEDNA----
A0A4Q2XXY1      -------D----------------------AEAYRILRTN--I--EFNRKSADANA----
A0A3D4CZT6      -------D----------------------AEAYRILRTN--I--EFNRNNPEDNS----
A0A4V1S9Q4      -------D----------------------AEAYRILRTN--I--EFNRKNPEDNA----
A0A355VK99      SV-----I----------------------AECFHILRNN--VDSMLPRPEQGGHV----
A0A2V6N5E0      HV-----F----------------------AESYRNIRSS--I-FFMPYDGPRPKS----
A0A2V6NH44      HI-----F----------------------AESYRNIRSS--L-LFMPYQGPRPKT----
A0A432FDF6      -------H----------------------AEAYRVLRTN--I-LFAGRQSEKQTT----
A0A522ACN3      -------H----------------------AEAYRVLRTN--L-LF-SRKDDKLNS----
A0A353DCA1      -------D----------------------AEAYRILRTN--I-EF-NRKNPEDNS----
A0A3C1AXQ2      -------D----------------------AEAYRILRTN--I-EF-NRRNPDANC----
A0A3D0IZR7      SR-----F----------------------AEGYRILCAK--L-N-LTGARASART----
A0A520LRZ3      -------D----------------------AEAYRILRTN--I-E-FNRKTADANS----
A0A356FSV4      H------V----------------------TETFRSIHSA--I-R-LNEESKNAKV----
A0A3D3DET9      HS-----F----------------------VEAYRNLRSS--L-LYMTEAGNRPKT----
A0A355SVK9      H------V----------------------TETFRTIHSS--L-R-LNEESKNAKI----
A0A2E5D7I3      DGLHSSLY----------------------AESYRILRAA--V-M-LLGDEKKRKI----
A0A2V5NYE2      HS-----F----------------------LEAYRNLRSS--L-LYMVKASERPRT----
A0A2V6FIP7      NA----------------------------AEGFRTIRAA--I-AL-APKSDQYHL----
A0A353DI77      EMESIRDLPVSMKHICPTLAVPGWKTDFVHSEMFRVLRAS--I-SL-LGDTNQRKI----
A0A1V6GCZ3      ------------------------------AEAYRVLRTN--L-LF-SRKDDKLNT----
A0A3C1UJT2      STC---------------------------SEAFRSLRVN--I-ES-MTRKKSHKV----
A0A2S7U0Z3      SAN---------------------------AESIRNLRAS--V-IL-LGKHDNNKV----
A0A5E6MKA7      AI----------------------------SNSFRQIRTL--L-HY-SIPDGRPQV----
A0A2N8IR72      VI----------------------------AECFHILRNNVDS-ML-PRPEQGGHV----
A0A2N8IV96      ------------------------------AEAYRILRTN--I-EF-NKKGLEEIS----
R7E1V8          ------------------------------AEAYRILRTN--I-EF-NKKGLEEIS----
A0A1T4WWY4      AL----------------------------LENFRLIRSS--I-LLNGSPKGDGRV----
A0A3D3LEQ6      AL----------------------------LENFRLIRSS--I-LLNRSPMGEARV----
A0A3D3NW23      AL----------------------------LENFRLIRSS--I-LLNRSPMGEARV----
A0A2E0R252      QS----------------------------AEAIRTLRAG--L-TF-LGTSEERRT----
A0A3E1EF48      HA----------------------------SEAIRTLRTG--L-TL-LGDSEERRI----
A0A2A2PVG8      KP----------------------------AESIRTLRTG--L-TF-LGTAEERCT----
A0A2E0R421      LQ----------------------------AEAIRTLRAG--L-TF-LGTPESKRT----
A0A2E5EJ69      SC----------------------------AEAFRTLRAS--I-SL-LGREEERRV----
A0A2G4I5Z5      LC----------------------------AEAFRSMRAS--L-GL-LGRDEDRKV----
A0A4P5QQV6      HTF---------------------------VESMRSLRSS--I-FFLPVEGPPPRT----
A0A2E7ALI1      EDSGAEASSEKALNFSQDVVFRDGLYSSLYAESYRILRAA--V-ML-LGDEKERKI----
A0A178IDB9      AL----------------------------AEAYRGIFSE--I-EI-RSPVPFPKR----
A0A290QD69      AL----------------------------SEAYRGVFSE--V-EI-RSIVPYPKR----
A0A2E7VDS1      GL----------------------------MESFRSMFSR--I-QM-NSTADGPKS----
A0A178IFJ2      DA----------------------------GEVVRGLYAQ--L-KL-SSRLDAPKT----
A0A357FSP9      HV----------------------------TEAFRSIHSA--L-KI-SEESKNAKV----
A0A538NJ59      HVY---------------------------AESYRNLRSA--L-LYQGTDGQRPRV----
A0A3C1VFY9      HPF---------------------------VESYRNLRSS--L-LYMAETGTRPHT----
A0A522AC27      HQF---------------------------VEAYRNLRSS--L-LYMNEGGNKRRT----
A0A2A2R174      LC----------------------------AEAFRSMRAS--L-GL-LGREEDRKV----
A0A1H2DTI1      HTY---------------------------SESFRNLRSA--L-MFMEVDGARPRT----
A0A1V5L462      VF----------------------------AESFRALRSS--I-LLHRQDSKEPRQ----
A0A2A2R3V9      HVY---------------------------AESFRNVRSS--L-LFMAIDGTRPKT----
A0A3D3LGD3      ------------------------------AEAYRILRTN--I-EF-NRKNRDANC----
A0A350ARX4      RF----------------------------AEACRTLRSTILL-KQSDAVHTSSQS----
B5JIS2          AK----------------------------VESFMAVVAQ--L-EL-TSKQEGPKS----
A0A1H2GQN6      TPH---------------------------AESYRILRAR--I-DL-QAHSGPGNT----
A0A512M3Y3      NI----------------------------GETFRIIRSS--I-PLYVPGENKCQV----
A0A4P5R5J1      HAL---------------------------LESFRTLRSS--I-IFLPIEGARPKT----
A0A4P5YK43      SLF---------------------------AESIRGVRSA--V-MF-GTQSKKKQV----
A0A2A2RPW6      LC----------------------------AEAFRTLRAA--L-SL-LGRDEDRKV----
B4D1I7          HAF---------------------------AEAFRSLRSS--I-AFLPVAGAPPKV----
A0A353F286      ------------------------------AEAYRILRTN--I-EF-NRKNPDNNS----
A0A354FSA6      ------------------------------AEAYRILRTN--I-EF-NRKNPDNNS----
A0A3B9GA54      ------------------------------AEAYRILRTN--I-EF-NRKNPENNS----
A0A520LEH8      ------------------------------AEAYRILRTN--I-EF-NRKNPENNS----
A0A2D7B7R6      STC---------------------------SEAFRSLRVN--I-ES-MTRKKSHKV----
B1ZT68          GL----------------------------TESYRGIYSA--I-DI-HSTEPFPKA----
W0J7C2          DL----------------------------SEAYRGIFSE--I-EV-RSPLAFPKA----
A0A2E5K4P7      HV----------------------------KEAFRSIFST--L-GV-NDASKDAQV----
A0A0R2XPB1      YVF---------------------------AEACRNLRTS--V-FFMGDEHVKPSV----
A0A348NQP1      YVF---------------------------AEACRNLRTS--V-FFMGDEHEKPSV----
A0A357FV58      YVF---------------------------AEACRNLRTS--V-FFMGDEHEKPSV----
A0A2V6F9Q9      HIF---------------------------AESYRNIRSS--I-LFMSYEGPRPKT----
A0A2V6NZZ3      HIF---------------------------AESYRNIRSS--L-LFMPYEGPRPKT----
A0A2V6EBU2      HIF---------------------------AESYRNIRSS--L-LFMPYEGPRPKT----
A0A2V6EY06      HIF---------------------------AESYRNIRSS--L-LFMPYEGPRPKT----
A0A2V6ME53      HIF---------------------------AESYRNIRSS--L-LFMPYEGPRPKT----
A0A538NUU0      HIF---------------------------AESYRNIRSS--L-LFMPYEGPRPKT----
A0A2V6NIJ1      HIF---------------------------AESYRNIRSS--I-LFMPYEGPRPKT----
A0A2V6C292      HIF---------------------------AESYRNIRSS--I-LFMPYAGPRPKT----
A0A2V6D2X0      HIF---------------------------AESYRNIRSS--I-LFMPYAGPRPKT----
A0A2V5ZUK1      HVF---------------------------AESYRNIRSS--I-FFMPYEGPRPKS----
A0A2V5XFN9      HVF---------------------------AESYRNIRSS--I-FFMPYEGPRPKS----
A0A2V6EZC8      HVF---------------------------AESYRNIRSS--I-FFMPYEGPRPKS----
A0A2V6I7Z5      HVF---------------------------AESYRNIRSS--I-FFMPYEGPRPKS----
A0A3B9LCP2      HVF---------------------------AESYRNIRSS--I-FFMPYEGPRPKT----
A0A3C0R669      HVF---------------------------AESYRNIRSS--I-FFMPYEGPRPKT----
A0A2V6EID2      HIF---------------------------AESYRNVRSS--I-FFMPYEGPRPKT----
A0A2V6MHB0      HIF---------------------------AESYRNVRSS--I-FFMPYEGPRPKT----
A0A2W5YWL9      HTF---------------------------AESYRNVRSS--I-FFMPYDGPRPKT----
A0A2V5NH62      HVF---------------------------AESYRNVRSS--I-FFMPYEGPRPKT----
A0A2W6A620      HVF---------------------------AESYRNIRSS--I-FFMPYEGPRPKT----
A0A2V5PIJ4      HVL---------------------------SESFRNVRSS--I-FFMPYEGPRPKT----
A0A2V6K2G8      HVF---------------------------AESYRNIRSS--I-FFMPYEGPRPKS----
A0A2V5W206      HVF---------------------------AESYRNIRSS--I-FFMPYDGPRPKS----
A0A2V6MW77      HVF---------------------------AESYRNIRSS--I-FFMPYDGPRPKS----
A0A2G4GZN8      IA----------------------------TEAVRSIYSA--L-KV-NPAVSKTRV----
A0A348NPT1      HV----------------------------TEAFRSIHSA--L-KI-SEESKNAKV----
A0A2E1KV60      HV----------------------------IENFRSMLSY--L-KI-SEHSKNSNV----
A0A2D7F4D9      HV----------------------------TENFRSMLSY--L-KI-NDQTKNSNV----
A0A3R7RBR8      HV----------------------------TENFRSMLSY--L-KI-NDQTKNSNV----
A0A2E0NH28      HV----------------------------TETFRSIHSA--I-RL-NEESKNAKV----
A0A350AS32      HV----------------------------TETFRSIHSA--L-KL-NDESKNAKV----
A0A368BGT4      HV----------------------------TETFRSIHSA--L-KL-NDQSKNAKI----
A0A2E0V4K6      ERQGEGASRDEEHLWDSGIVFRPGLQSSLYAESYRILRAS--V-VL-LGDEKERKV----
A0A2E6NAH3      HV----------------------------TETFRSIHSA--L-KL-SDHSKNAKV----
A0A2A5VZA5      HV----------------------------TETFRSIHSS--L-KL-NDESKNAKI----
A0A424R295      HV----------------------------TETFRSIHSS--L-KL-NDESKNAKV----
B4CZV9          KHGL--------------------------VENFRVIRTN--I-LSMGELSKPPHV----
A0A290QE54      PG----------------------------VESFLSVYSS--A-KI-HSKLDYPKS----
A0A1H1SWX2      PG----------------------------SEAFLSVYSA--V-KI-QSKLDFPKS----
A0A4Q1C9I5      PG----------------------------SEAFLSVYSA--V-KI-QSKLDFPKS----
A0A3B9FM17      GL----------------------------TEAFRSMYSR--I-QM-NSQTDYPKL----
A0A1G3ZL71      PG----------------------------VESFLSVYSA--V-KI-QSKIDYPKV----
A0A556QP09      SG----------------------------VEPFLGVYSS--V-KI-HSKLDFPKS----
A0A2T6DX88      PG----------------------------TESFLSIYSS--V-KI-HSKLDFPKA----
A0A2T6CWI7      QG----------------------------AESFLSVYSS--I-KI-HSKLDFPKS----
A0A3E1E5C8      PG----------------------------AEAFLSVYSS--V-KI-HSKLDFPKS----
B1ZZ74          PG----------------------------VEAFLSVYSS--V-KI-HSKLDFPKT----
R7E4L8          M-----------------------------EECFHILRNNAEL-MLLPNPEEAPRI----
A0A4Q3BVY2      YL----------------------------LECFRVIRAN--I-IMHPNRRNRSQV----
A0A4P6PCA7      SGIVDSFGPM--------------------VEVFVGINGY--I-LS-EKYKEQSRV----
A0A0E3YV65      DA----------------------------AETIRNLYGQ--L-KA-GSRLDLPKI----
W0J900          DA----------------------------GEIIQTLYSQ--L-RL-NSRLDAPKT----
A0A2T6DSN5      SL----------------------------SEAYRGVFSE--I-EI-RSVVPFPKR----
A0A2V2SMX4      HSF---------------------------VEAYRNLRSS--L-LY-MGNGSRPRT----
A0A317ZIW7      YIF---------------------------AEACRNLRTS--V-FFMGDESWKPSV----
A0A2D7WMI4      GL----------------------------GESFRSMFSK--I-QM-YSKTDYPKI----
A0A2D6VHX5      SL----------------------------TESFRSMYGK--I-QM-NSHVTGSKS----
A0A2D8I214      GL----------------------------TESFRSMFSR--I-QM-NSQTEYPKT----
A0A1Z8VL41      GL----------------------------TESFRSMYSR--I-QM-NSNADYPKI----
A0A2E6TNA4      GL----------------------------TESFRSMYSR--I-QM-NSNADHPKI----
A0A1Z8RG47      GL----------------------------TESFRSMYSR--I-QM-NSNADYPKV----
A0A1Z8RJJ5      GL----------------------------TESFRSMYSR--I-QM-NSNADYPKV----
A0A2D7V631      GL----------------------------TESFRSMYSR--I-QM-NSNSDYPKV----
A0A354RA24      GL----------------------------TESFRSMYSR--I-QM-NSNSDYPKV----
A0A2E9RV62      GL----------------------------TEAFRSMYSR--I-QM-NSKTDYPKT----
A0A2E4AY96      GL----------------------------AESFRSMFSK--I-QV-NSLVDFPKV----
A0A3B9B9P4      GL----------------------------AESFRSMFSK--I-QV-NSLVDFPKV----
A0A2D5Y6N6      GL----------------------------TESFRSMFSR--I-QM-NSLNDYPKT----
A0A2E7HSS8      GL----------------------------TESFRSMYSR--I-QM-NSLSDYPKL----
A0A2D8VCK3      GL----------------------------TEAFRSMYSR--I-QM-NSQTDYPKL----
A0A350QVY4      GL----------------------------TEAFRSMYSR--I-QM-NSQTDYPKL----
A0A2E4ZYR7      SL----------------------------MESFRSMFSR--I-QM-NSHVEYPKS----
A0A2E6TCV1      SL----------------------------MESFRSMFSR--M-QM-NSHIDYPKS----
A0A3D4HHL8      IIF---------------------------AEACRNLRSS--V-LFGGDENEAHQV----
A0A366HV03      PNHV--------------------------LECYRVLRAH--L-GLQLGNREGAKV----
A0A5R8KAF2      PNHL--------------------------LESFRLIRSH--I-LLHPNSKGKSQV----
A0A2V2SDN0      FEF---------------------------LESFRNIRSC--L-WFMHQNGNKPKS----
A0A1V6GL40      HSF---------------------------VEAYRNLRSS--L-LYMTEAGNRPKT----
A0A2V5X6Z6      FEF---------------------------LEAFRSIRSS--L-LFMSNGGTKPKT----
A0A2V5VGZ7      FEF---------------------------LEAFRSIRSS--L-LFMSNGGTKPKT----
