BYKdb

Dataset for cluster orphancd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

203 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ----------------------------------------------------------MD
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      ---------------------------------------------------------MKK
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      ------------------------------------------------------------
A0A3D3NW23      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      ---------------------------------------------------MSKPVQAQT
A0A290QD69      ---------------------------------------------------MSKSTKS--
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      ---------------------------------------------------------MSK
A0A178IFJ2      ----------------------------------------------MAETFSKKPVPAAG
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      ------------------------------------------------------------
A0A1H2DTI1      ------------------------------------------MEPIPPSAPGTPGGFPPP
A0A1H1MGC9      -------------------------------------------MDTVPKAEKAQGSGEAY
A0A1V5L462      ------------------------------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      ---------------------------------------------MILSVWRSESLPSDP
B5JIS2          -----------------------------------------------MAHSETKKSLRPH
A0A6N6ZC77      -----------------------------------------------------------M
A0A7C5H7K5      ------------------------------------------------------MVNGQS
A0A538NJ59      -----------------------------------------------------MTHSNLP
A0A2A2R3V9      ------------------------------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A2V2SMX4      -----------------------------------------------------------M
A0A522AC27      ------------------------------------------------------------
A0A6M1RFD0      ------------------------------------------------------------
A0A7C3HXH0      ------------------------------------------------------------
A0A1H2GQN6      ------------------------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      ---------------------------------------------------------MAS
A0A2A2RPW6      ------------------------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ------------------------------------------------------------
A0A3B9GA54      ------------------------------------------------------------
A0A520LEH8      ------------------------------------------------------------
A0A6B2M0T8      -----------------------------------------------------------M
A0A2D7B7R6      ------------------------------------------------------------
A0A2E5K4P7      ----------------------------------------------MDSEPPEDSSNSSY
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ------------------------------------------------------------
A0A2V6EBU2      ------------------------------------------------------------
A0A2V6EY06      ------------------------------------------------------------
A0A2V6ME53      ------------------------------------------------------------
A0A538NUU0      ------------------------------------------------------------
A0A2V6NIJ1      ------------------------------------------------------------
A0A2V6C292      ------------------------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      ------------------------------------------------------------
A0A2V5XFN9      ------------------------------------------------------------
A0A2V6EZC8      ------------------------------------------------------------
A0A2V6I7Z5      ------------------------------------------------------------
A0A3B9LCP2      ------------------------------------------------------------
A0A3C0R669      ------------------------------------------------------------
A0A2V6EID2      ------------------------------------------------------------
A0A2V6MHB0      ------------------------------------------------------------
A0A2W5YWL9      ------------------------------------------------------------
A0A2V5NH62      ------------------------------------------------------------
A0A2W6A620      ------------------------------------------------------------
A0A2V5PIJ4      ------------------------------------------------------------
A0A2V6K2G8      ------------------------------------------------------------
A0A2V5W206      ------------------------------------------------------------
A0A2V6MW77      ------------------------------------------------------------
A0A6N4WVA3      ------------------------------------------------------------
A0A0R2XPB1      ------------------------------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ------------------------------------------------------------
A0A2G4GZN8      MPTPDPSSDNRPPEPSREGNPGYGSYGQGYGQGYGQGYGQGYGAYGAGNY-------RGG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      ------MKNDYS-DNNMGNDNSYGNYGNYAPGN---QY-NQYNSYRYGGGGNYGNYGNYG
A0A2D7F4D9      ------MKNDYTGDQSNMNSNHYGGYSNNYGNP---QY-YNHGSYRYGGN------SGSG
A0A3R7RBR8      ------MKNDYTGDQSNMNSNHYGGYSNNYGNP---QY-YNHGSYRYGGN------SGSG
A0A2E0NH28      ------MKNDYVRGGPDPNTS-----------G---RYGYSSGNYGYNGS----------
A0A350AS32      ------MKNDYVRGAPDPNSGGYG--------G---GYGYG-GGYGYG-G----------
A0A368BGT4      ------MKNDYVRGAPDPNSGGYGSGGYGYGSG---GYGYGNGGYGYGNG----------
A0A6N6PLV8      ------------------------------------------------------------
A0A2E0V4K6      ----------------------------------------MSARRLAGAG----------
A0A290QE54      --------------------------------------MSDSPLNPSNAS----------
A0A1H1SWX2      ------------------------------------MSAPDAPLPTAPAR----------
A0A1D8AZK8      ------------------------------------MSVPDSP-PSSSAA----------
A0A4Q1C9I5      ------------------------------------MSSPDFS-PHSASV----------
A0A2E6NAH3      -------MKNDYIRGAPDPNSGGYGGSGYGYGGGNYGYGGSNYGYGGGNY----------
A0A2A5VZA5      -------MKNDYIKGGGDPNSGGYG-YGYGYSGGS--------GYSYGNY----------
A0A424R295      -------MKNDYIKGGGDPNSGGYG-YGYGYSGGS--------GYSYGNY----------
B4CZV9          ------------------------------------------------------------
A0A1G3ZL71      -----------------------------------MPSPLAIPAAPAKPS----------
A0A556QP09      ------------------------------------MSSVQKPSSATKVS----------
A0A2T6DX88      -----------------------------------MNDLQAKHP--SLHT----------
A0A2T6CWI7      -----------------------------------MADANAKPPPPPPVD----------