A0A2V5U130      FEF---------------------------LEAFRSIRSS--L-LFMSNGGTKPKT----
A0A2V6C237      FEF---------------------------LEAFRSIRSS--L-LFMSNGGTKPKT----
A0A3R8L982      DPHTNDGQGEHA------------------TEAFLSIFSA--V-KI-HSRLDFPKS----
A0A2E7HPU9      EKQLKVSDPPGIELWDSRLIFRPALLQTLYTEAYRILRAS--V-TL-LGKEDERKV----
A0A388PR45      QA----------------------------TEAVRAIYSA--M-KI-NPASAAGRV----
A0A388QR61      LA----------------------------TESVRAIYSA--M-KI-NPATAAGRV----
A0A4P5YHI0      LA----------------------------TESVRAIYSA--M-KI-NPATAAGRV----
A0A2A2RS01      VA----------------------------TEAVRAIYSA--M-KV-SPATANSRV----
A0A2A2Y1A7      VA----------------------------TEAVRAIYSA--M-KV-SPATANSRV----
A0A388PDH9      VA----------------------------TEAVRSIYSA--M-KV-SPATANSRV----
A0A2G4H1E7      IA----------------------------TEAIRSIYSA--L-KV-NPAVSKARV----
A0A2G4GZA6      IA----------------------------TEAVRSIYSA--L-KV-NPAVSKARV----
A0A388P514      IA----------------------------TEAVRSIYSA--L-KV-NPAVSKARV----
A0A2A2YG59      IA----------------------------TEAVRSIYSA--L-KV-NPAVSKARV----
A0A2G4F7D5      IA----------------------------TEAVRSIYSA--L-KV-NPAVSKARV----
D5EML0          KD----------------------------ADLLESFRSI--Y-SS-IRMRADLSAKRKA
A0A3C1C1M3      EL----------------------------AEAFAGLRSV--L-DS-PLYRDHSQI----
A0A2E9EYJ1      PD----------------------------AEAYRILRTN--X-EF-NRKNADAXA----
A0A258AXR6      PD----------------------------AEAYRILRTN--I-EF-NRKTPDANC----
A0A3D3NZQ6      PD----------------------------AEAYRILRTN--I-EF-NRKNRDANC----
A0A1T4WVZ9      PD----------------------------AEAYRILRTN--I-EF-NRKNPDANC----
A0A4R7SSI6      PD----------------------------AEAYRILRTN--I-EF-NRRNPDANC----
                                                                            

A0A4Q3AQI1      -IMVTSALPREGKTVVSSNLSISFAQTGARTLLMDTDLRRGRLHRLFGYRK---S---P-
A0A4P6PD26      -FAVLSSGAGEGKSTTCFNLAFVCAQQGEKVLLIDADLRRPVQHTILGVSN---R---F-
A0A1Z8SVB5      -ILVTSAIPSEGKSLISANYAHTCANHGSKTILIDFDLRRPGLHNFCNESN---D---A-
A0A2V5W3Y0      -MLVTSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALREAFGVSS---K---I-
A0A432FAS4      -MAVTSTIPAEGKSLVASNHAIVMAQTGAKTLLVDFDLRRPSVHKAFQLQS---P---R-
A0A660Q3A0      -LVVTSAVPLEGKTTTCLNVGISLGQAGSRVLLVDADLRRGTMHKFFGVEA---D---R-
A0A2V5UAD5      -LLVTSAVPNEGKSTVAANLARILALGGSRVLLVDGDLRKGALHELMGMNH---E---P-
A0A258AXL1      -IMVTSARPNDGKTTVAAHLAKSFSDSGERVLLIDADLRRGTLHKAFNLGN---K---NL
A0A2E6T1E0      -MAVTSTVPSEGKSLVASNHAIVMAQTGVKTLLVDFDLRRPSVHKAFQLQS---P---R-
A0A2D5W0Q9      -LSMTSTIPSEGKSLVASNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQS-------PI
A0A1Z9KB52      -ILVTSAIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLHNFCDESN---D---E-
A0A2V5U7A0      -ILLTSPSPGEGKTATTLNLGIALAQDGYRILIIDADLRRGSCHSRIGLRN---H---R-
A0A257LYL4      -ITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDGDLRRPRLHTFFDINN---S---V-
A0A4Q2XXY1      -ITVVSGGAGEGKSTTLVNLAYICAQGGYNTLMIDGDLRRPKLHTFFDINN---S---V-
A0A3D4CZT6      -ITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINN---S---V-
A0A4V1S9Q4      -ITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFFDINN---S---V-
A0A355VK99      -ILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDLRKSSLTRRLGGSG---R---K-
A0A2V6N5E0      -FLVTSAVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALRETFGISS---K---I-
A0A2V6NH44      -ILVTSAVPNEGKSTVSANLAIALALSGARILLIDGDLRRGALREQFGSDS---R---L-
A0A432FDF6      -FSVVSGGAGEGKTTTMFNLAVVFAQQGDRVLVVDSDLRRPSMHRFFKLSN---K---I-
A0A522ACN3      -IAIVSAGAGEGKSTTVMNLATVFAQADSRVVVVDSDLRRPTLHKMLGVSN---S---L-
A0A353DCA1      -ITVVSGGAGEGKSTTLVNLAYVCSQGGYTTLMVDADLRRPRLHSFFDINN---S---V-
A0A3C1AXQ2      -ITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFDVSN---S---V-
A0A3D0IZR7      -ITVLSGGPGEGKSTTTFNLGWVCAQSGMKVLLIDGDIRRPNMHNALQIEN---T---L-
A0A520LRZ3      -MTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFFNINN---S---V-
A0A356FSV4      -FLTTSTVPSEGKSFVSSNLALTFANNGDKTLLLDGDLRLPNIARSLQVSN---D---N-
A0A3D3DET9      -ILVTSSVPNDGKSITAANLAITMANAGSRVLLVDADLRKGTLHRLFGVSP---E---P-
A0A355SVK9      -LVTTSTVPGEGKSFVSSNLALTFANHGERTLLLDADLRLPNVAKSLQLEN---D---Y-
A0A2E5D7I3      -SAFSXALPGEGKTTTSVNYALALASQGKKTLLMDMDLRKPKVHRQFNLRR---GDLET-
A0A2V5NYE2      -LLVTSSEPNEGKSLTSANLAITMANSGSRVLLVDADLRKGVLHTLFGLPS---G---P-
A0A2V6FIP7      -LAITSTIPAEGKSLVASNLAIVTAQTGLKTLLVDADLRRPSVHKVFRLQS---P---V-
A0A353DI77      -TMITSSVPGEGKTFCAANLALAYAKQGTRTLLVDFDLRKPAVHKIFNEERA--A---RP
A0A1V6GCZ3      -IAIVSAGAGEGKSTTVFNLAAVFAQSGQRTIIVDSDLRRPTLHKMLRVTN---A---I-
A0A3C1UJT2      -VLFTSSIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVGPEFKLGE---E---YV
A0A2S7U0Z3      -LLVTSAIPGEGKTTVAAELAAAFAMNKERTLLVDLDLRRPALSGTFPDLD---G---GP
A0A5E6MKA7      -MMFTSSQMGEGKSSTCVNTATVLGQQGT-VLLIDADLRRPSLHKTLGLRP---H---P-
A0A2N8IR72      -ILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGGSG---R---K-
A0A2N8IV96      -LTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDN---E---V-
R7E1V8          -LTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDN---E---V-
A0A1T4WWY4      -IMLTSARPSEGKTTVSSNVAWAFSSLGEKTLLIDCDLRRGRVHEVIGASN---A---V-
A0A3D3LEQ6      -IMLTSARPGEGKTTVSANVAWAFSSMGEKTLLIDCDLRRGRVHNVAGVPN---L---P-
A0A3D3NW23      -IMLTSARPGEGKTTVSANVAWAFSSMGEKTLLIDCDLRRGRVHNVAGVPN---L---P-
A0A2E0R252      -FLITSAVPGEGKSWVASNLALSFASQGDRTLLIDGDLRKPVQSQVFDYDK---E---HP
A0A3E1EF48      -FVVTSSLPGEGKSWISANLACGFAQQGERTVLIDADLRKGVLHSTFNLSR---E---AP
A0A2A2PVG8      -FLIASSVPGEGKSWVASNLAHSFALQGDRTLLIDADMRRPVQGEVFGYGR---E---PK
A0A2E0R421      -FLITSSVPNEGKSWVASNLALAFAKQNERTLLIDGDLRRPRIHKIFGFDR---D---EA
A0A2E5EJ69      -ILFTSAVPSEGKTFCSVNYAIANASQGKKTLIMDFDLRRPSVGDTFHIDR---K---TP
A0A2G4I5Z5      -VFFTSAVPSEGKSFCCVNYAVCYAQQGRRTLIIDFDLRKPTLAESFGVEG---E---HF
A0A4P5QQV6      -FLVTSAVPNEGKSTVALNFAITMAMFDVRVLLVDGDLRRGELHHALDLPN---G---A-
A0A2E7ALI1      -TAFSSALPGEGKTTTSINYALATASQGKKTLLLDMDLRKPKVHRQFNLRRSELE---K-
A0A178IDB9      -ILITSSVPGEGKSLTASNMAAVFAAHGRRTLLVDCDFRRPSLRRYFGTAP---G---T-
A0A290QD69      -ILFTSSIPSEGKSLTASNMAAVFAAHGKKTLLVDCDFRRPTLRRYFGTQS---G---V-
A0A2E7VDS1      -ILITSAIPSEGKSLLAANLAYSCANHGRRTILLDFDLRRPGLHKFCGVSN---D---K-
A0A178IFJ2      -LLVTSTIPGEGKSFVASNLATAFAAHGLRTLIIDGDLRRPVQHRLADAPN---T---H-
A0A357FSP9      -IVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQLEN---D---F-
A0A538NJ59      -LLVTSAVPNEGKSTVAANLARILALGGSRVLLVDGDLRKGALHELMGMNR---E---P-
A0A3C1VFY9      -LLITSAVPNDGKSVTAANLAITLATGGSRVLLVDGDLRKGSLHSRFKIQA---D---T-
A0A522AC27      -LLVTSSVPNDGKSMTAANLAITLAITGSRTLLVDADLRKGLLHARFGLKP---E---T-
A0A2A2R174      -VFFTSAVPSEGKSFCCVNYAVAYAQQGKRTLIIDFDLRKPTLAESFGIKE---D---HF
A0A1H2DTI1      -ILFTSASPDEGKTTVATNFAITLAMLEGRVLLVDADLRRGGLNRLLDIDA---P---L-
A0A1V5L462      VFLVTSCAPAEGKSTVSSNLAVTLAYSGAKTLLIDCDLRRGHLHNKFGIDR---D---P-
A0A2A2R3V9      -LLITSAIPNEGKSTFASNLAITMAFAGSRVLLVDADLRRGRIHDAFSVSN---Q---R-
A0A3D3LGD3      -ITVTSGGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMHTHFDAGN---T---T-
A0A350ARX4      -ILITSATPSEGKSTISANLAIALSHLGKRVLLIDADMRRGGVHHLFSLSA---E---N-
B5JIS2          -FVVTSTTTSEGKSTIAANVASGFVQIKRKTIIIDGDLRRPCLHQFNRIKK---S---G-
A0A1H2GQN6      -LTMISGGPGEGKSTTLFNLAHVCAEAGQSVIILDADLRRPSQHTILDIAS---G---P-
A0A512M3Y3      -IMVTSSRPSEGKTMVSSLLARSFADADQKTLLIDADMRRGRVHRVFDMEP---G---I-
A0A4P5R5J1      -ILVTSATPGEGKTTIAANLAITFAFSGARTLLVDADLRLGRIAKAFKIES---E---L-
A0A4P5YK43      -MVITSALPGDGKTTFSVNFASTLANAGLKVLLIDSDLRRGTVSNYFNQPR---T---P-
A0A2A2RPW6      -VLFTSAVPSEGKSFTGANYAVAHAQQGKKTLIIDLDLRKPSLSETFGVSS---N---QI
B4D1I7          -ILITSAVPNEGKSTVAVNFAITLALAGSRVLLVDGDLRRGELHRSFGLTN---D---A-
A0A353F286      -ITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINN---S---V-
A0A354FSA6      -ITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINN---S---V-
A0A3B9GA54      -ITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINN---S---V-
A0A520LEH8      -ITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINN---S---V-
A0A2D7B7R6      -VLFTSSIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVGPEFKLGE---E---YV
B1ZT68          -IISTSSMPGDGKSLTASNLAAAFAAHGRRTLLVDCDLRRPVLHRYFGVDL---S---N-
W0J7C2          -LLVTSSVPAEGKSLLCCNLAAVFASHKRRTLLVDCDLRRPTLHRLFGVKP---D---T-
A0A2E5K4P7      -ILNTSTIPGEGKSFVSTNLAFTYAESGNRVLLLDCDLRLPNIAKSLQLEL---T---T-
A0A0R2XPB1      -FAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQLNR---E---N-
A0A348NQP1      -FAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQLNR---E---N-
A0A357FV58      -FAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQLNR---E---N-
A0A2V6F9Q9      -ILVTSAIPNEGKSTVSANLAIALALSGARVLLIDGDLRRGTLREQFNSNS---R---L-
A0A2V6NZZ3      -ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---V-
A0A2V6EBU2      -ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---I-
A0A2V6EY06      -ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---I-
A0A2V6ME53      -ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---V-
A0A538NUU0      -ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---V-
A0A2V6NIJ1      -ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---V-
A0A2V6C292      -ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLREQFGSNS---R---V-
A0A2V6D2X0      -ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLREQFGSNS---R---V-
A0A2V5ZUK1      -FLITSAVPSEGKSTVSSNLAITMALSGAKVLLIDCDLRRGAIREAFGIDS---K---I-
A0A2V5XFN9      -FLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITS---K---I-
A0A2V6EZC8      -FLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITS---K---I-
A0A2V6I7Z5      -FLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITS---K---I-
A0A3B9LCP2      -LLVTSAVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALREAFGISS---E---I-
A0A3C0R669      -LLVTSAVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALREAFGISS---K---I-
A0A2V6EID2      -LLVTSAVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALREAFGISS---K---L-
A0A2V6MHB0      -LLVTSAVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALREAFGISS---K---L-
A0A2W5YWL9      -LLITSAVPSEGKSTISANLAITMALSGARTLLIDGDLRRGALREQFGVSS---R---I-
A0A2V5NH62      -MLVTSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALREAFGISS---K---I-
A0A2W6A620      -LLITSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALRESFGVSS---K---I-
A0A2V5PIJ4      -FLVTSAIPNEGKSTVSANLSITMALAGARTLLIDGDLRRGALRDAFGVSS---K---I-
A0A2V6K2G8      -FLVTSAVPSEGKSTVSANLAITMALSGARTLLIDCDLRRGALREAFGITS---K---I-
A0A2V5W206      -FLVTSAVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALRETFGISS---K---I-
A0A2V6MW77      -FLVTSAVPSEGKSTISANLAITMALSGARTLLIDCDLRRGGLREAFGISS---K---I-
A0A2G4GZN8      -FLVTSTRPSEGKTFVATNLALLFAQHSERVLVIDADLRLPNVGPSLGFTG---D---G-
A0A348NPT1      -IVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQLEN---D---F-
A0A2E1KV60      -FLITSTTPSEGKSFISSNLALSFSAHGEKVLLLDADLRLPNVAKSLQLEN---D---S-
A0A2D7F4D9      -FLLTSTVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVAKSLQLEN---E---S-
A0A3R7RBR8      -FLLTSTVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVAKSLQLEN---E---S-
A0A2E0NH28      -FLTTSTVPSEGKSFVSSNLALTFANNGDKTLLLDGDLRLPNIARSLQVSN---D---N-
A0A350AS32      -IVTTSTVPGEGKSFVSSNLALTFANHGEKTLLLDGDLRLPNVARSLQLEN---D---F-
A0A368BGT4      -ILATSTVPGEGKSFVSSNLSLTFANHGEKTLLIDGDLRLPNVARSLQLKN---D---L-
A0A2E0V4K6      -SLFFSALPGEGKTTTSINYALATASQGRKTLLLDMDLRKPRVHRQLGRRRSEQG---K-
A0A2E6NAH3      -ILTTSTVPGEGKSFVSSNLSLTFANHGEKTLLLDCDLRLPNVARSLQIEN---D---L-
A0A2A5VZA5      -ILATSTVPSEGKSFVSSNMALTFANHGERTLLLDADLRLPNIASSLQLPN---E---F-
A0A424R295      -ILATSTVPSEGKSFVSSNMALTFANHGERTLLLDADLRLPNIASSLQLPN---E---F-
B4CZV9          -VMVTSAMPKEGKTVVSSNLAASFALTGAKTLLIDTDLRRGRLHRLFGYRK---E---P-
A0A290QE54      -ILVTSTIPGEGKTLVSSNLAASFARHGKRTLLIDCDLRRPMVHRHFNQPN---D---N-
A0A1H1SWX2      -ILVTSTIPGEGKTMISCNLAGSFARHGKKVLLIDCDMRRPMLHRHFKLTN---E---A-
A0A4Q1C9I5      -ILVTSTIPGEGKTMISCNLAASFARHGKRVLIIDCDMRRPMLHRHFQLPN---E---A-
A0A3B9FM17      -ILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCNLEN---S---K-
A0A1G3ZL71      -ILVTSTIPGEGKTLVSCNLAGSFARHGRSTLIIDCDMRRPMLHRHFKMEN---D---A-
A0A556QP09      -ILVTSTIPGEGKTLISSNLAGSFARHGKSVLLIDCDLRRPMMHRHFELAN---E---A-
A0A2T6DX88      -ILVTSTIPGEGKTLVSCNLAASFARHGKSTLIVDCDLRRPMLHRRFGKEN---E---A-
A0A2T6CWI7      -VLVTSTIPGEGKTLISCNVAGCFARHGKKTLLIDCDLRRPMLHRHFKQEN---K---N-
A0A3E1E5C8      -ILITSTIPGEGKTLIACNLAGSFARHGKRTLLIDCDLRRPMLHRNFKQEN---L---H-
B1ZZ74          -VLVTSTIPGEGKTLISCNLAGSFARHGKNTLLIDCDLRRPMLHRHYKQQN---N---A-
R7E4L8          -LFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFYGGKN---A---R-
A0A4Q3BVY2      -VLVTSARPQEGKTTQATNLAWAFQSMGEKTLLLDCDLRRGRIHGVVDIDK---A---P-
A0A4P6PCA7      -LMISSAGPGEGKTISSCNLAISLARNGLKTLLIDADLRRPQIGNIFEIPA---E---HP
A0A0E3YV65      -LLVTSTLPGEGKSFVASNLAASFASHGIKTLLVDTDFRRPTLHRYYGQSN---D---A-
W0J900          -LIVTSTVPGEGKSFVASNLATAFAAHGMRTLIIDGDLRRPVQHRLAGAPN---T---H-
A0A2T6DSN5      -LLVTSSVPSEGKSLTASNLAAVFAAHGRRTLLVDCDFRRPTLRRYFGATA---G---V-
A0A2V2SMX4      -LLITSSAPGEGKSLTAENLGAILANTGSRVLLVDGDLRKGVLHSRFGLDA---M---P-
A0A317ZIW7      -FAVTSAVPSEGKSTVSANLAVALSFSHSKVLLVDADLRRGRLHKLMNLDF---D---G-
A0A2D7WMI4      -ILVTSAIPSEGKSLISANLAYTCANHGKNTILIDFDLRRPGLHKFAGLDN---E---S-
A0A2D6VHX5      -ILVTSAIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLHNFCDESN---D---E-
A0A2D8I214      -ILITSAIPSEGKSLISANLAYSCANHGRRTVLVDFDLRRPGLHKFCGIEN---K---T-
A0A1Z8VL41      -ILVTSAIPSEGKSLISANLAXSCANHGRKTILIDFDLRRPGLHKFCSITN---D---N-
A0A2E6TNA4      -ILVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHKFCSISN---D---K-
A0A1Z8RG47      -LLVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHNLCNITN---E---K-
A0A1Z8RJJ5      -LLVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHNLCNITN---E---K-
A0A2D7V631      -LLVTSAIPSEGKSLISANLAYSCANHGRKTILIDFDLRRPGLHNFCNITN---E---K-
A0A354RA24      -LLVTSAIPSEGKSLISANLAYSCANHGRKTILIDFDLRRPGLHNFCNITN---E---K-
A0A2E9RV62      -ILITSAIPSEGKSLLAANLAYSCANHGRKTILVDFDLRRPGLHKFCGVNN---D---R-
A0A2E4AY96      -ILVTSAIPSEGKSLISTNLAFTCANHGKKTILIDFDLRRPGLHKFVGLEN---E---G-
A0A3B9B9P4      -ILVTSAIPSEGKSLISTNLAFTCANHGKKTILIDFDLRRPGLHKFVGLEN---E---G-
A0A2D5Y6N6      -ILVTSAIPSEGKSLISANLAYSCANHGKKTILIDFDLRRPGIHKFCNITN---E---K-
A0A2E7HSS8      -ILVTSAIPSEGKSLISANLAHSCANHGRKTILIDFDLRRPGLHKFCNMEN---E---R-
A0A2D8VCK3      -ILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCNLEN---S---K-
A0A350QVY4      -ILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCNLEN---S---K-
A0A2E4ZYR7      -MLITSAIPSEGKSLLAANLAYSCANHGRRTILIDFDLRRPGLHKFCGVSN---D---R-
A0A2E6TCV1      -MLITSAIPSEGKSLLAANLAYSCANHGRRTILIDFDLRRPGLHKFCGVSN---D---R-
A0A3D4HHL8      -VAVTSSVPGEGKSTMAANLAVTLAFAGKKTLLLDADLRRGVLHNAFNVPN---D---K-
A0A366HV03      -VMFTSARPSEGKTVTAANLAWTLQSIGAKTLLVDLDFRKGRVHNLFGVDR---Y---P-
A0A5R8KAF2      -IMVTSARPSEGKTSQAANLAWAFQSMGSRTLLIDCDLRRGRVHQVLDVAN---D---I-
A0A2V2SDN0      -LLIGSSVPQEGKSTVALYLAATMAIGGSKVLLIDGDMRRAKLHRHFGVAS---S---P-
A0A1V6GL40      -ILVTSSVPNDGKSITAANLAITMANAGSRVLLVDADLRKGTLHRLFGVSP---E---P-
A0A2V5X6Z6      -IVVASSVPEEGKSTVALYLAATLAKGNSRVLLIDADMRRTALHKFFGAAS---S---P-
A0A2V5VGZ7      -IIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTAS---S---P-
A0A2V5U130      -IIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTAP---R---P-
A0A2V6C237      -IIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTAS---S---P-
A0A3R8L982      -ILVTSTIPGEGKTLISCNLAGAFARHGRRTLLIDCDLRRPTIHRHFGIEN---N---A-
A0A2E7HPU9      -SLFTSSIPGEGKTTTSSNFAIAAAQQGKKTILVDFDLRKPAVHKAFGLKRRDLP---T-
A0A388PR45      -FLVTSTRPGEGKTFVATNLALAFAQHAERVIVVDADLRLPNVGPSLGFAG---D---G-
A0A388QR61      -FLVTSTRPGEGKTFVATNLALTFAQHSERVIVVDADLRLPNVGPSLGFAG---D---G-
A0A4P5YHI0      -FLVTSTRPGEGKTFVATNLALTFAQHSERVIVVDADLRLPNVGPSLGFAG---D---G-
A0A2A2RS01      -FLVTSTRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVGPSLGFSG---D---G-
A0A2A2Y1A7      -FLVTSTRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVGPSLGFSG---D---G-
A0A388PDH9      -FLVTSTRPGEGKTFVATNLALSFAQHAERVLVIDADLRLPNVGPSLGFSG---D---G-
A0A2G4H1E7      -FLLTSTRPSEGKTFVATNLAMIFAQHSERVLIIDADLRLPNVGPTLGFTG---D---A-
A0A2G4GZA6      -FLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTG---D---G-
A0A388P514      -FLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTG---D---G-
A0A2A2YG59      -FLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTG---D---G-
A0A2G4F7D5      -FLVTSTRPSEGKTFIATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTG---D---G-
D5EML0          SFVITSSVPNEGKSMVACNLSAVIAKHNYRVLLVDCDLRNPSLHRAHGVED---D---A-
A0A3C1C1M3      -VLVASSLPEEGKTTTSCNLATACALNGQKTLLIDFDLRRPRVGNIFPRPE---A---VC
A0A2E9EYJ1      -ITLVSGGAGEGKSTTLVXLAYVCAQGGYNTLMIDGDLRRPQLHTFFNINN---S---V-
A0A258AXR6      -LSVVSGGAGEGKSTTMVNLAYVCAQGGYNVLLIDADLRRPSLHTHFDVSH---A---T-
A0A3D3NZQ6      -ITVTSGGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMHTHFDAGN---T---T-
A0A1T4WVZ9      -ITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFDVSN---A---V-
A0A4R7SSI6      -ITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFDVSN---A---V-
                          :**:      .          :::* *:*                     

A0A4Q3AQI1      GLSNVLLGE-CTLDEAL-------RPTV-SENLTVLS---AGKHLD------TGTELLGS
A0A4P6PD26      GLTNVLLRD-VPVEEAI-------KATS-VPNLHFLP---SGRLPR------TSLGVLDP
A0A1Z8SVB5      GVMTILNTP-NATEEQISEKIEKCLCNI-HPNLFLLP---SGGKTR------AATEIIEK
A0A2V5W3Y0      GFSEVLKQE-VNWQEVV-------VPTS-YPNLFLLP---RGKTLG------QPSEHLLR
A0A432FAS4      GLSSYLLGKIDSIEEIV-------HHAE-VPNLDVIC---CGAVPN------NPSELAGS
A0A660Q3A0      GLTDILVGRAKP-EAVI-------QRTP-IPNVDFIG---SGPYPP------NPAELLMR
A0A2V5UAD5      GLSEMLRCP-EDLEKI--------IQTNSLPNFFFVS---SGGRLS------NPGDLFLN
A0A258AXL1      GLMEILADR-VKWNDA--------VRSSGVENLDFIS---RGNDSA------RGHDLLSS
A0A2E6T1E0      GLSSYLLGK-VDSIDAI-------VHQTEVPNLDVIC---CGAVPN------NPSELSGS
A0A2D5W0Q9      GLSAYLTGQITDPSEIT-------QTTE-VPNLDLIC---CGAVPN------NPSELVGS
A0A1Z9KB52      GVMTILNTP-NATEEEVTDKLKKVLCSI-HPNLFLLP---SGGKTR------AATEIIEK
A0A2V5U7A0      GLSNVLGGE-MPIEQLI-------QPTS-IAGLSLVT---RGVCPP------NPSELLGT
A0A257LYL4      GLTNYLTTE-LMLEDVI-------LQTP-VDNLYFMP---SGILPA------DAAGILNS
A0A4Q2XXY1      GLTNYLTTA-LQLEDVI-------LQTP-VENLYFMP---SGILPA------DAAGILNS
A0A3D4CZT6      GLSNYLTTD-LMLEDVI-------LQTP-VDNLYFLP---SGILPA------DAAGLLNS
A0A4V1S9Q4      GLTNYLTTE-LMLEDVI-------LQTP-VDNLYFMP---SGILPA------DAAGILNS
A0A355VK99      GLTSILLRQ-NPDTAGV-------IRPV-GEDTRGMDVLYTGPTVP------NPVTLLSH
A0A2V6N5E0      GFSEVLKQE-VNWREVV-------VPTA-YETLFVLP---RGKTLS------QPSEHLLR
A0A2V6NH44      GFSEVLQQE-VPWQEVV-------MPTT-YPSLFLLT---RGKALP------QPSEHLLR
A0A432FDF6      GLTNYLLGQ-ATIEEVI-------QTTE-LPSLHFIP---SGKLPS------SSMGILSS
A0A522ACN3      GLTNYLLKQ-NKLEEVI-------QHSN-VANLDFLP---SGKLPS------SSLGILSS
A0A353DCA1      GLTNYLTTD-LALEDVI-------LQTP-VDNLYFLP---SGILPA------DAAGILNS
A0A3C1AXQ2      GLTNFLTTN-VQLEEVV-------VRTP-VENLYFLP---SGMLPA------DSAGVLNS
A0A3D0IZR7      GLGEYLAGQ-ASLDELI-------QSTA-IPNLEILT---AGSLGP------EELGGFSR
A0A520LRZ3      GLTNYLTTD-LALEDVI-------LQTA-YENLFFMP---SGILPS------DAAGILNS
A0A356FSV4      GLIDYIDHD-VDINAVI-------VNEV-YPHLDVLP---AGGKSK------NPTQILNS
A0A3D3DET9      GLSDVLAKG-TAWETTV-------SATK-IANLHILP---AGTFTA------RSSELFIS
A0A355SVK9      GLLNHVDKG-VSLDELI-------IKEV-YPNLDVLP---TGGKSK------NPTQVLNS
A0A2E5D7I3      GMSEVLSNQ-CDASEAV---------TK-TPGIERLDAIFAGGKAP------NPGELLRE
A0A2V5NYE2      GLSEALSQG-LNWSEAV-------QATR-TPNLFLLP---RGAITH------KSSEFFIG
A0A2V6FIP7      GLSSYLMEKVSRVDEFI-------HTTE-VPHLDVVC---CGAVPS------SPSELAGS
A0A353DI77      GIVNVLNGT-AAANQAI-------TVYPGLDTLSVIY---SGPKSP------NPGELLEP
A0A1V6GCZ3      GLTNYLLRQ-NTLEEVI-------QTTS-LPTLDFLS---SGKLPS------SSLGILSS
A0A3C1UJT2      GVSDLLQSE-----DKLGQFPDLAIYEA-TEKLFVLH---GGSHIS------NPSEHISG
A0A2S7U0Z3      GIVEVLAGQ-ASIQDVF-------SDTE-IENLTVVC---SGAKAP------NPSELLNE
A0A5E6MKA7      GLSELLTNQ-APLEQAV-------QATA-LPNVWAIG---AGRTPC------HPADLLGA
A0A2N8IR72      GLTSILLQQTTDTTGIIRP-----LGEN-SRGMDILY---TGPMVP------NPVTLLSH
A0A2N8IV96      GLTSYLLED-YPLEEVI-------FQTP-IENLYVMP---AGPTPF------DPSGALNS
R7E1V8          GLTSYLLED-YPLEEVI-------FQTP-IENLYVMP---AGPTPF------DPSGALNS
A0A1T4WWY4      GMTDLLTGR-ASLSECV-------QKVE-AENLWAIT---RGMVVP------GTTELLNS
A0A3D3LEQ6      GLTRLLTGQ-ATLEECL-------VKSP-AENLWLLP---RGQVIA------GTTELLNT
A0A3D3NW23      GLTRLLTGQ-ATLEECL-------VKSP-AENLWLLP---RGQVIA------GTTELLNT
A0A2E0R252      GLSDHLSLN-RPLKEVV-------MKTRESENLFIMP---AGSRSA------NPSELLAG
A0A3E1EF48      GVTNLLSRT-SSLAEVI-------HQT-EIENLWFVP---GGGKSA------NPAELLGG
A0A2A2PVG8      GLADVLSLG-TPLKEVI-------LRSEVSEDLFLIP---AGSWSA------NPAELLSG
A0A2E0R421      GLSDHLSLR-TPLNKVV-------KPTDKSGKLYVLL---AGSPSA------SPSELLAS
A0A2E5EJ69      GVTDLLLAN-KTLDEVA-------LKTD-FENLTLIP---AGSTVP------NPSELIAS
A0A2G4I5Z5      GVSDVLLGK-VPLDQCV-------QKTR-FDNLFLLT---AGTMVP------NPAELLSG
A0A4P5QQV6      GFGDVLNGD-CALQSAV-------QQTR-VPGLSLLS---RGSTVQ------NPGELFLS
A0A2E7ALI1      GMSEVLSNQ-CTPEEAL-------TKTPGIETLDAIF---AGGKAP------NPGELLRE
A0A178IDB9      GLLSWLRAHPDDGADTPLDLATLGIATV-ENNLHLLP---AGHAIK------NPTEIIDQ
A0A290QD69      GLLPWLRENGSNAA-AQVETQKMGIVTI-APGLDLLP---AGDAIK------NPTEVIDQ
A0A2E7VDS1      GLLTLINEI---HGEHGTEPERNALTEI-YPNLYVLP---SGGKTR------AATEMLAR
A0A178IFJ2      GLLRWLDKG-GKSGGPLANDPDLDLLRP-APNLFVLR---AGGTSR------RISELLDN
A0A357FSP9      GMLDHIEKE-VALDEVI-------MKAV-YPNLDVLP---SGGKSK------NPTQVLNS
A0A538NJ59      GLSEMLRCP-EDLEKII-------QTNS-LPNFFFVS---SGGRLS------NPGDLFLN
A0A3C1VFY9      GLSESLAQG-MDWHKAV-------KETT-VGNLFLLP---RGASTQ------HSSELFLG
A0A522AC27      GLSEVLLAK-KDWRNCI-------CKTG-VANLDLLP---RGGTTQ------RSSELFVH
A0A2A2R174      GVSDVLLNK-AQLEQAV-------QTTR-FDNLFLLT---AGTTVP------NPAELLSG
A0A1H2DTI1      GFTDVLLHG-ADWRKAV-------VPSK-HKNLSVMV---CGKYTS------QGAELFLS
A0A1V5L462      GLAELLEHPEMDVQDVIL------VGDQELGNLSVIS---AGRPQE------NPGDLFLN
A0A2A2R3V9      GLSDVLSNQ-MNWRDAI-------QESA-AYHFHIIP---RGPTPP------NPGELFLS
A0A3D3LGD3      GLTNFLTTN-VRMEDVV-------VRTA-VENLYFLP---SGLLPA------DSAGILNS
A0A350ARX4      GLSDLLSCE-SDFDGYV-------QQTQ-HAKLDLIA---NGRSLL------NSGELLLS
B5JIS2          GLIRWAEEG-YPMDDIYGEDSPLGIQKL-KGGAYLLP---AGGVFP------LPSKLLVS
A0A1H2GQN6      GLADHLIRG-VPIADLI-------RETA-IPNLHIIP---AGEDAH------DAISRFDN
A0A512M3Y3      GLSGFLAGEVSQLTDAV-------IKTD-SPKLEVLS---RGKNSA------PRFEILSA
A0A4P5R5J1      GLSDVLRQR-THWREVI-------VPSS-TPNLSILP---RGKTLP------HPAEHFLG
A0A4P5YK43      GFSEVLAGD-RPWQQSV-------RETP-IPTLHLLT---TGQLIA------NPGELLMG
A0A2A2RPW6      GATDVMLGR-EPFEKGV-------QTTR-FENLFLMT---AGKMVP------NPAELLAG
B4D1I7          GFGDVLSGR-KSLDDAI-------QLTL-VPGLMLLS---RGRGVP------NPGELYLG
A0A353F286      GLTNYLTTD-LALEDVI-------LQTP-VDNLYFMP---SGILPA------DAAGILNS
A0A354FSA6      GLTNYLTTD-LALEDVI-------LQTP-VDNLYFMP---SGILPA------DAAGILNS
A0A3B9GA54      GLTNYLTTD-VALEDVI-------LQTP-VDNLYFMP---SGILPA------DAAGILNS
A0A520LEH8      GLTNYLTTD-LALEDVI-------LQTP-VDNLYFMP---SGILPA------DAAGILNS
A0A2D7B7R6      GVSDLLQSE-----DKLGQFPDLAIYEA-TEKLFVLH---GGSHIS------NPSEHISG
B1ZT68          GWIRALATSAAGGQPPP---LPTTIA-F-SENLDLLP---SGGVAK------NPTETLER
W0J7C2          GWVDWLETDPA--QRPT---LPVGIVPV-ADHLDLLP---AGRSLG------RPTELLDQ
A0A2E5K4P7      GLLDYVQGT-ATLEEVI-------VPGV-FTNLDILP---AGGRSR------TPMTIFNN