A0A3E1E5C8      -----------------------------------MPDHTARPF--PPAH----------
B1ZZ74          -----------------------------------MSLAEAKPAVQPGGA----------
A0A3B9FM17      ------------------------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------MAEIPFTKTGPDTGPLHPRP----------
R7E4L8          ------------------------------------------------------------
A0A4Q3BVY2      ------------------------------------------------------------
A0A4P6PCA7      ------------------------MFSGNEPPPVYGASHTPPPVDPANPY----------
A0A2T6DSN5      -------------------------------------------MAKASKT----------
A0A317ZIW7      ---------------------------------------------MSDLF----------
A0A7C4PPT4      ------------------------------------------------------------
A0A7C4QZX4      ------------------------------------------------------------
A0A2D7WMI4      -----------------------------------------------MDE----------
A0A2D6VHX5      -----------------------------------------------MDL----------
A0A2D8I214      ---------------------------------------------MEEEI----------
A0A1Z8VL41      ---------------------------------------------MDDNF----------
A0A2E6TNA4      ---------------------------------------------MDDNL----------
A0A1Z8RG47      ---------------------------------------------MDDEI----------
A0A1Z8RJJ5      ---------------------------------------------MDDEI----------
A0A2D7V631      ---------------------------------------------MDDDI----------
A0A354RA24      ---------------------------------------------MDDDI----------
A0A2E9RV62      --------------------------------------------MDSYSN----------
A0A2E4AY96      ---------------------------------------------MDQEH----------
A0A3B9B9P4      ---------------------------------------------MDQEH----------
A0A2D5Y6N6      ---------------------------------------------MDDNF----------
A0A2E7HSS8      ---------------------------------------------MEEDF----------
A0A2D8VCK3      ---------------------------------------------MEEDF----------
A0A350QVY4      ---------------------------------------------MEEDF----------
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ------------------------------------------MNESLEEL----------
A0A3D4HHL8      -----------------------------------------MTAPPTKSP----------
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A5R8KAF2      ------------------------------------------------------------
A0A7C4LRZ6      ----------------------------------------MSEPANANAK----------
A0A2V2SDN0      -----------------------------MENQNHNEPAKANNQLTTPAL----------
A0A1V6GL40      ----------------------------------------MNDQP---------------
A0A2V5X6Z6      --------------------------------------MNNNNHPNAAAV----------
A0A2V5VGZ7      ------------------------------------MNDNNHNQPNTPAV----------
A0A2V5U130      --------------------------------------MNNNNHPNAAAV----------
A0A2V6C237      --------------------------------------MNNNNHPNAAAV----------
A0A3R8L982      ---MPDTTNNRPPPSAKLH-----------------------------------------
A0A6N6QBS9      ----------------------------------------MKYPYSSHNT----------
A0A2E7HPU9      MRRKKYYEHDEELDLLDEEDGLGGGTSRRA------------------------------
A0A388PR45      -MDTPSPKPGQPPEDPSRG-PRGYGSYGSY----GGY-----AGYGAPGY----------
A0A388QR61      -MDAPAPKPGQPQDDAQRG-PRGYGSYGNY----GNYGGPA-GGYGAGGY----------
A0A4P5YHI0      -MDAPAPKPGQPQDDAQRG-PRGYGSYGNY----GNYGGPA-GGYGAGGY----------
A0A2A2RS01      MAEKTQKPEDDQDDSAARG--RGYGSYGNYGNYGGNYGGNYGGGYGA-GY----------
A0A2A2Y1A7      MAEKTQKPEDDQDDSAARG--RGYGSYGNYGNYGGNYGGNYGGGYGA-GY----------
A0A388PDH9      MAETPQKPEDNQDDSASRA--RGYGSYGNY----GNYGGAYGGGYGA-GY----------
A0A2G4H1E7      -MANPEPSSDNRPPEPARGGNRGYGSYGSY----GQYGQGY-GAYGA-GY----------
A0A2G4GZA6      -MPNPDPLSDNRPPEPARGGNRGYGSYGSY----GNYGAAN-GGYGY-GN----------
A0A388P514      -MATPEPSSDNRPPEPARGGNRGYGSYGSY----GNYGAGN-GGYGY-------------
A0A2A2YG59      -MATPEPSSDNRPPEPARGGNRGYGSYGSY----GNYGAGN-GGYGY-------------
A0A2G4F7D5      -MATPEPSSDNRPPEPARGGNRGYGSYGSY----GNYGAGN-GGYGY-------------
D5EML0          -------------------------------------------------M----------
A0A7C4PPJ4      ----------------------------------------MSNNSSPEAR----------
A0A3C1C1M3      MTQPNFPPSNLPPASGQPPGAPIYYGGGDP----YSGGMPMDSGPLQSLN----------
A0A2E9EYJ1      ----------------------------------------MAKQSETKLH----------
A0A258AXR6      ---------------------------------------MNESGTELQKH----------
A0A3D3NZQ6      ---------------------------------------MSEASPDLQNH----------
A0A1T4WVZ9      ---------------------------------------MRETSNELQQQ----------
A0A4R7SSI6      ---------------------------------------MRDTGNELQQQ----------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      IDPFADDDKEYRSTGAEEPVVSNRIGISNVRQALSRWWIMLIFGVLGYFAALYYM-SINP
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      EIDPFDDTLAEGDAHDEGARVSNRSAAGLLRVALERWWLILIFMVLGYVGALYYL-SVKE
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A2E0R252      ---MNEVDPPQNGYGNEAPASNGKGIKDYVRWFLRRFWIFLITCLGGYFLGLYVA-SLTP
A0A3E1EF48      --------------------MATKTFADYLNWLKRYAWIAVLTTITGTFYGFYLF-TITP
A0A2A2PVG8      ------MSRSYAPDSDANETGQSRGLQDYLRWFLRRFWIFLIAVVGGYFLGLYLY-SVTP
A0A2E0R421      ----MIDHHQQPLEENLHSNPQARGLQDYVRWFIHRFWILPITIVSGILIGHYVY-THTP
A0A2E5EJ69      -----MDFPESHDLGQQTQVEKEFSLRDSVDVVLDHAWLIILIFAACFGGAYYYL-KTAT
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------MLLRKYWWVVAFGVALGTGIAAWLV-ASQK
A0A1T4WWY4      -------MNSKTQPSGKDSKLDGSSIIRTVLAYEDYWRLMIILVLIGLLGGTCYF-IYAR
A0A3D3LEQ6      -------MNPRQSSNSQKGKLDSSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYAR
A0A3D3NW23      -------MNPRQSSKSQKGKLDSSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYAR
A0A2E7ALI1      ----------------------------------------------------------PP
A0A178IDB9      RSTAHRSAARVPDQAQAGGNLAHFSPRNLLNMFLERWWIGLIAGAAIATVFILAQ-PKLA
A0A290QD69      -SSGKRGSSEQPQTKPAGGG---FSPKSLLNMFLERWWIGLIVAAAVAAAFVLSQ-PKPE
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      KPNKKLDPYYGHSAGMMDRINISIHLRRYIKMLKSRWPFVILTAILGTAYMGFKA-FGDK
A0A178IFJ2      AWPPQSSSPFGEPPPFAGGSLPRLDIRQILLCIRERWIVAVSLAILVCVLLGVWL-LNQP
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      -----MDQYSQTQVGDTSSDHGMSLNRELWQVLVEKAWLIACIMAAAAAIGVWVG-VRSP
A0A1H2DTI1      QAPSSPMTAAMSQAGGRVPGTFMSRLHRYKLLVKKFWWILLFCTAVGIAIQAYKI-AHEV
A0A1H1MGC9      PYTYYGTSYSGYGSPGHGDNQMQRSMQDYVLILRERAWYIVLVFALVFSAATIFT-FTRV