A0A0R2XPB1      GFSDILEGS-LTLDSAV-------QSSS-YEHLDFVS---IGGYPD------HPAELLMS
A0A348NQP1      GFSDILDGN-LTLDNAV-------QSTS-YKHLDFVS---IGGYPD------HPAELLMS
A0A357FV58      GFSDILDGN-LTLDNAV-------QSTS-YKHLDFVS---IGGYPD------HPAELLMS
A0A2V6F9Q9      GFSEVLRQE-VPWSEVV-------MPTA-YHSLSLLT---RGKPLT------QPSEHLLR
A0A2V6NZZ3      GFAEVLQQE-VPWQEVV-------MPTA-YPSLLLVT---RGKTLA------QPSEHLLR
A0A2V6EBU2      GFAEVLQQE-VPWQEVV-------MPTA-YPSLLLVT---RGKTLA------QPSEHLLR
A0A2V6EY06      GFAEVLQQE-VPWQEVV-------MPTA-YPSLLLVT---RGKTLA------QPSEHLLR
A0A2V6ME53      GFAEVLQQE-VPWQEVV-------MPTT-YPSLFLVT---RGKTLP------QPSEHLLR
A0A538NUU0      GFAEVLQQE-VPWQEVV-------MPTT-YPSLFLVT---RGKTLP------QPSEHLLR
A0A2V6NIJ1      GFAEILQQE-VPWQEVV-------MPTV-YPSLFLLT---RGKALT------QPSEHLLR
A0A2V6C292      GFSEVLQQE-VPWQEVV-------MPTA-YPSLFLLM---RGKALA------QPSEHLLR
A0A2V6D2X0      GFSEVLQQE-VPWQEVV-------MPTA-YPSLFLLM---RGKALA------QPSEHLLR
A0A2V5ZUK1      GFSEVLKGE-VNWREVV-------VPTA-YETLFVLP---RGKTLG------QPSERLLH
A0A2V5XFN9      GFSEVLKQE-VNWREVV-------VPTA-VPTLFVLP---RGKPLS------QPSEHLLR
A0A2V6EZC8      GFSEVLKQE-VNWREVV-------VPTA-VPTLFVLP---RGKPLS------QPSEHLLR
A0A2V6I7Z5      GFSEVLKQE-VNWREVV-------VPTA-VPTLFVLP---RGKPLS------QPSEHLLR
A0A3B9LCP2      GFSEVLKQE-VNWQEVV-------VPTF-YPSLFVLP---RGKISA------QPSEHLLR
A0A3C0R669      GFSEVLKQE-VNWQEVV-------VPTF-YPSLFVLP---RGKISA------QPSEHLLR
A0A2V6EID2      GLSEVLKQE-VNWQEVV-------VPTS-YPSLFILP---RGKSLS------QPSEHLLR
A0A2V6MHB0      GLSEVLKQE-VNWQEVV-------VPTS-YPSLFILP---RGKSLS------QPSEHLLR
A0A2W5YWL9      GFAEALKQE-VNWREVV-------VPTS-CSNLSLLP---RGKTVA------QPSEHLLR
A0A2V5NH62      GFSEVLKQE-VNWQEVV-------VPTT-YENLFVLP---RGKTLG------QPSEHLLR
A0A2W6A620      GFSEVLKQE-VNWQEVV-------VPTS-YPNLYLMP---RGKTLG------QPSEHLLR
A0A2V5PIJ4      GFSEVLQQE-VNWRQVV-------VPTS-YPNLFLMP---RGKTIG------QPSEFLLR
A0A2V6K2G8      GFSEVLKQE-VNWREVV-------VPTA-VSTLFVLP---RGKTLG------QPSEHLLR
A0A2V5W206      GFSEVLKQE-VNWREVV-------VPTA-YETLFVLP---RGKTLS------QPSEHLLR
A0A2V6MW77      GFSEVLKQE-VNWREVV-------VPTA-YETLFVLP---RGKTLS------QPSEQLLR
A0A2G4GZN8      GLSKWFNAE-MTLDDAI-------VRDV-APGLDVLP---VGLSCK------NPTQVINN
A0A348NPT1      GMLDHIEKE-VALDEVI-------MKAV-YPNLDVLP---SGGKSK------NPTQVLNS
A0A2E1KV60      GVIDFINGD-DSISNFI-------VKDV-YPNFDVLP---SGGKSK------NPTAVLSD
A0A2D7F4D9      GVLDYIQGE-GTFDSYI-------AKEV-YPNLDILA---SGGKAK------NPTAILND
A0A3R7RBR8      GVLDYIQGE-GTFDSYI-------AKEV-YPNLDILA---SGGKAK------NPTAILND
A0A2E0NH28      GLIDYIDHD-VDINAVI-------VNEV-YPHLDVLP---AGGKSK------NPTQILNS
A0A350AS32      GLLDHVDKD-VAIDEVI-------IKEV-YPNLDVLP---SGGKSK------NPTQVLNS
A0A368BGT4      GLLDHVEKG-VSLEDII-------IKDV-CPNLDVLP---TGGKSK------NPTQVLNS
A0A2E0V4K6      GMAEILARQ-CPPEEAV-------CQDVGHGNLDAVF---AGGKVR------NPGELLKP
A0A2E6NAH3      GMLDYVENG-VSLDEVI-------VKEV-YPNLDVLS---TGGKSK------NPTQVLNS
A0A2A5VZA5      GLLDHIEQG-SRLDDMI-------VSEV-YPNLDVLP---SGGKSK------NPTQVLVS
A0A424R295      GLLDHIEQG-SRLDDMI-------VSEV-YPNLDVLP---SGGKSK------NPTQVLVS
B4CZV9          GLSNVLLGE-CTLEDAFRPSG--------QENLTVLS---AGRHLD------HGTELLGS
A0A290QE54      GLITWFEHG-ASLDGDLTENQHLGITRL-SENFSLLC---SGGRSK------TPTEILEN
A0A1H1SWX2      GLIAWFEAG-AKIPADPFTDASLGFTKV-DENLFLLR---SGGRSK------SPTELLET
A0A4Q1C9I5      GLLAWFEAG-AKIPEDPFTDASLGLTKA-EENLFLLR---SGGRSK------SPTEFLEN
A0A3B9FM17      GLLSLVNDV-GKPGQDVQNCISESLTEV-HPNLFLLP---SGGKTR------AATEMLEQ
A0A1G3ZL71      GLLAWAEAG-ASLDGDLTTDPKLGLARI-ADNLMLLR---SGGRSK------VPTELLEK
A0A556QP09      GLITWYEKG-ASLDGDLTINPSLGITSI-GENLSLLS---SGGRSK------SPTQLLES
A0A2T6DX88      GLLTWFEKG-GKVEGDLANDPTLGIVKL-EDNLSLLR---SGGRSK------IPTELLED
A0A2T6CWI7      GLITWFESG-AMLDSNLTTHPSLGIVPV-AENLWLLC---SGGRSK------SPTELLEN
A0A3E1E5C8      GLITWFEGG-AKLDGDLSTDPSLGIIKL-ADNLSLLC---SGGRAK------SPTELLEN
B1ZZ74          GLITWFEAG-SPLDGELASTPALGIIKI-SENLSLLC---SGGRSK------SPTEFLEN
R7E4L8          GLVHLLMNPQVSPDSVLQSGKR-------FPGFDLVT---AGPVPP------NPVALLTQ
A0A4Q3BVY2      GMTRLLLGE-CTLEQAI--------HSMGQGGFDVIP---RGPVIA------GTTELLCQ
A0A4P6PCA7      SLLEWLSSGSSELERSE-----LVSRNV-IEHLDVIT---SRPLKNV-----NPAEMLGR
A0A0E3YV65      GLLRWLDTK-SKTEPALLRDPALGITAF-GPSLHLLR---SGGTTR------RSTEILDS
W0J900          GLLRWLDKG-GRSDGPLAGDPDLGLLRP-APNLFVLR---AGGISR------RISELLES
A0A2T6DSN5      GLLPWLREN-AHRPDVQIDAHKMGIMNI-GPAFDLLP---AGDAIK------NPTEVIDQ
A0A2V2SMX4      GLTEVLADG---------KPVRDVIRETTIPNLWLLP---RGSTTH------HSSELFIS
A0A317ZIW7      GLTDVLEGR-KEMEEVI-------QRST-YDNLDFVS---IGGHPD------HPAELLMS
A0A2D7WMI4      GIITLVNE-MSQNPNFIDSGLKKHLKNI-HPNLNMLT---SGGKTR------SVTELIER
A0A2D6VHX5      GVMTILNT-PNATEEEVTDKLKKVLCSI-HPNLFLLP---SGGKTR------AATEIIEK
A0A2D8I214      GLVSLVN--VASSKENLKNSINDSVQEI-HPNLYILP---SGGKTR------AATEMLEQ
A0A1Z8VL41      GLLTLINE-AKNGVENLRELTDKTLHPI-HDNLYILP---SGGKTR------AATEILES
A0A2E6TNA4      GLLTLINE-AKNGVENLHELADKTLHPI-HDNLYILP---SGGKTR------AATEILES
A0A1Z8RG47      GIVTLVNE-VVKGSKDIDTHIQESLHET-HPNLHVLP---SGGKTR------AATEMLER
A0A1Z8RJJ5      GIVTLVNE-VVKGSKDIDTHIQESLHET-HPNLHVLP---SGGKTR------AATEMLER
A0A2D7V631      GIVSLVNE-VVKGSSDIDEQIKSCLHEI-HPNLHVLP---SGGKTR------AATEMLER
A0A354RA24      GIVSLVNE-VVKGSSDIDEQIKSCLHEI-HPNLHVLP---SGGKTR------AATEMLER
A0A2E9RV62      GLLTLINETVANPTPNYNFWDSGTLVEI-YPNLLILP---SGGKTR------AATEMLEK
A0A2E4AY96      GLIPIINK-SAEQPNYIKENLDSELHDI-HPNLKMLT---SGGKTR------SVTELIEK
A0A3B9B9P4      GLIPIINK-SAEQPNYIKENLDSELHDI-HPNLKMLT---SGGKTR------SVTELIEK
A0A2D5Y6N6      GLLSLINS-EKTDLKELQELAQSTVTQI-HPNLLVLP---SGGKTR------AATELLES
A0A2E7HSS8      GLLSLVNE-VSQKGGDIDQSVTETLTEI-HPNLFVLP---SGGKTR------AATEMLEH
A0A2D8VCK3      GLLSLVND-VGKPGQDVQNCISESLTEV-HPNLFLLP---SGGKTR------AATEMLEQ
A0A350QVY4      GLLSLVND-VGKPGQDVQNCISESLTEV-HPNLFLLP---SGGKTR------AATEMLEQ
A0A2E4ZYR7      GLLTLVNE-I--NGEHDTEAERNALTEI-YPNLYVLP---SGGKTR------AATEMLER
A0A2E6TCV1      GLLTLVNE-I--NGEHGTEAERNALTEI-YPNLYVLP---SGGKTR------AATEMLER
A0A3D4HHL8      GLSDVIRER-ISFDDAI-------QRPG-IENLDFVA---HGTTTK------RPGELLSG
A0A366HV03      GFCQALTGE-LVLEDVV-------RHTH-LANFHYCT---RGNTSA------GSAELLCR
A0A5R8KAF2      GITQLLLNR-FPVQEAV-------LKTS-NPLLDVIP---RGPIIT------GTTELLCQ
A0A2V2SDN0      GLAEILNQE-TYPNYGI-------VTTA-LENLSFLP---AGAPTL------EPGELVLR
A0A1V6GL40      GLSDVLAKG-TAWETTV-------SATK-IANLHILP---AGTFTA------RSSELFIS
A0A2V5X6Z6      GLAEVLNEE-ISFAEAI-------VPTG-LENLALLP---AGEARQ------NPGELALS
A0A2V5VGZ7      GLAEILNEE-ISFKEAI-------VPTG-LENLALLP---AGEANR------NPGELVLS
A0A2V5U130      GLAEILNEE-ISFAEAI-------VPTG-LENLALLP---AGEANR------NPGELVLS
A0A2V6C237      GLAEILNEE-ISFKEAI-------VPTG-LENLALLP---AGEANR------NPGELVLS
A0A3R8L982      GLLAWFEAG-APFDDLLPENPHLGVIKI-GENFDLLR---SGGRSR------TPTEFLES
A0A2E7HPU9      GLTEVLTGK-ATLAEAI-------QEQAGQENFSIIF---AGQKAP------NPGELLTT
A0A388PR45      GVSRWFNGE-MTLDEAI-------VKDV-APGLDVLP---VGLSCR------NPTQVINH
A0A388QR61      GVSRWYNGE-MTLDEAI-------VKDV-APGLDVLP---VGMSCR------NPTQVINN
A0A4P5YHI0      GVSRWYNGE-MTLDEAI-------VKDV-APGLDVLP---VGMSCR------NPTQVINN
A0A2A2RS01      GVSRWFNGE-MTLDEAI-------VRDV-APGLDVLP---VGMSCR------NPTQVINN
A0A2A2Y1A7      GVSRWFNGE-MTLDEAI-------VRDV-APGLDVLP---VGMSCR------NPTQVINN
A0A388PDH9      GVSRWFNGE-MTLDEAI-------VRDV-APGLDVLP---VGMSCR------NPTQVINN
A0A2G4H1E7      GLSKWFNGE-IPLDDAI-------IREV-APGLDVLP---VGLSCK------NPTQVINH
A0A2G4GZA6      GLSKWFNAE-MSLDEAI-------VHDV-SPGLDVLP---VGLSCK------NPTQVINN
A0A388P514      GLSKWFNGE-MSIEEAI-------VHDV-SPGLDVLP---VGLSCK------NPTQVINN
A0A2A2YG59      GLSKWFNGE-MSIDEAI-------VHDV-SPGLDVLP---VGLSCK------NPTQVINN
A0A2G4F7D5      GLSKWFNGE-MSIDEAI-------VHDV-ASGLDVLP---VGLSCK------NPTQVINN
D5EML0          GLCPWFDSGSTDMEDLL-------GNES-LGILKLSP---SLSLLRAGGGCEHPTELLGD
A0A3C1C1M3      GLLEYLDSDQMKPEEIV-------YASE-CRNLSVIS---SRVVGRS-----RPAELVGG
A0A2E9EYJ1      GLTNYLTTD-LXLEDVI-------LQTA-YENLYFMP---SGIL-PA-----DAAGILNS
A0A258AXR6      GLTNFLTTD-IRLEDVV-------LRTQ-VENLFFLP---SGLL-PA-----DSAGLLNS
A0A3D3NZQ6      GLTNFLTTN-VRMEDVV-------VRTA-VENLYFLP---SGLL-PA-----DSAGILNS
A0A1T4WVZ9      GLTNYLTTN-VTLEEVV-------VRTP-VENLYFLP---SGML-PA-----DSAGVLNS
A0A4R7SSI6      GLTNYLTTN-VQLEEVV-------VRTP-VENLYFLP---SGML-PA-----DSAGVLNS
                .                                                           

A0A4Q3AQI1      PRFTEIMQTLRERFDRIVMDTPPVLGLSDTSVMQSQVDGVLFVIWSAHTPIRTMKAAVEM
A0A4P6PD26      KRIGELISSLKSKYDVVLIDTPPLVGISDSSIIAKETDGAIIVVQYRKYPRDMLVKAKAM
A0A1Z8SVB5      KEFELLLAAXKKMADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGKVSRHVVKRLIGD
A0A2V5W3Y0      DSTDALLADLYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFVVWLSYTSARLVRKSLEL
A0A432FAS4      QRMKDFIEEIRSKYDKIMFDCPPVSAVSDPLMIAAATDGIIFVSKFNKVRREHARKTVQR
A0A660Q3A0      PELSAFLDYARRTYDRVMFDCPPVLAVSEAAILCTLVDGVIFVVWAGQTSRKLSQLAVQT
A0A2V5UAD5      PALSQVLAWARQHFDYVLIDSSPVFAADDTATLAPMVDGTLFVVRNRFSRPRPAREALEL
A0A258AXL1      SRFKEFLDALKHHFDRIIVDTPPLLGLADSLLISKAVDGLIFVIRADQTTQRDVATASEI
A0A2E6T1E0      QRMRDFVEEVRTKYQKIVFDCPPVSAVSDPLIIAAATDGIIFVNKFNKIRREHARKTVQR
A0A2D5W0Q9      KRMGELLDSLRDRYDRIFVDCPPVSAVSDPLMVGARTDGMVFVSKFNKIRREHARKTVQR
A0A1Z9KB52      KEFELLLTCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGD
A0A2V5U7A0      RKMKELVMDLRESYDFILLDTPPAIAVSDPAILSSVADGIILVFHARKTTVHSARQVKER
A0A257LYL4      RRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLMRVKQA
A0A4Q2XXY1      RRMSELIADVKNRFDLVLIDSPPILGVSDASVLASEVDLTMIVIQHRKLPRTMLMRVKQA
A0A3D4CZT6      RRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLVRVKQA
A0A4V1S9Q4      RRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLLRVKQA
A0A355VK99      PLLGQILSILKKQYDAVIIDAPPYGILADTAILASLSDITLYTVRSGKIDKRYLTQIQQL
A0A2V6N5E0      ESTEALLKEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALEL
A0A2V6NH44      DSTDQFLKEIYHQYDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSHTSARLTKKALES
A0A432FDF6      AKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQYRKYPQLMTQRAKDM
A0A522ACN3      NQMKDLISGLKQRYDYVFLDSPPIMGVSDASILASEVDITLQVIQYRRYPQPMNIRAKQL
A0A353DCA1      RRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLLRVKQA
A0A3C1AXQ2      QRMSELIADAKSRFDLVLIDSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLMRVKQT
A0A3D0IZR7      SRLATLMEACRPNYDVILVDSPPVLGISDASVISQEVDVSLLLIQHRRYPRNVSQRAKRV
A0A520LRZ3      RRMSELIADVKSRFDLVLVDSPPILGVSDASVLASEVDLTIIVIQHRKLPRGMLIRVKQA
A0A356FSV4      AKYSSLLGSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRR
A0A3D3DET9      EATQRFLRDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLES
A0A355SVK9      AKFEAMLADLRERYDRIVIDSPPLGAVSDALNLLPLVDGVIYVVKFNTVKRKTAMVNARR
A0A2E5D7I3      EAISKLFAWAREHYDHIVIDSAPILPVPDTRIIFPLVDNPCLVIRANVVPKPAVFRALDV
A0A2V5NYE2      EVTERFLRDAAAKYDYVMIDTAPVMAADDVTSLAPHLDGVLFVIRAERTSARVGRAALEL
A0A2V6FIP7      KRMRQFLEEVRNRYDRVILDCPPVSAVSDPLIIASLSDGVAFVTKFNKIRRDHASRTIQR
A0A353DI77      GRLRDLVEMFSSNFDHIVIDSAPLLPVPDTRILAPLVDNLALVIRAEHTPVKSIQRAFDM
A0A1V6GCZ3      TQMKDLIGELKQRYDFVFFDSPPIMGVSDASILASEVDMTIQVIQYRRYPQPMNIRAKQL
A0A3C1UJT2      SAIEELILKARQNFDRIVIDSAPLGPIGDTLSVARLADMLCLVVRSGKTTSKVVLRIIDY
A0A2S7U0Z3      GEFNSLLEDLIPEFDRIILDSAPVLPVADSRLLAKHAHAVILVVRTRKTPIGAMIRACDL
A0A5E6MKA7      AAMAYLCQWARSHFGYVLLDCPPLTGMPDAAVVGTLADGAVLVIRDGYVDRSEARRVVET
A0A2N8IR72      PLLGHILGILKKQYDAVIIDAPPYGILADTAILASLSDITLYAVRSGKIDKRYLLQIQQL
A0A2N8IV96      RKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQV
R7E1V8          RKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQV
A0A1T4WWY4      GVFAAILEELKKKYDRIILDTPPVLGLSETAFLQHHADGVAIVVRCGKTLRKDVEDAVQS
A0A3D3LEQ6      EVFSQLLDTLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQ
A0A3D3NW23      EVFSQLLDSLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQ
A0A2E0R252      KGLKGAIGALEEYFDRIIIDSAPLVPVSDSLPLAKLAESVVLVCRVGKTPRGAIKRAIRV
A0A3E1EF48      RHLGTFLADLCRDFDRVVIDTAPLVPVSDTLPIAKRAQSVIMVYRMGKTPRKALFRGLKT
A0A2A2PVG8      KSLRPLLEKLSEYFDRIVIDSAPLVPVSDSIPIAKLVQSVVLVVRMGSTPKGAIKRAIRV
A0A2E0R421      KALPALVDKLGKYFDRIIIDSAPIVSVSDTYPLAKIAQSVVLVCRMSMTSRSSIMRALRI
A0A2E5EJ69      DHVKKLIDDVVGKYDQVVIDNAPVTAVSDTLLILEYVQTICMVTRAAKTSYRLIGRALEL
A0A2G4I5Z5      QWTAKLIQEASAKFDHVVLDNAPINAVSDALLIVKEAQTVCLVANAGKTSYRVVLRALEM
A0A4P5QQV6      TDTDRFLRAADAQYDYVIMDSAPVTAADDTSSLAPKVHATLFVFRFATSSMRISQKALDT
A0A2E7ALI1      GMIEKLFDWAREHYDHVVIDTAPVLAVPDTRIIXPLVSNPXLVVRANVVPKPAVFRALEM
A0A178IDB9      IAHSELFNKLSKSYEVIIIDTPPAAVFPDALLLSRFCAELVYVCRFRTVRRKLIKKTLSK
A0A290QD69      LAHCDLFNKLSKIYDLVIIDTPPAAVFPDALLLSRFCTEMIYVCRFKTVRKAVIRKALEK
A0A2E7VDS1      PDFDILLSNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLCVIRYGKVSRKVVKNLLAK
A0A178IFJ2      EKLKGLFEQARREFDILVIDTPPAGIFPDAFDLVPFASELVYVVRFNHVSRPQVHRVTER
A0A357FSP9      AKFEAMLADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRR
A0A538NJ59      PALSQVLAWARQQFDYVLIDSSPVFAADDTATLAPMVDGTLFVVRNRFSRPRPAREALEL
A0A3C1VFY9      PVMGKFLQETIKEYDYVLIDTAPVMAADDVTSLAPRVDGVIFVVRAEFTSARVVRASLDM
A0A522AC27      QDTKDFLKAAAAEYDCVVVDTAPVMAADDVTSLAPLIDGTIFVIRAGETSGRVARAALEL
A0A2A2R174      QWTSKLIKEASAKFDHVVLDNAPINAVSDALMIVKEAQTVCLVANARKTSYRAVLRALEM
A0A1H2DTI1      PITDGILREMYNEFDYIIFDTSPVMAADDATSLAPKIDGTIFVLRASMTSARAARNALDQ
A0A1V5L462      ERMDAILEACRKQYDFVILDTAPILAVDDTIGLLRRADDVIFVVKSGQTNFRQVKISLER
A0A2A2R3V9      SLVPSIFQEMRDEYDYVVVDSAPILATDDTASLAPKLDGTIFLMRTSYTSARLSRNAMDL
A0A3D3LGD3      QRMSDLIEDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQT
A0A350ARX4      ERMDNLLEWARERYTYVIVDAPPILAVNDTIGLSNKTDSMMFVVRASQTSTRQVQSSLER
B5JIS2          TKIDALLRKLEETFEVIIVDTPPVGLYPDALIFAKSVGETLLVARESKAPISQIRQVIGD
A0A1H2GQN6      QVLREIIVELKEKYQVIFIDSPPALGVSDASVIAHEVDKVVMVIQHRRYPREISIRTKKA
A0A512M3Y3      ARFVNTINDLRKQYDRIIIDTPPLLGLADSIMVSKCVDGAIFVIRAEQTTQRDIATAMEV
A0A4P5R5J1      KVTDQLLQEVYAEFDYIIFDSPPVMAADDVLSLSPKIDGTIFVVRFSTSSARRSRTAINL
A0A4P5YK43      EVAHKVISEARQFYDHVIIDCPPITAIDDTFCLIPITDGLLFVVKSGQTSMRFAKSALGA
A0A2A2RPW6      PWAKQLIEEASKRYDKVVLDNAPVNAVSDTLLICKEAQTICLVMHSRRTPVRVVSRALEM
B4D1I7          RSADEFLKTVHAEFDYVVLDSSPVMAADDTTSLAPKADAAVFVFRFTSSSTRASRKALEL
A0A353F286      RRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQA
A0A354FSA6      RRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQA
A0A3B9GA54      RRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQA
A0A520LEH8      RRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQA
A0A2D7B7R6      SAIEELILKARQNFDRIVIDSAPLGPIGDTLSVARLADMLCLVVRSGKTTSKVVLRIIDY
B1ZT68          FVTSGMLKRLLERYDLVILDTPPVAVFPDALLLSRYCKELIFVCKYGSVRLNSVRKTLAR
W0J7C2          LSRRETLQPLLDNYDLILFDTPPAAVFPDALMLARCCHEMIYVCRYRTVRPAIIRKVIDR
A0A2E5K4P7      EYFPFLMNEIRQYYDKIIIDSPPLAAVSDALNIVPFVDGILFVVKYNTVKRNTASLTVRK
A0A0R2XPB1      KYMDQFIRDARAQYDFVIFDTAPILATDDTCGFAAKMDAVLFTIRCAHTQVRQIKPAMAR
A0A348NQP1      EYMDQFISEARERYDFVIFDTAPILATDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMAR
A0A357FV58      EYMDQFISEARERYDFVIFDTAPILATDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMAR
A0A2V6F9Q9      DSTDQFLKEIYHQYDYIIIDSSPVLAADDTTSLAPKVDATLLVVRLSHTSARLTKKALEL
A0A2V6NZZ3      DSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALEL
A0A2V6EBU2      DSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALEL
A0A2V6EY06      DSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALEL
A0A2V6ME53      DSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALEL
A0A538NUU0      DSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALEL
A0A2V6NIJ1      DSTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALEL
A0A2V6C292      ESTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKAFEL
A0A2V6D2X0      ESTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKAFEL
A0A2V5ZUK1      ETTDVLLREIYQHYDYVIIDSSPVLAADDTTSLAPKIDATLFVVRLAYTSARLTKKALEL
A0A2V5XFN9      ESTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALEL
A0A2V6EZC8      ASTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALEL
A0A2V6I7Z5      ESTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALEL
A0A3B9LCP2      DSTDAILKEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFVVRLSHTSARLARKGLEL
A0A3C0R669      DSTDAILKEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFVVRLSHTSARLARKGLEL
A0A2V6EID2      DSTDVLLKEMYKHYEYILIDSSPVLAADDTASLAPKIDATLFVVRLSYTSARLIRKGLEL
A0A2V6MHB0      DSTDVLLKEMYKHYEYILIDSSPVLAADDTASLAPKIDATLFVVRLSYTSARLIRKGLEL
A0A2W5YWL9      DSTDQMLKDMYQQYDYILIDSSPVLAADDTTSLAPKIDATLFVVRLGYTSARLTRKALEL
A0A2V5NH62      DSTDALLRDMYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFVVRLSYTSARLTRKSLEL
A0A2W6A620      ESTDQLLKEMYNHYDYILIDSSPVLAADDSTSLAPKIDATLFVVRLSYTSARLTRKSLEL
A0A2V5PIJ4      ESTDALLREINTFFDYIIIDSAPVLAADDATSLAPKIDATLFVVRLSHTSARLTRKSLEL
A0A2V6K2G8      ESTEALLKEIYQDYDYVIIDSSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALEL
A0A2V5W206      ESTEALLKEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALEL
A0A2V6MW77      DSTEALLKELYQHYDYVIIDSSPVLAADDTTSIAPKIDATIFVVRLSYTSARLTKKALEL
A0A2G4GZN8      PKFLAMIEELRGRYDRIFIDSPPIGAVSDALHILPKTDGVIYVVRYNVVNARNAVSCISR
A0A348NPT1      AKFEAMLADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRR
A0A2E1KV60      EKYQSMMLELRDRYDKIIVDSPPLAAVSDALNVVPYIDAVLFVIKYDSVKKSLVNSCVRR
A0A2D7F4D9      SKFESMLLQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRR
A0A3R7RBR8      SKFESMLLQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRR
A0A2E0NH28      AKYSSLLGSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRR
A0A350AS32      AKFEAMFADLRDRYDRIVVDSPPLAAVSDALNLLPLADGVLYVIKFNTVKRKTAVVNVRR
A0A368BGT4      AQFEEMLAVLRDRYDRIVIDSPPLAAVSDALNLLPLVDGVIYIIKFNTVKRKTAVLNVRR
A0A2E0V4K6      GAIRELLQWAREHYDHVVIDTAPVLAVPDTRIILPQADNRCLVIRANVVPKPAVFRAIDL
A0A2E6NAH3      AQFEAMFSDLRNRYDRIVVDSPPLAAVSDALNLLPMVDGILYVIKFNTVKRKTAVINVRR
A0A2A5VZA5      AQFEAMLADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRR
A0A424R295      AQFEAMLADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRR
B4CZV9          AQFSELLNSLRGRFDRIVIDTPPVLGLSETSIMQSLVDGVLFVIWTGQTPVRCVKSAIET
A0A290QE54      PAFGQLLARLKKHFDLIIVDSPPMGAVTDSLLIAERTDEVVYVCRFNKAYRKHIKLYIRA
A0A1H1SWX2      AVFGQFIEAMKQHFDLIVVDSPPMGAVTDSLLIAERTDEVIYVCRFNRAYRKHIRLYIKQ
A0A4Q1C9I5      PIFGQFIEAMKQHFDLIVVDSPPMGAVTDSLLISERTDEVIYVCRFNRAYRKHIRLYIKQ
A0A3B9FM17      NDFSTVIDLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIES
A0A1G3ZL71      PEFGELILQLKKRFDLIVIDSPPLGAVTDSLLIAEQTDEVIYVCRFNRALRKHIKVFVRT
A0A556QP09      PIFGQLLEKLKKHYDLIVVDSPPLGAVTDSLLIAERVDEVIYVCRFNRAFRKHIRLYIKA
A0A2T6DX88      PRFGQLIAKLKNQYDLVVVDSPPMGAVTDAMLVAERTDEVVYVCRFNHAARKHIRLYIRA
A0A2T6CWI7      PVFGQLLERLKKEFDLVIVDSPPLGAVTDSVLIAERVDEIVYVCRFNRAYRKHIRLYMRT
A0A3E1E5C8      PAFGQLLEKLKKDYDLVVVDSPPLGAVTDSLLIAERTDEVIYVCRFNCAAKKHVRLYMKT
B1ZZ74          PVFGQLLERLKREYDLVIIDSPPLGAVTDSMLIAERTDEIIYVCRFNRAYRKHIRLYMKA
R7E4L8          GRLEELLRYWRARYDRIILDGCPYEAVADASLMARHADLVLYVIRCGMIEKQYVPVIQGL
A0A4Q3BVY2      DVFSNMLEHFRKTYDRIVIDAPPVLGLSESSSLQKVVDGTVLVVRAEVTGRKDVLDALAL
A0A4P6PCA7      KELAELIKWARDEYDRVIIDTPPIGPVGDGVILASYVDSVIVVSRVGKTKMRGLKTMLSR
A0A0E3YV65      AAFRDLLDFLHKQYDAVIIDTPPAGVFSDAMVLAEQAGELVFVVRYNYTSRPGVRRLIET
W0J900          KKLKALIEQAQREFDILLIDTPPAGIFPDALSLAPFANELIYVVRFNYVSRPQVHRVTER
A0A2T6DSN5      IASCDLFNKLSKHYDIIVIDTPPSAVFPDALLLSRFCSEMVYVCRFKTVRKALIKKTLHK
A0A2V2SMX4      QAAADFLKNAAMQYDYVIMDTAPVMAADDVASLAPNMDSTIFLVRAEHTSARVARAALDI
A0A317ZIW7      DSMEQFIKHAREHYDFIVFDTAPILATDDTTSFAPFVDAVLFTVRCSYTHLRQIKPAIAR
A0A2D7WMI4      KEFGILLDKLKAESDVIVVDSPPIGLFPDALAFSKIADDIIFVTRYGKVARRVAKNLLYS
A0A2D6VHX5      KEFELLLTCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGD
A0A2D8I214      KEFDIVHNELKEMFDVIIVDSPPIGLFPDSLAIARKVDDVLFVTRYGKVSRKIAKNLVEN
A0A1Z8VL41      AEFEMVTNHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIEN
A0A2E6TNA4      TEFEMVTNHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIEN
A0A1Z8RG47      AEFDLVMNKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLEN
A0A1Z8RJJ5      TEFDLVMNKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLEN
A0A2D7V631      SEFDYVMNKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLEN
A0A354RA24      SEFDYVMNKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLEN
A0A2E9RV62      PEFDKMLFSLRQNAEIIIIDSPPIGLFPDSLAMARKVDEVIFVTRYGKVARKVAKNLIES
A0A2E4AY96      NQFHELLGKLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSN
A0A3B9B9P4      NQFHELLGKLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSN
A0A2D5Y6N6      NSFDRIHKILRTIADVIIIDSPPIGLFPDSLAMARKVEEVLFVTRYGKVSRKIAKSLLEN
A0A2E7HSS8      NDFSVVIDSLKRHAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVVKSLIAS
A0A2D8VCK3      NDFSTVIDLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIES
A0A350QVY4      NDFSTVIDLLRTNAEVVIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIES
A0A2E4ZYR7      PDFDILLNNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLMR
A0A2E6TCV1      PDFDHLLNNLKKLCDILIIDSPPLALFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLTR
A0A3D4HHL8      VYFATMLEGLRKRYDFIVFDLPPVLATDDTPGFVQKVDGVLFVVRSNTTRVKQAKSAFHI
A0A366HV03      LSLEENVAIWRQQYDWIILDTPPVLGLSETTNLQRVADAVVLVVKAEKTHGRDVTEAVEQ
A0A5R8KAF2      KGFVDLVERFRGEYDQIVIDTPPVLGLSETAALRIVVDGVIMVVRAEKTTRRDVSDAVAL
A0A2V2SDN0      SQFSSLLSDVYSRFDYIIIDSPPVLAADDAATLAPKVDGVLFVVRGSHTSARMVREGLDT
A0A1V6GL40      EATQRFLRDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLES
A0A2V5X6Z6      PVWLSFLAEAKSQFDYVLVDTPPVLAADDAATLAPKVDGVLFVVRGSFTSARMARGALDA
A0A2V5VGZ7      QVWPGFLAEAKPQFDYILVDTPPVLATDDAGSLAPKVDGVLFVVRGSFTSARMARGALDA
A0A2V5U130      QVWPGFLAEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDA
A0A2V6C237      PVWPGFLAEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDA
A0A3R8L982      AAFTQLLTKLKKHYDLVIVDSPPLGAVSDSLLIAERTDEVLYVCRFNRALRKHIKLYIKA
A0A2E7HPU9      EGVVAVLKELKQEFDVIVIDSAPLLAVPDTRLLVPEVDNFCLVVRAEHTPKGAVAKCLDM
A0A388PR45      PRFGEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKVDGVVYVVRFNVVSARNAAACLAR
A0A388QR61      PKFAEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKADGVVYVVRFNVVSARNAAACIGR
A0A4P5YHI0      PKFAEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKADGVVYVVRFNVVSARNAAACIGR
A0A2A2RS01      PKFLAMLDEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGR
A0A2A2Y1A7      PKFLAMLDEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGR
A0A388PDH9      PKFLAMLDEMKTRYDRVFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGACLAR
A0A2G4H1E7      PKFLAMIDGFRERYDRIFIDSPPLGAVSDSLHLLPKVDGVIYIVRYNAVNLRHATSCLAR
A0A2G4GZA6      PKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKVDGVLYVVRYNTVNLRNATSCLAR
A0A388P514      PKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLAR
A0A2A2YG59      PKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLAR
A0A2G4F7D5      PKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLAR
D5EML0          LRVSALFSKLKDLYDIVVFDTPPIGLFSDATIVADSADSCVMVARQFAVKRTKFQHSVNQ
A0A3C1C1M3      AKVAALLAWARAHFDRIVLDVPPLGIVSDALSLAHLSDCVLVMARPATSRKRAVRHTIQR
A0A2E9EYJ1      RRMSELIAXVKSRFDLVFIDSPPILGVSDASVISSXVDLTIIVIQHRKLPRGMLXRVKQA
A0A258AXR6      QRMVDLIAEVKSRFDLVLIDSPPILGVSDASVLANLADMTMIVVQHRKLPRHMLMRVKQG
A0A3D3NZQ6      QRMSDLIEDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQT
A0A1T4WVZ9      QRMTELIEDAKSRFDIVLIDAPPILGVSDASVLANEADLTIIVVQHRKLPRHMLLRVKQT
A0A4R7SSI6      QRMSELIADAKSRFDLVLIDSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLLRVKQT
                                :..*  *     :   .           .               