A0A1V5L462      MQDDFLESSGREGGHTDLGETLRSLSHRARLLLQSYWWILLLCLSIGLLVQAVRV-KSMR
A0A3D3LGD3      --------------------MKIERLQDKVQVF-----------------------ERSS
A0A350ARX4      NNFSSSYDLDESSGSLDWGERLQRIYFESKRLLAIWWWIVLLAVAIGIGWQAYRE-LNRE
B5JIS2          ASAGYGASGSRNSNTEDTLAGVVTQIRSFFAIIRSRWLSGVVSALVVGSAFAYLF-LNDK
A0A6N6ZC77      VANEFDLFDDKPKAAGDWQDQARHYWQLAKLLLRRYWWLPLLTLVLGASWRGWQA-QNDR
A0A7C5H7K5      TLPSNYYPYPHQYPDYPRKDHFAELLGYTKRVLMLRWWILLLMMMAGCLGGVAFV-YLSP
A0A538NJ59      VPASEYPLAGPMDQDANLLPSF--RIQRFFTFLLKYWWVPVLTLALSLGGAIWYF-FWEP
A0A2A2R3V9      -----MSSITPPPTLSSWSAAFFTKLHRYRALVKRRWYVPLLTLSVGLCIQAYRF-AQIQ
A0A3C1VFY9      ---MKEDSALTAPDRHAWGRKFFSRVQRYRNLLLRRWWVLVVCLVLALGIEAVHI-QFTP
A0A2V2SMX4      NQPGAIETVSTTQHQHAWRARFFTRLQRLRGLLLAKWWIPALGVALGVGIQASRS-ITEK
A0A522AC27      --MNE-PTPTPTHDRSSWAARFHSRVYRYKRLLKQRWWIPFSCVFIALVIQGALS-WFAP
A0A6M1RFD0      --MNEYPQPAP-ENRSVRSARFFTVLQRWRSLLRRHWWVLPGCALLAMAVHLIVV-WNSP
A0A7C3HXH0      --MNEYPQPVP-ENRSVRSARFFTVLQRWRSLLRRYWWILPGCALLAMAVHLLIL-WNSP
A0A1H2GQN6      --------------MSVSESIDLPHFNDYWRVIRARFGIILTLFILTFGTGYFVSAFVLQ
A0A512M3Y3      ------------MQKGKKLIITFQDVFLFLTRFVKHWKIASLLFSLGLAASLLYY-TYGR
A0A4P5R5J1      ----MSLPTSQLPAGTSAINRVRVQGIRYVYLLKKRWWVLVLLLSLGLCIGAWTA-MQQP
A0A4P5YK43      SHASLELPPPNQGTSLVDRINISIHFRRYFKIISRRWWIPFLLVLVGTGIALYVA-LTTP
A0A2A2RPW6      -----MQTTEDVTQQSPIGGLSSVALRDFWQALLDKAWLVVCIMLAAAALGVWHG-ARSP
B1ZT68          MPTSKKPAADRRNP--QANTGFRITPRDLLQMFQERWLLGLFLGAIAAGVFVYFQ-PEKV
W0J7C2          MTTTDTTAGNRPSPGRPRAASIRRTPRDFLDMFAERWWIGALAGAAAAALIVVFR-PHFE
B4D1I7          MDAHPAATPARDQDAASWWYLIHTKIYRYRALLRKYWWMVLFTTCAGMAIGAWML-AHQQ
A0A353F286      ---------------------------------------------------------MIP
A0A354FSA6      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A3B9GA54      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A520LEH8      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A6B2M0T8      SNQQYESNPNSSQRNSGNSISSEKSWLDYLFVIREHWMLALLVALSVSGFYAYKK-LQTV
A0A2D7B7R6      -----------------METGNTNSPQDILRSAKSHYAIVLIIIVACTFTAYMQT-RKMT
A0A2E5K4P7      RGYRYYGGYGYNYGGYDAEPQEHRSLKDYIIIFRERFWLFLFCFAIIITGVLLYT-LKKP
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      -----MNAPLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6EBU2      -----MNAPLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6EY06      -----MNAPLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6ME53      -----MNAPLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A538NUU0      -----MNAPLERPGAAPWSTAFFTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6NIJ1      -----MNPPPVRPAAAPWSTAFFTRLYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6C292      -----MNPPPERPAAAPWSTAFFTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6D2X0      -----MNPPPERPAAAPWSTAFFTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V5ZUK1      ---MQVAATRLQNLSTSWSAAFITRLHRYKSLLLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V5XFN9      ----MPASTAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V6EZC8      ----MPASTAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V6I7Z5      ----MPASTAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A3B9LCP2      ----MQASAAERSTPASWSTAFITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTP
A0A3C0R669      ----MQASAAERSTPASWSTAFITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTP
A0A2V6EID2      --MQAPIPAVERSTPAAWSNTLITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMP
A0A2V6MHB0      --MQAPIPAVERSTPAAWSNTLITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMP
A0A2W5YWL9      -----MNALAERTNPGSWSTAFITRIHRYKSLLKRRWWIPLLTICLGLFVQSWLI-FQTP
A0A2V5NH62      -MPAPAPATTDRPVSAPWSTAFITRLHRYKALLQRRWWIPVLTICLGLFVQAWFI-YQTP
A0A2W6A620      ---MPAPAATDRPASAPWSTAFITRLHRYKSLLQRRWWIPVLTICLGLFVQSWLS-YQTP
A0A2V5PIJ4      ----MGNAAPDHPVSPIWTTKFVTRFHRYRALLLRRWWILLLTVCMGLFVQAWMV-YQRA
A0A2V6K2G8      ----MQPSTAVKNLSTSWSAAFVTRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V5W206      ----MQATTAGKNLSTSWSTVFITRLHRYKSLFLRRWWIPVLTTCLGLFVEAFLI-YQMP
A0A2V6MW77      ----MQVATVGKNLSTSWSAAFITRLHRYKALFLRRWWIPVLTTCLGLFVEAFLI-YQMP
A0A6N4WVA3      --MDDLFQDEKHTKTVDYTELFQQIVYRTKIVLRRYWWVIPLAVALGVCAKAVQS-HFKE
A0A0R2XPB1      --MDDLFQDENNTKTVDYTELFQQIVYRAKIVLRRYWWVIPLAITLGVSYKAVES-FVAD
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      --MDDLFQDEQNTKTVDYTELFQQIVYRAKIVLRRYWWIIPLAIALGVTYKAVES-FVAD
A0A2G4GZN8      NYGGGNYGYGNNPGYGKGGAGESNPIQNYLLMLKERYWWILLASLVFLTLSLLNT-YNVV
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      NYGY--GSYGQNADEQG----PQRTFKDYLFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A2D7F4D9      SYGY--GSYGNVSEEQG----PQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A3R7RBR8      SYGY--GSYGNVSEEQG----PQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A2E0NH28      NYGY--GSYGSNSSGYG--TIAQRSISDYFLMLRERVWYLVVAFFIIFSGSILYT-FNKT
A0A350AS32      GYGYG-GGYGAGGGYEGGSSAPQRSFKDYLLMFRERVWYLIVAFFIIFSGSILYT-FNKT
A0A368BGT4      GYGYGTGGYGGYGGGYGGGAGPQRSFKDYFLIFRERIWYLLVSFFIIFSGTIMYT-FNKT
A0A6N6PLV8      ---------------MNETNEVKLHFLDYWRTIKVRMGLILLTFFLVMVTAGVTT-YFLP
A0A2E0V4K6      -------RELPDEDEVLEFPGRARGLPKVFWEMLGKWYFPVMGAILGLFASAYYL-KKTP
A0A290QE54      -------QSG-------DQLVERRTIRDYLIILRERLWIALPLALLVAVGFGYWK-ARAV
A0A1H1SWX2      -------APGPSLHGNDQQVVEKRSLRDYYVILRERLWIALPVALLVALSIGYYQ-AQEI
A0A1D8AZK8      -------QRAASLHGNDHQVVERRSLRDYYIILRERLWIALPVALLVSLSVGYYK-AQET
A0A4Q1C9I5      -------KHGASLHGNEPHVSERRTLRDYYIMLRERLWIALPVAVIVALGFGYVK-STET
A0A2E6NAH3      -------GFGGGYGDGGAGP--QRSFKDYLLMFRERIWYLIVSLFIIFSGSILYT-FNKT
A0A2A5VZA5      -------GYGGYGGGGEQAP--QRSIKDYILIFRERIWWLIVSFFIIFSGSLLYT-FNKT
A0A424R295      -------GYGGYGGGGEQAP--QRSIKDYILIFRERIWWLIVSFFIIFSGXLLYT-FNKT
B4CZV9          -----------MIPGTKKPAFTLHDIFLYVAIASKHARLMVLLICFALTAGLTYY-VFAK
A0A1G3ZL71      -------ASTRAPQGGEEHLVERRTLRDYYVIIRERLWIALPLALLVSLGLGYWK-MRET
A0A556QP09      -------GR-------DEEIIERRTLRDYYIILRERLWIALPLALVISIGMAYYQ-SRAT
A0A2T6DX88      -------AQ-------GEVLNERRTARDYLIILRERVWIALPIGILVGVILGYLQ-ARVT
A0A2T6CWI7      -------HD-------DETVSERRTLRDYYIMLRERLWIALPLALLVAVGYAYKN-LQET
A0A3E1E5C8      -------DK-------EEPAVERRSLRDYYIILREKLWIALPLALLVSLSLGYYE-ASRP
B1ZZ74          -------RD-------EETLVERRGLRDYYIILRERLWIALPLALLVAVPLGYFR-ARET
A0A3B9FM17      ------------------------------------------------------------
A0A0E3YV65      -----------------------MSPREILLSIRERALTSFVLALLICSLLGGWL-LSRP
W0J900          -------SAPRSEPPFEGGSLPRLDIRQILLCIRERWIVSTSLATLVCVLLGVWL-LKQP
R7E4L8          ----------MPVSVIQPEDNDIFSFRFIFSTARRYWPWILACALLGGGLAYFIC-ARQG
A0A4Q3BVY2      -----------MSNSSDKPKFDPLRLISQVLSYAKHVRLMLLMLAVGVMAGIIVY-LFTT
A0A4P6PCA7      -------GAAHQPAPFNLKGGGGFKPMRLLFVVLRRWYIPVIFGLIGIAVGILRA-LYAV
A0A2T6DSN5      -------TPSKRNEAQSPTKGFNFSPRSLLNMFLERWWIGLIAGALGAVAFVLAQ-PKQD
A0A317ZIW7      -------NDDNQAGKVDYAEILHKSIYRTKIVLKRFWWVLPVAVSLGVAYKAIES-FLEA
A0A7C4PPT4      -----------MLPGLKRRSINFADIVLYVAIALKHWRLMVLLVFFALSLGLTFF-VYVK
A0A7C4QZX4      -----------MLSKLQKRAFSFAEVVYYLALFLKHLRLMVLLLCLSLVGGLFYY-VYAR
A0A2D7WMI4      -------NEIGSLSQNPPNQKV-KGISDFLLILRDRWMLSLTLALPIALGFTYKS-LQVP
A0A2D6VHX5      -------EENSNYGDYSPKSKKNKTVSEFLLILRDRWLLAVTLALPFSLAYVYKE-LQVP
A0A2D8I214      -------ENLNSQGSVRSKSKT-KSIAEILLVIRDRWLLALSLALPISLGYVYLK-FQDT
A0A1Z8VL41      -------EDIDRPLSTKPKGRI-RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVP
A0A2E6TNA4      -------EDIDRSLSTKPKGRV-RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVP
A0A1Z8RG47      -------DTTEIHSGGRSKSNI-KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSP
A0A1Z8RJJ5      -------DTTEIHSGGRSKSNI-KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSP
A0A2D7V631      -------DSISVNAGGKPKSRI-KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGP
A0A354RA24      -------DSISVNAGGKPKSRI-KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGP
A0A2E9RV62      -------PDPSQEIIQPASRSRLRGVFDYFLIIRDRWLLATALSLPIALGFVYKE-YQQP
A0A2E4AY96      -------PESFKN---QGDTIKVRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVP
A0A3B9B9P4      -------PESFKN---QGDTIKVRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVP
A0A2D5Y6N6      -------NKMTGDGGASPTGSKIKGIGDFILILRDRWLIALTLSLPXALAYIYVK-SQGI
A0A2E7HSS8      -------DNFSTP-PQPKGKPKIKGVSDFLLIIRDRWLLSLALSLPFALGFVFVK-QQVH
A0A2D8VCK3      -------DNFSSS-PVQKGKSKIKGLSDFLLIVRDRWLLAIALSLPCALLWVFYK-QQEP
A0A350QVY4      -------DNFSSP-PVQKGKSKIKGLSDFLLIIRDRWLLAIALSLPCALFWVFYK-QQEP
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      -------DGTSSHVPSGAPGPKLKGVIEYLLIIRDRWLLAIALSLPISLWYVYDR-YQEP
A0A3D4HHL8      -------RYDDVEPKIEWSELIHVWLFRAKLLLKRFWWVFLITISLGVAFQTYDV-LITP
A0A366HV03      ------------MSAPIKKGAPGVDMLHYAVGYLKYGRMMILLLLLGVLAGVCYY-TYSP
A0A6G6K911      -------------------------MLHYAVGYLKYGRMMILLLLLGVLAGVCYY-VYSP
A0A5R8KAF2      ------------MDTTKKKFDFAAAVGNALSYAQHGRLMVIMACLGVLAGLCYFV-YTT-
A0A7C4LRZ6      -------TVVSFDTPLMDRINIYFRFRRYFKMLARRWFIVLLTTGAAGGYAFHLA-MKQP
A0A2V2SDN0      -------DLMAPPDHFVATSRLFVRLHRHQVLLREYWWVLALILLVTVVPALVIT-LATP
A0A1V6GL40      --------VQSFHDRPNTAARLHARLSRFRNLLREKWWVLVLGAMAGAIIKIVLL-WNAP
A0A2V5X6Z6      -------DLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSL
A0A2V5VGZ7      -------DLFAPANRFVSASRLYGRLHRWWLLLRRYWWLIVLILVLGLGPAGFLS-FNSP
A0A2V5U130      -------DLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGVLS-FNSL
A0A2V6C237      -------DLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSL
A0A3R8L982      --------------SGDDDLVERRTLRDYYIIVRERLWIALPLALLAALGYAYYK-SREL
A0A6N6QBS9      -------PLPGYGTSMVDRINLYLHFRRYFKILAERWLLVVVCTVTGLGIGTWQA-MSKP
A0A2E7HPU9      ------------------------RTRQLIGDILVRWHWMALGLVLGLLGSFYYL-SKAP
A0A388PR45      -------GNYGNYAAGGASGGKGGPFTVYLAMLRERWWWVLLSVLVFVTIAVVYT-STII
A0A388QR61      -------GAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIV
A0A4P5YHI0      -------GAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIV
A0A2A2RS01      -------GQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTM
A0A2A2Y1A7      -------GQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTM
A0A388PDH9      -------GQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLLGVTIALVLT-YQTM
A0A2G4H1E7      -------GSYGGGPRGGAGG--ASPISNYLLMLRERYWWVLLTSLVFLTLSLLNT-YNTV
A0A2G4GZA6      -------GNYGAYNRGGAGE--GNPIQNYLLMLRERYWWILLSTLVFLTLSLLNT-YNTV
A0A388P514      -------GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
A0A2A2YG59      -------GNYGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
A0A2G4F7D5      -------GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
D5EML0          -------GKDDFTIEANASTTSVFGLTDLLAVVRKHWMSGAFIGLVVAGLFVASV-LTKE
A0A7C4PPJ4      -------GVDSFDTPLMDRINLYFRLRRYIKMLARRWFILLLTVAVGVGIAAHRA-YSLP
A0A3C1C1M3      -------PMRLL------------------QIARNHWVILLLA--ILFAGGAAAF-YLSR
A0A2E9EYJ1      -------ALDYW------------------QVAXNRYAVILLTXALVXMTALVIA-YLRP
A0A258AXR6      -------AMDTW------------------QVVKNRFGLIALSFLLIFAAAAVLT-YIMP
A0A3D3NZQ6      -------ALDSW------------------RVIRGRAGLIILSFLLVFGSAAMLT-YIMP
A0A1T4WVZ9      -------ALDSW------------------QVIRNRFGLIILSFLLVFATAAIIT-YIMP
A0A4R7SSI6      -------AIDSW------------------QVIRNRFGLIILSFLLVFATAAIIT-YIMP
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ----------------------------IVLQALKQAQADLDKARSDAAAARKLDEEVER
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      -----------------------------------------------DLEDLESVGYVDA
A0A2S7U0Z3      PSSEAIAVLEVNIQTGQ-----------LLGQDLVQERMTPDIILATEASKLMGPAILSA
A0A5E6MKA7      -----MGSLKVEP-----------------------------------------------
A0A6B3L936      PETMAMASLKVTTKQQLL----------VGNEVEQDSMVFRDQMLGTIAAELVGLEQLQK
A0A2N8IR72      ----------------------------------------MTDAWNGKAVIVRHSPVLET
A0A2N8IV96      ---------------------------------MVATSNVTANYIPMQYSVLTSAEVLKV
R7E1V8          ---------------------------------MVASSNVTANYIPMQYSVLTSTEVLKV
A0A2E0R252      VTYQSQATIEIERVKKED----------ADVDEEERIRMGGASEMFSVTEKLRLPNLYTN
A0A3E1EF48      KTYQSWTSIQIARVKQEA----------ADVAEEERIRLGVPAELQATLEKLRMPRIYQN
A0A2A2PVG8      PTYQSSATIEILRVKRDA----------ADIAEEEKIRMTGAAEMLSASERIRLPQIYVE
A0A2E0R421      HTYQSSATIEVLRIKKDD----------ADVDEDEVLRMNGVAEMMSASEKLRMPALYTQ
A0A2E5EJ69      VIYESRATIIVEFAGPTVS---------YDQNSRNDFRLMRFDILNTMAQTVGRREVIDR
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      QIYMSQARMMVSGK--------------INLPEGGSFSEEMTHFMNTQGELMKDEAIRTR
A0A1T4WWY4      ATYESQALIRANSFLMS-----------SEAAVGNANADRTYRQMRALMDQLNSGYVILE
A0A3D3LEQ6      ATFESTALIRINQFVDA-----------AKAASG-AQRDNNIALMRSLSKQLTSDFYQLE
A0A3D3NW23      ATFESTALIRINQFVDA-----------AKAASG-AQRDNNIALMRSLSKQLTSDFYQLE
A0A2E7ALI1      ASYLPDWITGFLNRGK------------RALPETGSNTSNHQKKLVSLLKNRCEVTV---
A0A178IDB9      PVYRSEVKLLFEPQKDQV----------IGIKEVVDTTTTSNLQLNLHIEQMLSTTFYEY