A0A4Q3AQI1      LQTNGANFYGFVLNRL-----------DLNATTN--------------------------
A0A4P6PD26      IETLGVNVVGAVLNNI-----------NVMRDDY--------------------------
A0A1Z8SVB5      LKITGANILGVILNDL-----------PSKKATG--------------------------
A0A2V5W3Y0      LYNRQVNVPGIILNYV-----------DTSLPEY--------------------------
A0A432FAS4      IQDAGIYIAGICINDL-----------DFEGKDS--------------------------
A0A660Q3A0      LRERGANILGCVLNNL-----------DFSRIGY--------------------------
A0A2V5UAD5      LFQRQAKVLGLVFNRA-----------DASARSH--------------------------
A0A258AXL1      LHQSGAQVYGFVLNCV-----------NLRRLEN--------------------------
A0A2E6T1E0      IQDAGINIVGVCINDL-----------DFEGKDS--------------------------
A0A2D5W0Q9      IQDAGIYILGTVINDI-----------DFEGKDS--------------------------
A0A1Z9KB52      LKATGANILGVILNDL-----------PSKKATG--------------------------
A0A2V5U7A0      FDAVRGPILGVILNGI-----------NVEDPD---------------------------
A0A257LYL4      VENVGGHVIGVVLNNV-----------DVRSDSQ--------------------------
A0A4Q2XXY1      IENVGGNLLGVVLNNV-----------DVRSDSQ--------------------------
A0A3D4CZT6      VENVGGHVIGVVLNNV-----------DVRSDSQ--------------------------
A0A4V1S9Q4      VENVGGNVIGVVLNNV-----------DVRSDSQ--------------------------
A0A355VK99      ADQGKLPNMAYIINGV-----------NFKSASY--------------------------
A0A2V6N5E0      LYGRQVNIPGVILNFV-----------DTSLPEY--------------------------
A0A2V6NH44      LYSRQVNVPGIILNYV-----------DTSLPEY--------------------------
A0A432FDF6      VTKVGGELVGVVLNNI-----------NISQDSY--------------------------
A0A522ACN3      IEKVGGNLVGIVLNNI-----------NMSQDES--------------------------
A0A353DCA1      VENVGGQVIGVVLNNV-----------DVRSDSQ--------------------------
A0A3C1AXQ2      VENVGGTVLGVVLNNV-----------DLRSDSQ--------------------------
A0A3D0IZR7      IEDVGGKLFGVILNNV-----------NIKTDDN--------------------------
A0A520LRZ3      IENVGGKALGVVLNNV-----------DVRSDNQ--------------------------
A0A356FSV4      LWESNTPVFGSVLNNV------------STALSS--------------------------
A0A3D3DET9      LYQRQVRLLGLVFNAV-----------RPSSED---------------------------
A0A355SVK9      MAESNTPVFGAILNNI------------SSTLSS--------------------------
A0A2E5D7I3      MEEDGSRIVGVVLNGY-----------RETRRLX--------------------------
A0A2V5NYE2      LYHRQVSVLGLVFNGV-----------RPSSVDY--------------------------
A0A2V6FIP7      IQDAGIHILGVVLNDI-----------DFEGKDS--------------------------
A0A353DI77      LEDDGVFSSGVILNDF----------TENRLQGG--------------------------
A0A1V6GCZ3      IEKVGGNLVGIVLNNI----------NMSQDESY--------------------------
A0A3C1UJT2      LHRHGHTPSGIVLNFL-----------RNNNNKG--------------------------
A0A2S7U0Z3      LKASGAKLGGVVVNGM-------------KRTGG--------------------------
A0A5E6MKA7      LLGVNTRILGAVLNRV------------QTSARS--------------------------
A0A2N8IR72      ADQGKLPNMAYIINGV------------NFKSAS--------------------------
A0A2N8IV96      IESVGGNLAGVVMNNV-----------DITSDHQ--------------------------
R7E1V8          IESVGGNLAGVVMNNV-----------DITSDHQ--------------------------
A0A1T4WWY4      LQKLGAHFYGFILNGV----------DFSKRVNH--------------------------
A0A3D3LEQ6      LEKLGGHFFGFVLNRV----------DFSKRSNH--------------------------
A0A3D3NW23      LEKLGGHFFGFVLNRV----------DFSKRSNH--------------------------
A0A2E0R252      LEANHSAPVGVVANGL-----------PRTRTKG--------------------------
A0A3E1EF48      LRSNHAEPVGIVANLL-----------PRVAGRG--------------------------
A0A2A2PVG8      LSDNGSHPVGIVANGL-----------PQTRTAG--------------------------
A0A2E0R421      LKVNQSDPVGIVANGL-----------PVAKTKT--------------------------
A0A2E5EJ69      VRRSGKNVSGLVLNFV-----------PEKRRAG--------------------------
A0A2G4I5Z5      LRRAGAKPSGVVLNFL-----------PQSAGSG--------------------------
A0A4P5QQV6      LRERQVNVLGLVCNDV------------DESLQD--------------------------
A0A2E7ALI1      LEEDGSRVVGIILNGY----------RESRRLXGXXYSYGS-------------------
A0A178IDB9      FTESGISILGVVLNRM-----------PHASIMN--------------------------
A0A290QD69      FQESGITILGVVLNCM-----------PHASVMN--------------------------
A0A2E7VDS1      VDETGANVLGVVLNDL-----------PEKKTPG--------------------------
A0A178IFJ2      FRSTGLEMPGIVLNMM-----------PSGRGSA--------------------------
A0A357FSP9      LWESNTPIFGAILNNI------------SSTLAS--------------------------
A0A538NJ59      LFQRQAKVLGLVFNRA-----------DASARSH--------------------------
A0A3C1VFY9      LYQRKARVLGLVFNAV-----------RMSVGGY--------------------------
A0A522AC27      LYQRNVPVLGLVFNAV-----------QTGSGDY--------------------------
A0A2A2R174      LRRAGAKPSGVVLNFL-----------PQSAGSG--------------------------
A0A1H2DTI1      LYHRQVNVLGLVLNSV------------NALLPD--------------------------
A0A1V5L462      LSVTKTKVWGFVMNYV------------KAGGND--------------------------
A0A2A2R3V9      LYQRQVNILGLVMNFV------------DTNLPE--------------------------
A0A3D3LGD3      VENVGGTVLGVVLNNV-----------DLRADSQ--------------------------
A0A350ARX4      LSSRTSKIMGLVFNCA-----------PATGVDY--------------------------
B5JIS2          IDSTGAPVLGLVLNDY-----------------S--------------------------
A0A1H2GQN6      IEEVQGNLVGVALNSV-----------ATNSDEG--------------------------
A0A512M3Y3      LVGTRTPIYGFVLNGV-----------DLSRMEN--------------------------
A0A4P5R5J1      LVQRQANLLGIVCNDV------------RLAESE--------------------------
A0A4P5YK43      LRHRGAEILGVVLNGI------------TSDNPH--------------------------
A0A2A2RPW6      LRRAGGKPSGVVLNFL-----------PGSAGAG--------------------------
B4D1I7          LRERQTNVIGIVCNDV------------SEAMQD--------------------------
A0A353F286      VENVGGQVIGVVLNNV-----------DVRSDSQ--------------------------
A0A354FSA6      VENVGGQVIGVVLNNV-----------DVRSDSQ--------------------------
A0A3B9GA54      VENVGGQVIGVVLNNV-----------DVRSDSQ--------------------------
A0A520LEH8      VENVGGQVIGVVLNNV-----------DVRSDSQ--------------------------
A0A2D7B7R6      LHRHGHTPSGIVLNFL-----------RNNNNKG--------------------------
B1ZT68          VHETGIKVLGLVINQM-----------PESRFRA--------------------------
W0J7C2          FHGTGISLLGVVLNRL-----------PQSKARS--------------------------
A0A2E5K4P7      LAEAGKPIFGVILNNM------------ASKSAE--------------------------
A0A0R2XPB1      LRERKIDISGLILNYV------------DTTQPG--------------------------
A0A348NQP1      LRERNIEISGLILNFV------------DTTQPG--------------------------
A0A357FV58      LRERNIEISGLILNFV------------DTTQPG--------------------------
A0A2V6F9Q9      LYSRQVNVPGIILNFV------------DTSLPE--------------------------
A0A2V6NZZ3      LYNRQVGVPGVILNCV------------DTSLPE--------------------------
A0A2V6EBU2      LYNRQVGVPGVILNCV------------DTSLPE--------------------------
A0A2V6EY06      LYNRQVGVPGVILNCV------------DTSLPE--------------------------
A0A2V6ME53      LYNRQVNVPGVILNFV------------DTSLPE--------------------------
A0A538NUU0      LYNRQVNVPGVILNFV------------DTSLPE--------------------------
A0A2V6NIJ1      LYSRQVNVPGIILNYV------------DTSLPE--------------------------
A0A2V6C292      LYSRQVNVPGVILNFV------------DTSLPE--------------------------
A0A2V6D2X0      LYSRQVNVPGVILNFV------------DTSLPE--------------------------
A0A2V5ZUK1      LYSRQVNVPGVILNFV------------DTSLPE--------------------------
A0A2V5XFN9      LYGRQVNVPGVILNFV------------DTSLPE--------------------------
A0A2V6EZC8      LYGRQVNVPGVILNFV------------DTSLPE--------------------------
A0A2V6I7Z5      LYGRQVNVPGVILNFV------------DTSLPE--------------------------
A0A3B9LCP2      LYDRQVNVPGIILNFV------------DTSLPE--------------------------
A0A3C0R669      LYDRQVNVPGIILNFV------------DTSLPE--------------------------
A0A2V6EID2      LYGRQVNVPGIILNFV------------DTSLPE--------------------------
A0A2V6MHB0      LYGRQVNVPGIILNFV------------DTSLPE--------------------------
A0A2W5YWL9      LYSRQVNVAGVILNYV------------DTSLPE--------------------------
A0A2V5NH62      LYNRQVNVPGVILNYV------------DTSLPE--------------------------
A0A2W6A620      LYNRQVNVPGVILNYV------------DTSLPE--------------------------
A0A2V5PIJ4      LYNRQVNVPGVILNQV------------DTSLSE--------------------------
A0A2V6K2G8      LYNRQVNVPGVILNFV------------DTSLPE--------------------------
A0A2V5W206      LYGRQVNIPGVILNFV------------DTSLPE--------------------------
A0A2V6MW77      LYGRQVNIPGVILNFV------------DTSLPE--------------------------
A0A2G4GZN8      LRDAHAPILGVVLNSM------------SIRMAS--------------------------
A0A348NPT1      LWESNTPIFGAILNNI------------SSTLAS--------------------------
A0A2E1KV60      LWESKKPVLGAILNNV------------SSGLSS--------------------------
A0A2D7F4D9      LWESKTPLLGAVLNNV------------SLGLSH--------------------------
A0A3R7RBR8      LWESKTPLLGAVLNNV------------SLGLSH--------------------------
A0A2E0NH28      LWESNTPVFGSVLNNV------------STALSS--------------------------
A0A350AS32      LWESNTPVFGAILNNI------------TSTLSS--------------------------
A0A368BGT4      LWESNTPVFGAILNNI------------TSSLSS--------------------------
A0A2E0V4K6      LEEDGVKLAGVVMNGY----------RESRRLLGYNYSYGA-------------------
A0A2E6NAH3      LWESNTPVYGAILNNI------------TSVLSS--------------------------
A0A2A5VZA5      LWESNTPVFGAILNNI------------TTSLSS--------------------------
A0A424R295      LWESNTPVFGAILNNI------------TTSLSS--------------------------
B4CZV9          LRANRANFYGFVLNRL-----------DLNATQN--------------------------
A0A290QE54      LHNGKNDILGIVLNGL-----------STRRIEY--------------------------
A0A1H1SWX2      LKESKNELLGIVLNGL-----------SPRRIEY--------------------------
A0A4Q1C9I5      LRESKNELLGVVLNGL-----------SPRRIEY--------------------------
A0A3B9FM17      INDTGANLLGVVLNDL-----------PQKKTPG--------------------------
A0A1G3ZL71      LREGKNAFLGIVLNGL-----------TARRIAY--------------------------
A0A556QP09      LRSGKNEILGVVLNGL-----------SPRRIEY--------------------------
A0A2T6DX88      LQSGKNEILGIVMNGM-----------STRRIEY--------------------------
A0A2T6CWI7      LRQGKNEVLGIVLNGL-----------SPRRIEY--------------------------
A0A3E1E5C8      LRNGKNEVLGVVLNGL-----------SPRRIEY--------------------------
B1ZZ74          LRDAKNEVLGVVLNGL-----------SPRRIEY--------------------------
R7E4L8          ADKGEFRSGAVILNAE--------------------------------------------
A0A4Q3BVY2      LRRSQAHFFGFVLNAV-----------DLSKLGN--------------------------
A0A4P6PCA7      LLEVDALVLGCIANDV-----------P--------------------------------
A0A0E3YV65      FKRSQIDLAGIVLNRM-----------PAGTHSD--------------------------
W0J900          LRSTGLELPGIVLNMM-----------PSGRGSS--------------------------
A0A2T6DSN5      FAESGIHVLGVVLNCV-----------PSSSVRN--------------------------
A0A2V2SMX4      LYQRRVKVMGLVFNAV------------RPTTAD--------------------------
A0A317ZIW7      LKERSTNVDGIILNYV------------DTAQPG--------------------------
A0A2D7WMI4      IEESGTNILGVVLNDL-----------PQKRSTG--------------------------
A0A2D6VHX5      LKATGANILGVILNDL-----------PSKKATG--------------------------
A0A2D8I214      LEETGVNVLGVVLNDL-----------PQKKAPG--------------------------
A0A1Z8VL41      IEETGANILGVVLNDL-----------PQKKTPG--------------------------
A0A2E6TNA4      IEETGANILGVVLNDL-----------PQKKTPG--------------------------
A0A1Z8RG47      IEETGANVLGVVLNDL-----------PQKKTPG--------------------------
A0A1Z8RJJ5      IEETGANVLGVVLNDL-----------PQKKTPG--------------------------
A0A2D7V631      IEETGANVLGVVLNDL-----------PQKKTPG--------------------------
A0A354RA24      IEETGANVLGVVLNDL-----------PQKKTPG--------------------------
A0A2E9RV62      LEETGANMLGVVLNDL-----------PEKKTPG--------------------------
A0A2E4AY96      LEESGSNILGVVLNDL-----------PSKKSTG--------------------------
A0A3B9B9P4      LEESGSNILGVVLNDL-----------PSKKSTG--------------------------
A0A2D5Y6N6      LDETGAKILGVVLNDL-----------PQKKAPG--------------------------
A0A2E7HSS8      IKETGANLLGVVLNDL-----------PQKKTPG--------------------------
A0A2D8VCK3      INDTGANLLGVVLNDL-----------PQKKTPG--------------------------
A0A350QVY4      INDTGANLLGVVLNDL-----------PQKKTPG--------------------------
A0A2E4ZYR7      MDETGANTLGVVLNDL-----------PEKKTPG--------------------------
A0A2E6TCV1      VDETGANILGVVLNDL-----------PEKKTPG--------------------------
A0A3D4HHL8      LMFRRAKILGIVLNAF-----------DVRGPG---------------------------
A0A366HV03      LMRAGAPMAGFVLNNI-----------DMSKVSN--------------------------
A0A5R8KAF2      LRKTDAHFFGMVLNDL-----------DLNKAKN--------------------------
A0A2V2SDN0      LRQRRARVLGVIFNRA--------------VSSS--------------------------
A0A1V6GL40      LYQRQVRLLGLVFN-A--------------VRPS--------------------------
A0A2V5X6Z6      LRQRRVHVLGLIFNRA--------------ASSP--------------------------
A0A2V5VGZ7      LRQRHVRVLGLIFNRT--------------VSSP--------------------------
A0A2V5U130      LRQRHVHVLGLIFNRA--------------ASSP--------------------------
A0A2V6C237      LRQRHVRVLGLIFNRT--------------VSSP--------------------------
A0A3R8L982      LRAGKNEILGVVLNGL-----------TARRIEY--------------------------
A0A2E7HPU9      LRDDDNEPAGIVVNDY-----------QERGGFARKYLYKYGGYGGYGGYGGYGGYGGYG
A0A388PR45      LRDAGAPMLCAVLNQM-----------SVRLASV--------------------------
A0A388QR61      LREAGVPMLCAVLNQM-----------SVRMASV--------------------------
A0A4P5YHI0      LREAGVPMLCAVLNQM-----------SVRMASV--------------------------
A0A2A2RS01      LAETGVPILGAVLNRM-----------SIRMASV--------------------------
A0A2A2Y1A7      LAETGVPILGAVLNRM-----------SIRMASV--------------------------
A0A388PDH9      LAETGVPILGAVLNRM-----------SIRMASV--------------------------
A0A2G4H1E7      LREAQAPLLGVILNAM-----------SLRMASA--------------------------
A0A2G4GZA6      LREAQAPLLGVVLNAM-----------SLRMASA--------------------------
A0A388P514      LREAQAPLLGVVLNAM-----------SLRMASA--------------------------
A0A2A2YG59      LREAQAPLLGVVLNAM-----------SLRMASA--------------------------
A0A2G4F7D5      LREAQAPLLGVVLNAM-----------SLRMASA--------------------------
D5EML0          MERSTAPVVGVVFNGIKDVNAAVGFGRNGVSHYG--------------------------
A0A3C1C1M3      FQAAGMANLAVVMNDV-----------E-HSKFT--------------------------
A0A2E9EYJ1      IQNVGGTAXGVVLNNV-----------DVRSDNX--------------------------
A0A258AXR6      VENVGGKVVGVVLNNV-----------DLRSDAQ--------------------------
A0A3D3NZQ6      VENVGGTVLGVVLNNV-----------DLRADSQ--------------------------
A0A1T4WVZ9      IENVGGTVLGVVLNNV-----------DLRSDSQ--------------------------
A0A4R7SSI6      VENVGGTVLGVVLNNV-----------DLRSDSQ--------------------------
                             *                                              

A0A4Q3AQI1      -----YYQY-----------YYYSNDY------YYHTQLENA------------------
A0A4P6PD26      -----YYYY-----------HSYYSDY------YHSSQSEVLDESGS-------------
A0A1Z8SVB5      -----YYYSGY--YGYGYYRYKYYSKY------YSPDXA---------------------
A0A2V5W3Y0      -----YYYQ--------------YSEY------YNTPLAVEEPDDVAAAHRHHQPRQIQS
A0A432FAS4      -----YYYSYY------YYQNRYYASH------YKSDKPGGKDEETNSKKPEKESSAA--
A0A660Q3A0      -----YYYSTY------Y---GYYDYD------YRY--------------PSGETGSA--
A0A2V5UAD5      -----YY-----------------------------------------------------
A0A258AXL1      -----NYYYGH------YYSRYYEPTY------YNNPKEGGEAA----------------
A0A2E6T1E0      -----YYYSYY------YYQNRYYASH------YKSDKSDSEHGKEEEFDSKKTKKKAV-
A0A2D5W0Q9      -----YYYSYY------YYQNRYYASY------YSNEKKLGSKKGEGAKDGELVQGGKAG
A0A1Z9KB52      -----YYYSGY--YGYGYYRYKYYSKY------YSPTEDT--------------------
A0A2V5U7A0      -----YAYYRH------------YYGSDYGTVAAAENGNGGEHADVEVLMAHDSFEKDPW
A0A257LYL4      -----YQYYTS------------YYTY------YAPAESQSAAQLGPVAPQGSAVAPAPR
A0A4Q2XXY1      -----YQYYTS------------YYTY------YSPTNIEK-ARPRPAASASTPATAGSR
A0A3D4CZT6      -----YQYYTS------------YYTY------YAPSADSDPVPTVGATASATSGSALES
A0A4V1S9Q4      -----YQYYTS------------YYTY------YAPAESQIGPPVAAATSSSPAKPQAQS
A0A355VK99      -----SYYGYG------------YGYQ------YGYGAKDPQQTARKRD-----------