A0A290QD69      PIYKTEVKLLFENQKDNV----------IGMAGVVETTTNSGMQLQLHIEQMLSRTFYES
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      TFFQGKSIIGITSKIR------------IPGEKRVEYLKPAPTYWTDLSRSMDSDTVWSR
A0A178IFJ2      KVFQASATLLVDRAEKVLGNEM------TKVVDDSVGGSKNDPSFDTHLAQITSREMVQR
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      VVYQSKAVIELDFGEKKVL---------AIDDFEKRDKGGGVDFLNTIANNVRSSAIIKR
A0A1H2DTI1      PNYASTARLMINTK--------------INVTESSVSTTEVGNYMETQIALMTSQKVYTA
A0A1H1MGC9      PQYQSVASVQVFRRDPVV----------MQVQGVVDNEIRSAEDLNTQVKVLESFAIVQR
A0A1V5L462      DAWESSAQLIIQGN--------------IEIQEADRLREVATNFHDNQLHLMTGQWVSER
A0A3D3LGD3      DNFMANSDVVVKNEFE------------SIIKPETLYPVVDKLDLQLKWELPTRQAALGK
A0A350ARX4      PVYVSYAEMMVSG---------------RFALPDNVYREELSNFFGTQITLMLSDRVQKQ
B5JIS2          PEHTAVSTMLAQSPLDELLH--------SDQQARERKKDAQENFLQNHLSVMKSRRFSVE
A0A6N6ZC77      PTYRWGAKIMLSGF--------------VAQQLNTGVQEQFSYWFGNQRAFLESSDVRKA
A0A7C5H7K5      PKYVSEGRMIVNVK--------------LTIPEGSAYSEELGNFLGTQAALMESPRVIQR
A0A538NJ59      PTYVSKSRMWETVT--------------LRLPEGAMFSEDMQNFLGTQSELLESGQLRQL
A0A2A2R3V9      PTYISSGKLIVSPR--------------MFLPENAVVSDESVNFIGTQLELMQSAEVRSR
A0A3C1VFY9      PEFISVGQMIVSIK--------------VNIQQGSLYTEELGNFLGTQAALMQGNEVLNR
A0A2V2SMX4      PSYVSTGRMIVSMK--------------LSIPEGQLYTEEMGNFLGTQAALMQSDVVIHR
A0A522AC27      QRFISIGRMIVSIK--------------LSIQETSVYTEELSNFLGTQQALMQSPVVVQR
A0A6M1RFD0      PAYASRGKMIVNVR--------------IQVQTGANYIEELSNFLGTQVALMQSDTVLNR
A0A7C3HXH0      PAYASQGRMIVNVK--------------IQVQTGANYIEEFSNFLGTQVALMQSATVLNR
A0A1H2GQN6      KQYGGTVDIRVFKQDKD-----------VQVFSQSDRNAFDPIFFESERSTIESKEILYP
A0A512M3Y3      PTYYSRSLVAYDSVNLPIK---------SETSDGSDGRGKWAHISNVLTSALNSRWLVEH
A0A4P5R5J1      PAFRSSGRMMVAGQL-------------RLGDNAAAYSEELMNFFGTQIELMQSAAVLKG
A0A4P5YK43      NKYRAYSTLGFTSRVE------------TGVGGKAQVVELADGFVEHQLVLMKSPRVRNK
A0A2A2RPW6      VVYQSKAVLYFDSGEVNV----------INIQEVEKREKAGIDLLNSIANNLKSSVILSR
B1ZT68          PLYYSEVSLLFETRKDRV----------LNIQDVVDTGVRSTTELNVHAEQLRSQTFFEY
W0J7C2          PIYRTEVSLLFEARKDRV----------LNIQEVVDTTLQTAAELNTHIEQLRSKTFADY
B4D1I7          VVYVSTGRIMASGK--------------INLPEGVTYTEEMNLFISTQRELMQDEAVRQR
A0A353F286      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A354FSA6      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A3B9GA54      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A520LEH8      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A6B2M0T8      PLYKSVAILLFELQQDKVIN--------IQQVVDNSLGRSADFILRNHLTDLRSNSFRNR
A0A2D7B7R6      AHYRSTALLVVDTQQF------------VESDADASNDVRDLDILTTLVGRISTTPVLSH
A0A2E5K4P7      KEYKSVAELRMERFGNTPI---------DTGNEKNQDNIGSHEDFNTWANILKSPTITSM
A0A2V6F9Q9      ---------------------------------------------------MQSAEVRRG
A0A2V6NZZ3      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6EBU2      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6EY06      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6ME53      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A538NUU0      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6NIJ1      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6C292      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6D2X0      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V5ZUK1      PQYQSTSKMMLAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVKHS
A0A2V5XFN9      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A2V6EZC8      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A2V6I7Z5      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A3B9LCP2      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A3C0R669      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2V6EID2      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2V6MHB0      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2W5YWL9      PSFLSTSKMMLAGK--------------LNVNSSAVYSEDNVNFYGTQIQLMQSTEVRRG
A0A2V5NH62      PSFESRSKMMLAGK--------------LNISQSAVYSEDSVNFYGTQIQLMQSQEVRKS
A0A2W6A620      PLFQSMSKMMLAGK--------------MNISQSAVYSEDSVNFYGTQIQLMQSAEVRRS
A0A2V5PIJ4      PSFLSRSKMMLAGK--------------LNISQNAVYSEDSSNFYGTQIQLMQSDQVKQG
A0A2V6K2G8      PSYQSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVRHS
A0A2V5W206      PSYLSASKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVRHS
A0A2V6MW77      PSYLSASKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKHS
A0A6N4WVA3      PFYLSKAQMIVSGR--------------IDLPENDVYAEERDNFFGTQIELMLSEQVQVR
A0A0R2XPB1      PFYKSTSQMIVSGR--------------IALPENDMYAEERDNFIGTQIELMLSDQVQAR
A0A348NQP1      -----------------------------------MYAEERDNFIGTQIELMLSDQVQAR
A0A357FV58      PFYKSTAQMIVSGR--------------IALPENDMYAEERDNFIGTQIELMLSDQVQAR
A0A2G4GZN8      PEYRATGRLRVFRLSPNINGG--------SSAADDNFKIVSNDDFFTAIEAMRSANIIEG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      KLYTAYSTIELLRDDPTVMLS--------SSGNLEQNEIRTAEDLNTHISKLESITVIQG
A0A2D7F4D9      KLYTAYATIELLRDDPTVM-N--------SASNLEQNEIRSSEDLNTHISRLESVSIIQG
A0A3R7RBR8      KLYTAYATIELLRDDPTVM-N--------SASNLEQNEIRSSEDLNTHISRLESVSIIQG
A0A2E0NH28      KVYTAYVSVQLLRDDPSAMR---------DETEMEPNQILSAEDLNTQISVLESLSIIQA
A0A350AS32      KVYTAVAQVQLLRDDPSAMGNI-------PGMEMEPNQIRSAEDLNTQISVLESASIIVG
A0A368BGT4      KVYTAVSQVQLFRDDASALGAY------GQGAEMELNQILGAEDFNTQIIVFESLNIMQG
A0A6N6PLV8      RQYLSKVRMEVKQDNSGP----------VSAFGGNTGKTFDPQFVATQFQILQTTEILYP
A0A2E0V4K6      ERFASTATLLVKQNLSGV----------ISSEEVEDLDLRSDNVMNTIAAQVTRVGILEK
A0A290QE54      PMYQARATMQIEKPEKI-----------VTSQEIVDISINSDIELNTYLQVLGSAKLRGK
A0A1H1SWX2      PMYSSTATMQFERPERV-----------VQNEQVVDTAVRSEVDLGTYLQILQSGRLRTM
A0A1D8AZK8      PMYSSVATMQFERPERV-----------VQNEQVVDTSVRSDVDLNTYIQILTSGRLRTM
A0A4Q1C9I5      KMYASTATMQFERPERV-----------VLNEQVVDTSIRHDVDLNTYLQILTSGKLRQM
A0A2E6NAH3      KVYTAASQVQLFRDDASALGAI------GQGMEMEQNQILSAEDLNTQISVMESLSIIQG
A0A2A5VZA5      KVYTSVAVVRLLRDDPSAMGV---------SVELAQNQIVGAEDLNTQISLLQSGKIIQG
A0A424R295      KVYTSVAVVRLLRDDPSAMGV---------SVELAQNQIVGAEDLNTQISLLQSGKIIQG
B4CZV9          PVYYAHALIHLE----------------YLARPLDTDKLYEDGRLSAFVAQFTEPQIMLR
A0A1G3ZL71      PMYESRATLQFEREERV-----------MNQQKVVELAPQSEVDINTYVHQLNSGTLRSR
A0A556QP09      PLYRSAATLQIEKPEKV-----------VTTVDVVDTGINSDIELNTYLQVIASAKMRNR
A0A2T6DX88      PLYQSQATMQIEKPEKI-----------VTSQEVVDLSVTNDIDLNTYLQVLNSTKLRTK
A0A2T6CWI7      PRYAATARMQFEKPDRI-----------VMAEGVVDTAVRSEVDMNTHTEVLKSSSLREE
A0A3E1E5C8      KMYAATATMQFEKADTV-----------VTTQGVVDPSVRSELELRSNLEKLNSQRLRTK
B1ZZ74          PLYAAMATMQFEKPETV-----------VTSQVVVDPSVRSDIELNTNIQVLNSARMRSR
A0A3B9FM17      -------------------------------------ESHLEGLISRHTEGLNSEKLRIN
A0A0E3YV65      KVYQSRSRLLVDRSERVV--DI------AQVVDQSVGGGKNDAMFDTYLAQITSPAMIVR
W0J900          KVFQASATLLVGRIEKVLGNEI------TNVVDDSVGGSKNDPAFDTHLAQITSREMIQR
R7E4L8          YLYQKTARIMLRDDKQKNAQV-------SEIILSDLGFKPGEANLANESYVVKSSEVMSR
A0A4Q3BVY2      PSYSSTALVTMHSFGA------------PMVDREVAETQQVSSFHRNFLNRLRSAPIQLA
A0A4P6PCA7      PVYQAKAEIEMSVQRPQFIQT-------EVNLEEGGGTLSEDVIFNTRFAKFRSPAMEEI
A0A2T6DSN5      PVYWTEVQLLFEPKEKKV----------LNITEVVDTTTSSSLDLHTHLARLRSETFLDY
A0A317ZIW7      PNYRSNAQMMLSGRISLPE---------NELYAEERANF-----FGTQIELMESSQVKSR
A0A7C4PPT4      PVYMAKSLIRYQ----------------ALERPVDAEKVFRDSSERELITRLTADHIIRR
A0A7C4QZX4      PIYSSKSLVRYL----------------SLARPLDAENVLMEQTDRVLLTRLTSPKIMQR
A0A2D7WMI4      EFYASSSSFRLIPPPAII----------N-LQKVD-REQQLQPLVSKHLDGLNSQELRAQ
A0A2D6VHX5      EMYQSSSSFVLIPPPKIL----------N-LQKVD-RDQQVNGLISKHLDGLNSQELRMN
A0A2D8I214      EFFQSSSSFRLIPPPAVL----------N-LQKVD-RDTQVQGLVAKHREGLNSQELKAS
A0A1Z8VL41      EFFRSESSFRLXPPPXII----------N-LQKVD-RXSXINTLXSRHLDGINSQXLRVN
A0A2E6TNA4      EFFRSESSFRLIPPVEVI----------N-LQKVD-RSSQINTLISRHLDGINSQELRVN
A0A1Z8RG47      EFYKSSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A1Z8RJJ5      EFYKSSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A2D7V631      EYYASSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A354RA24      EYYASSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRAN
A0A2E9RV62      SIYQSSSSFRLIPPPAIL----------N-LQPVE-QANQLVDLVRKHTEGLNSQELRAR
A0A2E4AY96      EFFSSSSSFRLIPPPAII----------N-LQKVDQQEQQFQLLVGKHRDGLNSQELRMQ
A0A3B9B9P4      EFFSSSSSFRLIPPPAII----------N-LQKVDQQEQQFQLLVGKHRDGLNSQELRMQ
A0A2D5Y6N6      ELFRSSASFRLIPPPAIL----------N-LQKVD-RDQHVQGLVAXHLDGLNSQDLRLN
A0A2E7HSS8      EYYRSSSSFSLIPPPAIL----------N-LRSVD-RDQHVEGLIAKHTEGLNSQQLRTN
A0A2D8VCK3      DKFQSSCSFSLTPPPAIL----------N-LQSVE-RESHLEGLISRHTEGLNSEKLRIN
A0A350QVY4      DKFASSCSFSLTPPPAIL----------N-LQSVE-RESHLEGLISRHTEGLNSEKLRIN
A0A2E4ZYR7      ------------------------------MQPVD-RDKYSARIIGQHLEGLRSGELRNR
A0A2E6TCV1      ELFRSSATFVIQPPLSII----------DNMQPIE-RDKYSARIVGDHLHRLKEKELRQR
A0A3D4HHL8      PSYVSYSQMIVSGRIALPE---------GAIYSEELSNF-----FGTQMSLMQSHRVKER
A0A366HV03      AVYHSRSLIDYKFFA-------------LPVAADGVDGSSVARAVRSVQGQLSSRQMIAW
A0A6G6K911      AVYQSRSLIDYKFFA-------------LPVAADGVDGSTAVRAVRSVQSQLSSRQMIAW
A0A5R8KAF2      PLYSSNAVIYFRVFGSPL----------SDKGMGDSAGSQTSALKYLPWELASDSNVLAA
A0A7C4LRZ6      PVYQAISKIGIDSKVV------------TPYDQKAAVVVDLSSFYDTHLQYMQSSKVRAR
A0A2V2SDN0      PAYQSDARMWLTGKLDLSE---------GRLYTEELVNF-----LGTQADLLRSRVIQER
A0A1V6GL40      PSYVSVGRMIVSMKLAIQP---------ASLYSEELSNF-----LGTQAALMQCGVVVNR
A0A2V5X6Z6      PAYESKARMWLTGRLDIYE---------GRLYTEELINF-----LGTQTELLRSPAIQGR
A0A2V5VGZ7      PAYESKARMWLTGKLDIYE---------GRLYTEELINF-----LGTQAELLRSPAIQGR
A0A2V5U130      PAYESKARMWLTGRLDIYE---------GRLYTEELINF-----LGTQAELLRSPAIQGR
A0A2V6C237      PAYESKARMWLTGRLDIYE---------GRLYTEELINF-----LGTQTELLRSPAIQGR
A0A3R8L982      PMYQSTATMQIEKPERVVTS-----------QEVVDTAVSSDADLNTYLQIIGSQKLRDK
A0A6N6QBS9      DIFQARSVLAVPPKVKMSGGM-------QGAQIDEDARV-----TETQIAMMKGGAVITR
A0A2E7HPU9      KLYEATSTLLVKDSARAAFE--------GQRQDNADINLRSQEALGTIVEQIKNFELFEK
A0A388PR45      PEYRAAGRLRVYRLTPTIGT--------GNTGVDETQRIGSNDDFLTAIESMKSTAVIEG
A0A388QR61      PEYRAAGRLRVYRLTPNLGN--------NNSAVEEAQRIGSNDDFLTAIESMKSSTVIEG
A0A4P5YHI0      PEYRAAGRLRVYRLTPNLGN--------NNSAVEEAQRIGSNDDFLTAIESMKSSTVIEG
A0A2A2RS01      PEYRAVGKLRVFRMAPDVTA--------NNTAANNNFNITTNDDFYTAVESMRSTGIIES
A0A2A2Y1A7      PEYRAVGKLRVFRMAPDVTA--------NNTAANNNFNITTNDDFYTAVESMRSTGIIES
A0A388PDH9      PEYRAIGKLRVFRMAPDVTV--------NNTTANNNFNITTNDDFFTAVESMRSTSIIES
A0A2G4H1E7      PEFQATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEEMRSANIIES
A0A2G4GZA6      PEYRATGRLRVFRLTPTING--------GSSAADDNFRIGSNDDFFTAVEAMRSANIIEG
A0A388P514      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
A0A2A2YG59      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
A0A2G4F7D5      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
D5EML0          KLYQASASMTVELTTANVMDIREV----MDTNVAHVNLL--NTLMNTHLERIKTRAIADA
A0A7C4PPJ4      KIYRAISKIGIA--SRVVTPFDN-----KAAVLVDINSF-----YDTHLQYLQSTKVRER
A0A3C1C1M3      ATEIYQAEARIELSTRRPRIVNKQDAMIEDRGYGDAEEI-----LNTQIQKFNSPSILPF
A0A2E9EYJ1      SEXLGRVQIXVQREARDIEVFRXT----GSVGXXGSDQLPYMTXMQTQFEIXQSRETXKE
A0A258AXR6      RKYRGHVEMTIERITQDINVFDRN----RGDSLAFTQEY-----IKTQFETITKPTTLYP
A0A3D3NZQ6      RKYRGRVEMKIERLQDKVQVFERS----SDNFMANSDVV-----VKNEFESITKPETLYP
A0A1T4WVZ9      RKYRGRVEMKIERLQNKVQVFQRN----TDDFMAPTDVV-----IKNEFESITKPETLYP
A0A4R7SSI6      RKYRGLVEMKIERMQNKVQVFQRS----TDDFMAPSDVV-----IKNEFESITKPETLYP
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      LL----------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      AS----------------------------------------------------------
A0A2S7U0Z3      TAQSPEVRALRNAIPPEFSFKP------------------------------RYMRTEEE
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      VMQRPEVQVLEKVIPPQFSWKP------------------------------KYWRDESQ
A0A2N8IR72      AN----------------------------------------------------------
A0A2N8IV96      VS--------RKLNLAAEWGMTD-------------------------------------
R7E1V8          VS--------RKLNLAAEWGMTD-------------------------------------
A0A2E0R252      IAASPKFAEREDVA--SEKFHMPWE---------DVPSVSGADMSPET--LGGMMRGWVT
A0A3E1EF48      VASNPLFANRPEVVPLSRRYVLPWEPFLAKKPNPEEKPAPGTKQGPAAGDLAGMMAGWVS
A0A2A2PVG8      AAKGQLFANRENIA--PAKKRFPWT---------KQMRFAGEDLSPEM--LGAMLKGWVT
A0A2E0R421      VAKSYLFENRDDVF--PDRFHLPWE---------KRQNPTREDISDVS--LGNMMRGWVS
A0A2E5EJ69      AA--------------------------------------------------ELIVDREQ
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      AE--------------------------------------------------AYVRTTAA
A0A1T4WWY4      AA--------------------------------------------------RAIGVAGP
A0A3D3LEQ6      AA--------------------------------------------------KKLGVATA
A0A3D3NW23      AA--------------------------------------------------KKLGVATA
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      VQ--------SSFSSAEIEQIQ-----------------------------APYRNPDNP
A0A290QD69      VQ--------SSFTPKEIEQIQ-----------------------------NAYRNPDSP