A0A2V6N5E0      -------YYYQ------------YSEY------YSTPTSVPDGEAVAPVRRQRPKPIETT
A0A2V6NH44      -------YYYQ------------YSEY------YNRPVAPPESAAAV---QHRTGQAQSS
A0A432FDF6      -----YYYYSG------------YYYD------YYYKSREK--------EESADEAQDGK
A0A522ACN3      -----YYYYSG------------YYHD------YYSKNEDS--------MTEGEHKGDAK
A0A353DCA1      -----YQYYTS------------YYTY------YAPSSLEETGTPQQMTAAPASSKTEEK
A0A3C1AXQ2      -----YQYYTS------------YYTY------YSPDNM----------AAPADKKPERR
A0A3D0IZR7      -----YYYYAG------------YSTQ----YGYKKRAPRAAQRSKATATVAAVEIPAAT
A0A520LRZ3      -----YQYYTS------------YYTY------YSPSNIDPNQKISSDKPKAPQSEESKS
A0A356FSV4      -----Y-YYSH------------YSDKSYQDY-YINNEDDFEDQLVESTASGDEDTSEIA
A0A3D3DET9      -----Y-YYYR------------YKDY------YRPYPSGGTKAAESVRTEQT-------
A0A355SVK9      -----Y-YYYS------------YSDKSYSDY-YVHHDVESEQDLGKGALKPELQGKS--
A0A2E5D7I3      -----G-YNYS------------YGSYRYGKYGYSQYGYGGYGSYGSYGSDDXED-----
A0A2V5NYE2      -----Y-YYYK------------YKDY------YKAYPTSPSQSAATASPKREQAHRA--
A0A2V6FIP7      -----YYYNYY------YYQNRYYSSH------YNPRPDKPLKDKSEEVKKAG-------
A0A353DI77      -----KYGYGY------------GYGH------YGDDT----------------------
A0A1V6GCZ3      -----YYYSGY------------YHDY------YYRSEEQEPVVKEGAESGGKDKLDIKQ
A0A3C1UJT2      -----SYYYYYSSDKDKTYSKSGYQKK------QVTNSPMEVGASAEDEPVKS-------
A0A2S7U0Z3      -----SNYLGY--KGHGEYGGEEYGYY------GGDK-----------------------
A0A5E6MKA7      -----YYAYHY--------------AY------RLPEEQKREQSLKAPSQPS--------
A0A2N8IR72      -----YSYYGY--------GYGYQYGY------GTKEPQQTSRKQNK-------------
A0A2N8IV96      -----YQYYTT------------YYSY------YSADGASSGENADASSMKKVERSGKAK
R7E1V8          -----YQYYTT------------YYSY------YSADGGSSGENADASSMKKAERSGKAK
A0A1T4WWY4      -----YYYYYY------------SASY------YDANW----------DVKPAKKET---
A0A3D3LEQ6      -----YDYYYY------------SSNY------YDSNW-EEEKEEREADERPGRKKRRGS
A0A3D3NW23      -----YDYYYY------------SSNY------YDSNWEEEEKEDREADERPGRKKRRGS
A0A2E0R252      -----AYGYYY-----SYYGGGNYANY--------SDAK---------------------
A0A3E1EF48      -----AYGYYY-----GYHGGGAIDGY------VSNDSK---------------------
A0A2A2PVG8      -----AHGYYY-----SYSSGGSYSGY------SSNEK----------------------
A0A2E0R421      -----GHDYYY-----SYPGSGSYGSG------NNSDTEKIKTTRVRVPLFQNILNLGSK
A0A2E5EJ69      -----YNYYYY-----------TDKKY------YGYGEDKR-------------------
A0A2G4I5Z5      -----YYYYYS------------GNKY------YGQKGVYGASTPRS-------------
A0A4P5QQV6      -----YYYYRY-------------SEY------YGSQKKDAGKKQAARA-----------
A0A2E7ALI1      -----YRYGKYGYSQYGYGGYGSYGSY------GSDDDED--------------------
A0A178IDB9      -----YGYDGY-----GAYGSDYYKAY------QEEEAAAVK------------------
A0A290QD69      -----YGYDGY-----GAYKADYYKSY------QGEKAESK-------------------
A0A2E7VDS1      -----YYYAGY--YGYGYFRYKYYNKY------YGENEPQEHGKAKAG------------
A0A178IFJ2      -----AYYSGY-----GYYGSKHYSSY------YKEGQLAARSG----------------
A0A357FSP9      -----YYYSSY--------SDKAYQDY------YISQDVELEDELAGSVEPEMEPRA---
A0A538NJ59      -----YY-----------------------------------------------------
A0A3C1VFY9      -----YNYYRY-------------QDY------YSTHPGK--------------------
A0A522AC27      -----YYYYRY-------------KDY------YKPYPAKPA------------------
A0A2A2R174      -----YYYYYS------------GNKY------YGQKGVYGATSSKG-------------
A0A1H2DTI1      -----YYYYYR------------YYEY------YRPKDEVIEGAPGTPRRGKDGSKL---
A0A1V5L462      -----YYYYGR------------YKSY------RYQHKESGDSGNEEIRKKTGRLSPKEK
A0A2A2R3V9      -----YYYYQY-------------KEY------YNRGAKAS-------------------
A0A3D3LGD3      -----YQYYTN------------YYTY------YSPDNRPAAEGGKPKKRRKAAGETAPA
A0A350ARX4      -----YYNYRH------------YDSY------HQQPDAKQKRERS--------------
B5JIS2          -----FGSLNPRLAYGGKGKYKYHNNI------KKHAKGAGRVKSKSMVGKLMAEDVEDD
A0A1H2GQN6      -----YYYYGA------------YADY------YNNPKNRKKKKKGSSLQPRPAPPLPPG
A0A512M3Y3      -----YYYYSS-----------YYPKY------YDPSYVLQHADA---------------
A0A4P5R5J1      -----YGYGNY----------YQYSAY------RENADSEPLEPLPR-------------
A0A4P5YK43      -----YYYNNY------------YHAY------YGKQAQHAATAPTPIPAAVHRATPPNR
A0A2A2RPW6      -----YYYYYS------------GNKY------YGSKGVYGASSSKG-------------
B4D1I7          -----YYYYRY-------------PDY------YATAKSDQAGV----------------
A0A353F286      -----YQYYTS------------YYTY------YSPSNMEENQKPQAMTARKSSKSEPKG
A0A354FSA6      -----YQYYTS------------YYTY------YSPSNMEENQKPQAMTARKSSKSEPKG
A0A3B9GA54      -----YQYYTS------------YYTY------YSPSNMEENQKPQAMTARKSSKSEPKS
A0A520LEH8      -----YQYYTS------------YYTY------YSPSNMEENQKPQAMTARKSSKSEPKG
A0A2D7B7R6      -----SYYYYYSSDKDKTYSKSGYQKK------QVTNSPMEVGASAEDEPVKS-------
B1ZT68          -----SGYEGY-----GAYGQDYYQAY------AKTSAAQ--------------------
W0J7C2          -----YGYHGY-----GTQSAAYYKAY------EEQTPA---------------------
A0A2E5K4P7      -----YYYSEY--------YTGQYKKY------YTSQGAPEVSLGETSNSHPKPARKMNL
A0A0R2XPB1      -----YYYYKY-------------SEY------YTDPKNGVQSTSQQTTASS--------
A0A348NQP1      -----YYYYKY-------------SEY------YTDPKNSEQSLSQQTTA----------
A0A357FV58      -----YYYYKY-------------SEY------YTDPKNSEQSLSQQTTA----------
A0A2V6F9Q9      -----YYYYQY-------------SEY------YNRSVAVLESEATAQRQPTR-------
A0A2V6NZZ3      -----YYYYQY-------------SEY------YNRPVAPSESEA------IA-QRSSG-
A0A2V6EBU2      -----YYYYQY-------------SEY------YNRPVAPSESEA------IA-QRSSG-
A0A2V6EY06      -----YYYYQY-------------SEY------YNRPVAPSESEA------IA-QRSSG-
A0A2V6ME53      -----YYYYQY-------------SEY------YNRPIAPPESEA------TA-QHSSG-
A0A538NUU0      -----YYYYQY-------------SEY------YNRPIAPPESEA------TA-QHSSG-
A0A2V6NIJ1      -----YYYYQY-------------SEY------YNRPVASSESEA------TT-QHHPTS
A0A2V6C292      -----YYYYQY-------------SEY------YNRPVTSSASDA------IA-Q-HSSD
A0A2V6D2X0      -----YYYYQY-------------S-----------------------------------
A0A2V5ZUK1      -----YYYYQY-------------SEY------YSTPS-VPETDAQPVAPPVR-RQRPRP
A0A2V5XFN9      -----YYYYQY-------------SEY------YSTPA-APDGEA---VTSVG-REHPKP
A0A2V6EZC8      -----YYYYQY-------------SEY------YSTPA-APDGEA---VTPVG-REHPKP
A0A2V6I7Z5      -----YYYYQY-------------SEY------YSTPA-APDGEA---VTPVG-REHPKP
A0A3B9LCP2      -----YYYYQY-------------SEY------YNAPASAPEGET---VAAPH-REQAKP
A0A3C0R669      -----YYYYQY-------------SEY------YNAPASAPEGET---VAAPH-REQAKH
A0A2V6EID2      -----YYYYQY-------------AEY------YNPPASVTDDEA---LTAPP-PREPAK
A0A2V6MHB0      -----YYYYQY-------------AEY------YNPPASVTDDEA---LTAPP-PREPAK
A0A2W5YWL9      -----YYYYQY-------------SEY------YNTPAEPAE------------RPATHQ
A0A2V5NH62      -----YYYYQY-------------SEY------YNTPVPVEEHDD---VAAAHRHHQPRQ
A0A2W6A620      -----YYYYQY-------------SEY------YNTPVPVEEHDE---VAATTLHPQPKQ
A0A2V5PIJ4      -----YYYYQY-------------AEY------YNTPEPVDERAA---PAALH-HREPKQ
A0A2V6K2G8      -----YYYYQY-------------SEY------YSTPT-VPDAET---VTPVR-RERPKP
A0A2V5W206      -----YYYYQY-------------SEY------YSTPTSVPDGEA---VAPVR-RQRPKP
A0A2V6MW77      -----YYYYQY-------------SEY------YSTPTSVPDGEA---VAPVR-RQRSKP
A0A2G4GZN8      -----AYTDTY-------DS--SYRKY------YVDEPR---------------------
A0A348NPT1      -----YYYSSY-------SD-KAYQDY------YISQDV-------------------EL
A0A2E1KV60      -----YYYSQY-------SS-EKYSQY------YLQDSYL-DLNESNATKSLDSSTANDQ
A0A2D7F4D9      -----YYYSQY-------SANKKYSAY------YMQESYLGNMDESEAEES-------NQ
A0A3R7RBR8      -----YYYSQY-------SANKKYSAY------YMQESYLGNMDESEAEES-------NQ
A0A2E0NH28      -----YYYSHY-------SD-KSYQDY------YIN------------NED-------DF
A0A350AS32      -----YYYSHY-------SD-KAYQDY------YIH------------NDE-------EF
A0A368BGT4      -----YYYSNY-------SD-KAYKNY------YTNRGEELDQGEELVQGE-------EL
A0A2E0V4K6      -----YRTGRYGYRQYGYGGYGSYGAY------GSDDEED--------------------
A0A2E6NAH3      -----YYYSNY--------SDKAYQDY------YINQEEELEEELVGDIETELESKS---
A0A2A5VZA5      -----YYYSQY--------TDKAYQDY------YIGQEDEMEDELAASTEPEEKVES---
A0A424R295      -----YYYSQY--------TDKAYQDY------YIGQEDEMEDELAASTEPEEKVES---
B4CZV9          -----YYQYYY-----------YSHDY------YYQHAIEST------------------
A0A290QE54      -----YSNYRY---------YRSYKKY------YGTQT----------------------
A0A1H1SWX2      -----YSNYRY---------YRSYKKY------YGSQS----------------------
A0A4Q1C9I5      -----YSNYRY---------YRSYKKY------YGSQS----------------------
A0A3B9FM17      -----YYYSGY--YGYGYFRYKYYNKY------YGKSDAEEKRKKKQAVS----------
A0A1G3ZL71      -----YTNYRY---------YRSYKKY------YGTQG----------------------
A0A556QP09      -----YSNYRY---------YRSYKKY------YGTQD----------------------
A0A2T6DX88      -----YSNYRY---------YRSYKKY------YGTQA----------------------
A0A2T6CWI7      -----YSNYRY---------YRSYKKY------YGAQT----------------------
A0A3E1E5C8      -----YSNYRY---------YRSYKKY------YGTQS----------------------
B1ZZ74          -----YSNYRY---------YRSYKKY------YGSQS----------------------
R7E4L8          ---------NF-----KNSRFHYYDEY------SETDG----------------------
A0A4Q3BVY2      -----YYNYYY-----------YSAPY------YDQMESEEEPAAMVQTRS---------
A0A4P6PCA7      -----YSLAGKFSGAEGYGYGHSYKSY------VSDTAETAN------------------
A0A0E3YV65      -----AYYSSY-----GHYGSKYAADY------IREEKA---------------------
W0J900          -----GYYSGY-----GYYGSRYYASY------YKEEQLAGQSG----------------
A0A2T6DSN5      -----YGYDGY-----GSYESDYYKSY------QSEKVSS--------------------
A0A2V2SMX4      -----YYYSKY-------------SEY------YRTYPGKG-------------------
A0A317ZIW7      -----YYYYRY-------------SEY------YTSTQKPEDSVKSVGGV----------
A0A2D7WMI4      -----YYYSGY--YGYGYYRYKYYNKY------YGKNQDS--------------------
A0A2D6VHX5      -----YYYSGY--YGYGYYRYKYYSKY------YSPTEDT--------------------
A0A2D8I214      -----YYYSGY--YGYGYFRYKYYNKY------YGKEKKSEA------------------
A0A1Z8VL41      -----YYYSGY--YGYGYFRYKYYNKY------YGSEKDTSTKIEV--------------
A0A2E6TNA4      -----YYYSGY--YGYGYFRYKYYYKY------YGSEKDTSSKIEA--------------
A0A1Z8RG47      -----YYYSGY--YGYGYFRYKYYNKY------YGKEKDEKAPVEKLTS-----------
A0A1Z8RJJ5      -----YYYSGY--YGYGYFRYKYYNKY------YGKEKDEKAPVEKLTS-----------
A0A2D7V631      -----YYYSGY--YGYGYFRYKYYNKY------YGKDKDEKPPVEKLTT-----------
A0A354RA24      -----YYYSGY--YGYGYFRYKYYNKY------YGKDKDEKPPVEKLTT-----------
A0A2E9RV62      -----YYYSGY--YGYGYFRYKYYNKY------YGKQGAEKAQ----GKNAKLS------
A0A2E4AY96      -----YYYSGYYGYGYGYYRYKYYNKY------YGGSKSNTG------------------
A0A3B9B9P4      -----YYYSGYYGYGYGYYRYKYYNKY------YGGSKSNTG------------------
A0A2D5Y6N6      -----YYYSGY--YGYGYFRYKYYNKY------YGRERDDEPSSPTVQGKESVS------
A0A2E7HSS8      -----YYYSGY--YGYGYFRYKYYNKY------YGKSDAEEKR----KSVSS--------
A0A2D8VCK3      -----YYYSGY--YGYGYFRYKYYNKY------YGKSDAEEKR----KKKQAVS------
A0A350QVY4      -----YYYSGY--YGYGYFRYKYYNKY------YGKPDAEEKR----KNKQAVS------
A0A2E4ZYR7      -----YYYAGY--YGYGYFRYKYYNKY------YGGRGEDEKA----EKKAQAS------
A0A2E6TCV1      -----YYYAGY--YGYGYFRYKYYNKY------YGGKEGAESE----LPREKAS------
A0A3D4HHL8      ---------YY------YHR---YGEY------YTRREEPSPKVSKKMQAVSKT------
A0A366HV03      -----YYY-YY------YSSSYYYQAF------EEDDVAGRSAPVSA-------------
A0A5R8KAF2      -----YYNYYY------YSA-----SY------YEDLEGVGAGGKAVV------------
A0A2V2SDN0      -----FEY-HH------YQR---YKDD------YRWQPNVTTAA----------------
A0A1V6GL40      -----SED-YY------YYR---YKDY------YRPYPSGGTKTAESARTGQA-------
A0A2V5X6Z6      -----CER-QY------YQR---YRRA------YRWEPQKSGRV-ALAGNLSPNTTDR--
A0A2V5VGZ7      -----YEH-DY------YQR---YRRA------YHWEPKETRCATALAGHSAPDATDG--
A0A2V5U130      -----YGH-DY------YQR---YRRA------YRWEPKETRRATALAGHSAPDATGG--
A0A2V6C237      -----YEH-DY------YQR---YRRA------YHWEPKETRCATALAGHSAPDATDG--
A0A3R8L982      -----YSNYRY------YRS---YKKY------YGPRAA---------------------
A0A2E7HPU9      QYGGGYGS-GS------YGS---YGSY------GADEEEDD-------------------
A0A388PR45      -----YTD-TY------DPS---AGKY------YVGESGAGPKA----------------
A0A388QR61      -----YTD-TY------DPT---AGKY------YASDAGGPPSP----------------
A0A4P5YHI0      -----YTD-TY------DPT---AGKY------YASDAGGPPSP----------------
A0A2A2RS01      -----YTD-SY------DPA---NKKY------YIDSEGSDSSG----------------
A0A2A2Y1A7      -----YTD-SY------DPA---NKKY------YIDSEGSDSSG----------------
A0A388PDH9      -----YTD-SY------DPA---NKKY------YIDAQDSDSSS----------------
A0A2G4H1E7      -----YTD-SY------DSS---YRKY------YVDERGASSSPGPPKS-----------
A0A2G4GZA6      -----YTD-TY------DSS---YRKY------YVDETRSQAGADSTKS-----------
A0A388P514      -----YTD-TY------DSS---YRKY------YVDEPRGQSDAGSAKS-----------
A0A2A2YG59      -----YTD-TY------DSS---YRKY------YVDEPRGQSGAGSEKS-----------
A0A2G4F7D5      -----YTD-TY------DSS---YRKY------YVDEPRGQSGAGSEKS-----------
D5EML0          -----Y---GY------EKDPEKYKAY------YRRSRSA--------------------
A0A3C1C1M3      -----Y---HS------YGP---YYHY------QKHYGAY--------------------
A0A2E9EYJ1      -----Y---QY------YTS---YYTY------YAPRNLDPDMESGSIGSPKPG------
A0A258AXR6      -----Y---QY------YTS---YYTY------YSPTNSPNGGTGGKSRRRKIKAETTAT
A0A3D3NZQ6      -----Y---QY------YTN---YYTY------YSPDNRP-AAEGGKPKKRRK-------
A0A1T4WVZ9      -----Y---QY------YTS---YYTY------YSPNNTA-APAGTRPEKRKKQIPPSRP
A0A4R7SSI6      -----Y---QY------YTS---YYTY------YSPNNTA-APAGHKPEKRKKQVAPGQV
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      S-----------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      KDDEPSKA----------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      PKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARNRFPKNRLHELFDRIC
A0A257LYL4      S--QPAAKGDSELY----------------------------------------------
A0A4Q2XXY1      SGGKSSPKDDKDDY----------------------------------------------
A0A3D4CZT6      KVVANDSEEDEGLTY---------------------------------------------
A0A4V1S9Q4      PSRGNDSE-----LY---------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      K-----DAKLLAKADIGGEDEKPKY-----------------------------------
A0A522ACN3      K---------------AKVEIKPKY-----------------------------------
A0A353DCA1      K--------------SERSSSEDLY-----------------------------------
A0A3C1AXQ2      KKPTPAGQPSPGAAASSNAPRGDLF-----------------------------------
A0A3D0IZR7      PAASVDEVVEHPLDTPEASAPKVTFIRPPRGQDRF-------------------------
A0A520LRZ3      SSEEVSIEDKF-------------------------------------------------
A0A356FSV4      RET---------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      KY----------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ELAATQSHDSEDLY----------------------------------------------
R7E1V8          ELAATQSHDSEDLY----------------------------------------------
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      SQSA--------------------------------------------------------
A0A3D3NW23      SQAA--------------------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      MKDHDFFSKKQKRPRRRNRRRPSRR-----------------------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      ------------------------------------------------------------
A0A290QD69      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      ------------------------------------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A522AC27      ------------------------------------------------------------
A0A2A2R174      ------------------------------------------------------------
A0A1H2DTI1      ------------------------------------------------------------
A0A1V5L462      ------------------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3D3LGD3      RTPGGDLF----------------------------------------------------
A0A350ARX4      ------------------------------------------------------------
B5JIS2          DNLEAVEANGKVAETAKSKLKSTPLKLNNKNSGSKSLIGKLMSEQEKKE-----------
A0A1H2GQN6      TTPPPTPPSQPDEF----------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      PITLAVATAVPPKSAQDFKLRRATQRKANLTLPGATAARPARDVTVTRT-----------
A0A2A2RPW6      ------------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      SSSSDTSNDDLY------------------------------------------------