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      TL--------EQVKEDH-------------------------------------------
A0A178IFJ2      VV--------ASFTPEEKTRVLAAW---------LDKDDPPLSASQMDGRLSGLITSGVG
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      VVVGQSLTNHPYFTGGSNAPSE--------------------------------------
A0A1H2DTI1      AI--------------------------------------------------NALKAKNP
A0A1H1MGC9      VA--------DRLTGEDLKAFL-----------------------------APYQKSAAS
A0A1V5L462      AS--------------------------------------------------ERVRALHP
A0A3D3LGD3      LR--------SNLDTQS-------------------------------------------
A0A350ARX4      AK--------------------------------------------------DRVLMLYP
B5JIS2          LA--------SEFTEDEKASIV-----------------------------RAFVKGDGV
A0A6N6ZC77      AR--------------------------------------------------ERVAAFYP
A0A7C5H7K5      AF------------------------------------------------DHAVAQTGIN
A0A538NJ59      AL--------------------------------------------------ARLSAPRT
A0A2A2R3V9      AR--------------------------------------------------ARVQALKP
A0A3C1VFY9      AR--------------------------------------------------ERVASQNP
A0A2V2SMX4      AH--------------------------------------------------LLVIAQNP
A0A522AC27      AH--------------------------------------------------ARAVAQRP
A0A6M1RFD0      AA--------------------------------------------------ERVHAGRP
A0A7C3HXH0      AA--------------------------------------------------DRVHATRP
A0A1H2GQN6      VI--------KKLNLVEKWSQR-------------------------------YLHGERL
A0A512M3Y3      TA--------------------------------------------------KTLGLVET
A0A4P5R5J1      AE--------------------------------------------------TRVHALHP
A0A4P5YK43      AQ--------------------------------------------------EYMREIDA
A0A2A2RPW6      VVKANKLTNHVYFTQGTNAISE--------------------------------------
B1ZT68          VL--------TSFNKEEAERIQ-----------------------------RPYRDPTQP
W0J7C2          VL--------ASFSTAEAELIR-----------------------------KAYADPLDP
B4D1I7          AA--------------------------------------------------NLVRSNNP
A0A353F286      AA----------------------------------------------------------
A0A354FSA6      AA----------------------------------------------------------
A0A3B9GA54      AA----------------------------------------------------------
A0A520LEH8      AA----------------------------------------------------------
A0A6B2M0T8      VV--------DSLTTEEVNLITKDY---------RDND----------------------
A0A2D7B7R6      VI------------------------------------------EISPELQEHYKVDLND
A0A2E5K4P7      VE--------TRLKASEVDYNN---------------------------FMEPYQKMDKN
A0A2V6F9Q9      AA--------------------------------------------------ELVWSTHP
A0A2V6NZZ3      AA--------------------------------------------------ALVRSTNP
A0A2V6EBU2      AA--------------------------------------------------ALVRSTNP
A0A2V6EY06      AA--------------------------------------------------ALVRSTNP
A0A2V6ME53      AA--------------------------------------------------ALVRSTNP
A0A538NUU0      AA--------------------------------------------------ALVRSTNP
A0A2V6NIJ1      AA--------------------------------------------------GLVRSTNP
A0A2V6C292      AV--------------------------------------------------GLVRSTNP
A0A2V6D2X0      AV--------------------------------------------------GLVRSTNP
A0A2V5ZUK1      AE--------------------------------------------------ALVRSSHP
A0A2V5XFN9      AE--------------------------------------------------SLVRSAHP
A0A2V6EZC8      AE--------------------------------------------------SLVRSAHP
A0A2V6I7Z5      AE--------------------------------------------------SLVRSAHP
A0A3B9LCP2      AE--------------------------------------------------ALVRSTHP
A0A3C0R669      AE--------------------------------------------------ALVRSTHP
A0A2V6EID2      AE--------------------------------------------------ALVRSTHP
A0A2V6MHB0      AE--------------------------------------------------ALVRSTHP
A0A2W5YWL9      AE--------------------------------------------------ALVRSTHP
A0A2V5NH62      AE--------------------------------------------------QLVRSTHP
A0A2W6A620      AE--------------------------------------------------ALVRSTHP
A0A2V5PIJ4      AE--------------------------------------------------GLVHSTHP
A0A2V6K2G8      AE--------------------------------------------------SLVRSAHP
A0A2V5W206      AE--------------------------------------------------SLVRSAHP
A0A2V6MW77      AE--------------------------------------------------SLVRSAHP
A0A6N4WVA3      AV--------ERIRLSNPELDA--------------------------------------
A0A0R2XPB1      AV--------ERIRLMDPDLHD--------------------------------------
A0A348NQP1      AV--------ERIRLLNSDLHD--------------------------------------
A0A357FV58      AV--------ERIRLLNSDLHD--------------------------------------
A0A2G4GZN8      VS--------KRLTVAERKQVL-----------------------------EPYQGGNIF
A0A348NPT1      ------------------ERFM-----------------------------APYADALSF
A0A2E1KV60      VE--------KRLQEDEFAQFM-----------------------------APYKGVFSF
A0A2D7F4D9      VE--------KRFQEDELAQFM-----------------------------APYKGTFSF
A0A3R7RBR8      VE--------KRFQEDELAQFM-----------------------------APYKGTFSF
A0A2E0NH28      VE--------RRLQDEERARFM-----------------------------APYADAFSL
A0A350AS32      VE--------QRIQDDVRERFM-----------------------------APYSDALSL
A0A368BGT4      VE--------KRLQDEMRERFM-----------------------------APYMDTLSF
A0A6N6PLV8      VI--------ERLELVKEFSPA--------------------------------------
A0A2E0V4K6      VA--------QRPEFAGSEDLVRKP---------ASYMPDWASAFFAREGARESNSEPDT
A0A290QE54      VI--------QSLTPAEVKMLQ-----------------------------QPFLATLEP
A0A1H1SWX2      VA--------QSLTPDEIRLLQ-----------------------------RPYLKDLAP
A0A1D8AZK8      VS--------QSLTPEEIKILQ-----------------------------RPYLKDLAP
A0A4Q1C9I5      VA--------QSLTAEEVRILQ-----------------------------RPYLGELAP
A0A2E6NAH3      VE--------QRLQDELRLRFM-----------------------------APYEDTLSL
A0A2A5VZA5      VN--------RRMSDEQRKRFL-----------------------------LPYEGAFSF
A0A424R295      VN--------RRMSDEQRKRFL-----------------------------LPYEGAFSF
B4CZV9          TA--------RALGIDTNSRDL--------------------------------------
A0A1G3ZL71      VY--------DSFTPEEKAILQ-----------------------------RSFLKDLPP
A0A556QP09      VQ--------ESLTPQERQVLQ-----------------------------RPYIKDLAP
A0A2T6DX88      VM--------ESFTPEEVKVIQ-----------------------------RAYLKNLKP