A0A354FSA6      SSSSDTSNDDLY------------------------------------------------
A0A3B9GA54      SSVSDTSNDDLY------------------------------------------------
A0A520LEH8      SSSSDTSNDDLY------------------------------------------------
A0A2D7B7R6      ------------------------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
A0A2E5K4P7      EQGSEAQA----------------------------------------------------
A0A0R2XPB1      ------------------------------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ------------------------------------------------------------
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ------------------------------------------------------------
A0A2V6EBU2      ------------------------------------------------------------
A0A2V6EY06      ------------------------------------------------------------
A0A2V6ME53      ------------------------------------------------------------
A0A538NUU0      ------------------------------------------------------------
A0A2V6NIJ1      QAQSS-------------------------------------------------------
A0A2V6C292      QAQSF-------------------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      IETQI-------------------------------------------------------
A0A2V5XFN9      IETA--------------------------------------------------------
A0A2V6EZC8      IETA--------------------------------------------------------
A0A2V6I7Z5      IETA--------------------------------------------------------
A0A3B9LCP2      VETS--------------------------------------------------------
A0A3C0R669      VQTS--------------------------------------------------------
A0A2V6EID2      QPS---------------------------------------------------------
A0A2V6MHB0      QPS---------------------------------------------------------
A0A2W5YWL9      VQPS--------------------------------------------------------
A0A2V5NH62      IQSS--------------------------------------------------------
A0A2W6A620      IQSS--------------------------------------------------------
A0A2V5PIJ4      IQSS--------------------------------------------------------
A0A2V6K2G8      IETA--------------------------------------------------------
A0A2V5W206      IETT--------------------------------------------------------
A0A2V6MW77      METT--------------------------------------------------------
A0A2G4GZN8      ------------GATDSDSAKS--------------------------------------
A0A348NPT1      EDELAGSVEPEMEPRA--------------------------------------------
A0A2E1KV60      SAGVDTAVAESDTNTDTDKLDS--------------------------------------
A0A2D7F4D9      AIVADTFTETKTDSDSEDKLDS--------------------------------------
A0A3R7RBR8      AIVADTFTETKTDSDSEDKLDS--------------------------------------
A0A2E0NH28      EDQLVESTASGDEDTSEIARET--------------------------------------
A0A350AS32      EEELAGSVEPTVDSKS--------------------------------------------
A0A368BGT4      EDELVGDIETELESKS--------------------------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A2E6NAH3      ------------------------------------------------------------
A0A2A5VZA5      ------------------------------------------------------------
A0A424R295      ------------------------------------------------------------
B4CZV9          ------------------------------------------------------------
A0A290QE54      ------------------------------------------------------------
A0A1H1SWX2      ------------------------------------------------------------
A0A4Q1C9I5      ------------------------------------------------------------
A0A3B9FM17      ------------------------------------------------------------
A0A1G3ZL71      ------------------------------------------------------------
A0A556QP09      ------------------------------------------------------------
A0A2T6DX88      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A3E1E5C8      ------------------------------------------------------------
B1ZZ74          ------------------------------------------------------------
R7E4L8          ------------------------------------------------------------
A0A4Q3BVY2      ------------------------------------------------------------
A0A4P6PCA7      ------------------------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------------------------------------
A0A2T6DSN5      ------------------------------------------------------------
A0A2V2SMX4      ------------------------------------------------------------
A0A317ZIW7      ------------------------------------------------------------
A0A2D7WMI4      ------------------------------------------------------------
A0A2D6VHX5      ------------------------------------------------------------
A0A2D8I214      ------------------------------------------------------------
A0A1Z8VL41      ------------------------------------------------------------
A0A2E6TNA4      ------------------------------------------------------------
A0A1Z8RG47      ------------------------------------------------------------
A0A1Z8RJJ5      ------------------------------------------------------------
A0A2D7V631      ------------------------------------------------------------
A0A354RA24      ------------------------------------------------------------
A0A2E9RV62      ------------------------------------------------------------
A0A2E4AY96      ------------------------------------------------------------
A0A3B9B9P4      ------------------------------------------------------------
A0A2D5Y6N6      ------------------------------------------------------------
A0A2E7HSS8      ------------------------------------------------------------
A0A2D8VCK3      ------------------------------------------------------------
A0A350QVY4      ------------------------------------------------------------
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ------------------------------------------------------------
A0A3D4HHL8      ------------------------------------------------------------
A0A366HV03      ------------------------------------------------------------
A0A5R8KAF2      ------------------------------------------------------------
A0A2V2SDN0      ------------------------------------------------------------
A0A1V6GL40      ------------------------------------------------------------
A0A2V5X6Z6      ------------------------------------------------------------
A0A2V5VGZ7      ------------------------------------------------------------
A0A2V5U130      ------------------------------------------------------------
A0A2V6C237      ------------------------------------------------------------
A0A3R8L982      ------------------------------------------------------------
A0A2E7HPU9      ------------------------------------------------------------
A0A388PR45      ------------------------------------------------------------
A0A388QR61      ------------------------------------------------------------
A0A4P5YHI0      ------------------------------------------------------------
A0A2A2RS01      ------------------------------------------------------------
A0A2A2Y1A7      ------------------------------------------------------------
A0A388PDH9      ------------------------------------------------------------
A0A2G4H1E7      ------------------------------------------------------------
A0A2G4GZA6      ------------------------------------------------------------
A0A388P514      ------------------------------------------------------------
A0A2A2YG59      ------------------------------------------------------------
A0A2G4F7D5      ------------------------------------------------------------
D5EML0          ------------------------------------------------------------
A0A3C1C1M3      AQAVPPSLTPTGK-----------------------------------------------
A0A2E9EYJ1      SKLASXDQNNLSAEDKF-------------------------------------------
A0A258AXR6      ALGSSQSVSRLDGDDVF-------------------------------------------
A0A3D3NZQ6      AAGETAPARTPGG-DLF-------------------------------------------
A0A1T4WVZ9      GQATVASSSAPRG-DLF-------------------------------------------
A0A4R7SSI6      AKAVSAPSNGSRG-DLF-------------------------------------------
                                                                            

A0A4Q3AQI1      -----------------------
A0A4P6PD26      -----------------------
A0A1Z8SVB5      -----------------------
A0A2V5W3Y0      -----------------------
A0A432FAS4      -----------------------
A0A660Q3A0      -----------------------
A0A2V5UAD5      -----------------------
A0A258AXL1      -----------------------
A0A2E6T1E0      -----------------------
A0A2D5W0Q9      -----------------------
A0A1Z9KB52      -----------------------
A0A2V5U7A0      EEILDDKLKNDFQQSMQEELRVL
A0A257LYL4      -----------------------
A0A4Q2XXY1      -----------------------
A0A3D4CZT6      -----------------------
A0A4V1S9Q4      -----------------------
A0A355VK99      -----------------------
A0A2V6N5E0      -----------------------
A0A2V6NH44      -----------------------
A0A432FDF6      -----------------------
A0A522ACN3      -----------------------
A0A353DCA1      -----------------------
A0A3C1AXQ2      -----------------------
A0A3D0IZR7      -----------------------
A0A520LRZ3      -----------------------
A0A356FSV4      -----------------------
A0A3D3DET9      -----------------------
A0A355SVK9      -----------------------
A0A2E5D7I3      -----------------------
A0A2V5NYE2      -----------------------
A0A2V6FIP7      -----------------------
A0A353DI77      -----------------------
A0A1V6GCZ3      -----------------------
A0A3C1UJT2      -----------------------
A0A2S7U0Z3      -----------------------
A0A5E6MKA7      -----------------------
A0A2N8IR72      -----------------------
A0A2N8IV96      -----------------------
R7E1V8          -----------------------
A0A1T4WWY4      -----------------------
A0A3D3LEQ6      -----------------------
A0A3D3NW23      -----------------------
A0A2E0R252      -----------------------
A0A3E1EF48      -----------------------
A0A2A2PVG8      -----------------------
A0A2E0R421      -----------------------
A0A2E5EJ69      -----------------------
A0A2G4I5Z5      -----------------------
A0A4P5QQV6      -----------------------
A0A2E7ALI1      -----------------------
A0A178IDB9      -----------------------
A0A290QD69      -----------------------
A0A2E7VDS1      -----------------------
A0A178IFJ2      -----------------------
A0A357FSP9      -----------------------
A0A538NJ59      -----------------------
A0A3C1VFY9      -----------------------
A0A522AC27      -----------------------
A0A2A2R174      -----------------------
A0A1H2DTI1      -----------------------
A0A1V5L462      -----------------------
A0A2A2R3V9      -----------------------
A0A3D3LGD3      -----------------------
A0A350ARX4      -----------------------
B5JIS2          -----------------------
A0A1H2GQN6      -----------------------
A0A512M3Y3      -----------------------
A0A4P5R5J1      -----------------------
A0A4P5YK43      -----------------------
A0A2A2RPW6      -----------------------
B4D1I7          -----------------------
A0A353F286      -----------------------
A0A354FSA6      -----------------------
A0A3B9GA54      -----------------------
A0A520LEH8      -----------------------
A0A2D7B7R6      -----------------------
B1ZT68          -----------------------
W0J7C2          -----------------------
A0A2E5K4P7      -----------------------
A0A0R2XPB1      -----------------------
A0A348NQP1      -----------------------
A0A357FV58      -----------------------
A0A2V6F9Q9      -----------------------
A0A2V6NZZ3      -----------------------
A0A2V6EBU2      -----------------------
A0A2V6EY06      -----------------------
A0A2V6ME53      -----------------------
A0A538NUU0      -----------------------
A0A2V6NIJ1      -----------------------
A0A2V6C292      -----------------------
A0A2V6D2X0      -----------------------
A0A2V5ZUK1      -----------------------
A0A2V5XFN9      -----------------------
A0A2V6EZC8      -----------------------
A0A2V6I7Z5      -----------------------
A0A3B9LCP2      -----------------------
A0A3C0R669      -----------------------
A0A2V6EID2      -----------------------
A0A2V6MHB0      -----------------------
A0A2W5YWL9      -----------------------
A0A2V5NH62      -----------------------
A0A2W6A620      -----------------------
A0A2V5PIJ4      -----------------------
A0A2V6K2G8      -----------------------
A0A2V5W206      -----------------------
A0A2V6MW77      -----------------------
A0A2G4GZN8      -----------------------
A0A348NPT1      -----------------------
A0A2E1KV60      -----------------------
A0A2D7F4D9      -----------------------
A0A3R7RBR8      -----------------------
A0A2E0NH28      -----------------------
A0A350AS32      -----------------------
A0A368BGT4      -----------------------
A0A2E0V4K6      -----------------------
A0A2E6NAH3      -----------------------
A0A2A5VZA5      -----------------------
A0A424R295      -----------------------
B4CZV9          -----------------------
A0A290QE54      -----------------------
A0A1H1SWX2      -----------------------
A0A4Q1C9I5      -----------------------
A0A3B9FM17      -----------------------
A0A1G3ZL71      -----------------------
A0A556QP09      -----------------------
A0A2T6DX88      -----------------------
A0A2T6CWI7      -----------------------
A0A3E1E5C8      -----------------------
B1ZZ74          -----------------------
R7E4L8          -----------------------
A0A4Q3BVY2      -----------------------
A0A4P6PCA7      -----------------------
A0A0E3YV65      -----------------------
W0J900          -----------------------
A0A2T6DSN5      -----------------------
A0A2V2SMX4      -----------------------
A0A317ZIW7      -----------------------
A0A2D7WMI4      -----------------------
A0A2D6VHX5      -----------------------
A0A2D8I214      -----------------------
A0A1Z8VL41      -----------------------
A0A2E6TNA4      -----------------------
A0A1Z8RG47      -----------------------
A0A1Z8RJJ5      -----------------------
A0A2D7V631      -----------------------
A0A354RA24      -----------------------
A0A2E9RV62      -----------------------
A0A2E4AY96      -----------------------
A0A3B9B9P4      -----------------------
A0A2D5Y6N6      -----------------------
A0A2E7HSS8      -----------------------
A0A2D8VCK3      -----------------------
A0A350QVY4      -----------------------
A0A2E4ZYR7      -----------------------
A0A2E6TCV1      -----------------------
A0A3D4HHL8      -----------------------
A0A366HV03      -----------------------
A0A5R8KAF2      -----------------------
A0A2V2SDN0      -----------------------
A0A1V6GL40      -----------------------
A0A2V5X6Z6      -----------------------
A0A2V5VGZ7      -----------------------
A0A2V5U130      -----------------------
A0A2V6C237      -----------------------
A0A3R8L982      -----------------------
A0A2E7HPU9      -----------------------
A0A388PR45      -----------------------
A0A388QR61      -----------------------
A0A4P5YHI0      -----------------------
A0A2A2RS01      -----------------------
A0A2A2Y1A7      -----------------------
A0A388PDH9      -----------------------
A0A2G4H1E7      -----------------------
A0A2G4GZA6      -----------------------
A0A388P514      -----------------------
A0A2A2YG59      -----------------------
A0A2G4F7D5      -----------------------
D5EML0          -----------------------
A0A3C1C1M3      -----------------------
A0A2E9EYJ1      -----------------------
A0A258AXR6      -----------------------
A0A3D3NZQ6      -----------------------
A0A1T4WVZ9      -----------------------
A0A4R7SSI6      -----------------------
                                       

© 1998-2020Legal notice