A0A2T6CWI7      VV--------ASFSADEIKVLQ-----------------------------RAALKRLPP
A0A3E1E5C8      VV--------ESFTPDEVKILQ-----------------------------RPYLKNLPP
B1ZZ74          VV--------ESFTPEEVQILQ-----------------------------RPYLANLAP
A0A3B9FM17      VA--------HQLDNNPQYKSV---------------------------LLGPFLK----
A0A0E3YV65      VV--------DSLSETEKLSAWRPY---------AEQDAPPPAAPVLRDTLLQIIG----
W0J900          VV--------ASFKPEEKARILAPW---------LDKDAPPLSDSQTDARLASLIA----
R7E4L8          VV--------KGLGLDVSYWEK--------------RNIREVDLYHTTPLKAEFSEEVAF
A0A4Q3BVY2      AA--------KRMGL---------------------------------------------
A0A4P6PCA7      AA----EVYFSKYSKKEYEERT--------------------------------------
A0A2T6DSN5      VQ--------QSFSPKEIEMIQ-----------------------------NPYRDPQNA
A0A317ZIW7      AI--------ERVKLTEPEVYE--------------------------------------
A0A7C4PPT4      TA--------RRLGLPDNPKIL--------------------------------------
A0A7C4QZX4      TA--------RRLGLPEDPKAL--------------------------------------
A0A2D7WMI4      VV--------TKIENSPELKTE---------------------------ILAPYIQ----
A0A2D6VHX5      VI--------ARINENSDYKTE---------------------------LLAPYLS----
A0A2D8I214      VI--------QKISDNPESKSI---------------------------MLAPFLR----
A0A1Z8VL41      VV--------QKISENPEXKSI---------------------------XLAPFLX----
A0A2E6TNA4      VV--------QKISENPEYKSI---------------------------LLAPFLQ----
A0A1Z8RG47      VI--------QKVKDNPEYKSA---------------------------LLEPYLK----
A0A1Z8RJJ5      VI--------QKVKDNPEYKSA---------------------------LLEPYLK----
A0A2D7V631      VI--------QKIKDNPEFKST---------------------------LLAPYLK----
A0A354RA24      VV--------QKIKDNPEFKST---------------------------LLAPYLK----
A0A2E9RV62      VL--------EAIKDNSFKKST---------------------------MLAPYVH----
A0A2E4AY96      VI--------TKIENSPELKRE---------------------------MLKPYVE----
A0A3B9B9P4      VI--------TKIENSPELKRE---------------------------MLKPYVE----
A0A2D5Y6N6      VT--------QKIKDTPELKSE---------------------------LLSPYLK----
A0A2E7HSS8      VI--------LRLRESPEYKSV---------------------------LLAPYLK----
A0A2D8VCK3      VA--------HQLDNNPQYKSV---------------------------LLGPFLK----
A0A350QVY4      VA--------HQLDNNPQYKSV---------------------------LLGPFLK----
A0A2E4ZYR7      IV--------RAINEDDHKKAT---------------------------LLAPYVK----
A0A2E6TCV1      VV--------KAIESDKAKKSI---------------------------LLAPYVKDKKE
A0A3D4HHL8      AR--------LRVRA---------------------------------------------
A0A366HV03      TA--------HSLGVGRANASFEEL---------RSGPLRKIELG---------------
A0A6G6K911      TA--------HALGIGRANASFEEL---------RSGPLRKVELG---------------
A0A5R8KAF2      AKELGIVGPSASFEAVKSKQLRVRA---------S-------------------------
A0A7C4LRZ6      VD--------EKLRAD-----------------------------------SRLPA----
A0A2V2SDN0      ALATVEKQFSNAPPLKPVPGMA-----------------------------DFLRH----
A0A1V6GL40      AH--------ERVSAQ-KPEIG--------------------------------------
A0A2V5X6Z6      AL--------ARLRSELNPDLAVLL---------DGGGRQSELLHLAKALCKRLFA----
A0A2V5VGZ7      AL--------AKLRSERN--LAVLH---------NGGGTQSELLHKAKALCKKLIA----
A0A2V5U130      AL--------ARLRSELNPDLAVLL---------DGGGRQSELLHKPKALCKRLFA----
A0A2V6C237      AL--------ARLRSELNPDLAVLL---------DGGGRQSELLHLAKALCKRLFA----
A0A3R8L982      VA--------ESLKPDDIKILQ--------------RPYQQ-----------DAIA----
A0A6N6QBS9      VM--------QRL-----------------------------------------------
A0A2E7HPU9      IA--------KDPDVLALEGLI--------------PPSVNWWPEWSGDLLGGDGE----
A0A388PR45      VS--------RLLTPAERKLVL--------------EPYQQ----------GNVFT----
A0A388QR61      VS--------RLLTPAERKLVL--------------EPYQQ----------GNVFT----
A0A4P5YHI0      VS--------RLLTPAERKLVL--------------EPYQQ----------GNVFT----
A0A2A2RS01      VS--------RQLTIDEKKRVI--------------EPYQQ----------GNIFS----
A0A2A2Y1A7      VS--------RQLTIDEKKRVI--------------EPYQQ----------GNIFS----
A0A388PDH9      VS--------RQLTIDEKKRVI--------------EPYQQ----------GNIFS----
A0A2G4H1E7      VS--------KRLTTDERKQIL--------------EPYQN----------GNYFS----
A0A2G4GZA6      VS--------KRLTADERKLVL--------------EPYQA----------GNIFS----
A0A388P514      VS--------KRLTADERKLVL--------------APYQA----------GNIFS----
A0A2A2YG59      VS--------KRLTADERKLVL--------------LPYQG----------GNIFS----
A0A2G4F7D5      VS--------KRLTADERKLVL--------------LPYQG----------GNIFS----
D5EML0          VV--------AALSEDQIQQLV--------------DPYYD----------PAIDG----
A0A7C4PPJ4      VL--------AKIRADER------------------------------------------
A0A3C1C1M3      VV------------ASYRELY---------------------------------------
A0A2E9EYJ1      VIXNGVDXAGNXXDLKKSWGV---------------------------------------
A0A258AXR6      VI--------ETLELAKKWEL---------------------------------------
A0A3D3NZQ6      VV--------DKLDLQLKWEL---------------------------------------
A0A1T4WVZ9      VV--------DKLDLQKRWSL---------------------------------------
A0A4R7SSI6      VV--------DKLDLQKRWSM---------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      LAFKPASSVEVYELVSSFGSWITISG----------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      REFISAGDADPAEFLRLLHQRVSVEN----------------------------------
A0A2N8IR72      ----------ALLRGLTITRPD--------------------------------------
A0A2N8IV96      ----------EMAATNLAGMIKVAP-----------------------------------
R7E1V8          ----------EMAASNLAGMIKVAP-----------------------------------
A0A2E0R252      VRW---------------------------------------------------------
A0A3E1EF48      VSV---------------------------------------------------------
A0A2A2PVG8      VRW---------------------------------------------------------
A0A2E0R421      VRW---------------------------------------------------------
A0A2E5EJ69      LSP-------DISQNDLRGQLGGVSSSL--------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      EIP-------VSMVMLRVEP----------------------------------------
A0A1T4WWY4      STT-------FDGLRDDVMPVCRMA-----------------------------------
A0A3D3LEQ6      STT-------AVDLRASLIPAIRIG-----------------------------------
A0A3D3NW23      STT-------AVDLRASLIPAIRIG-----------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      SAP-------PPSLAGIIRPHINIYQ----------------------------------
A0A290QD69      TAP-------PPSLADIIRPNVRIEP----------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      ----------PPPADVEVLSKGASR-----------------------------------
A0A178IFJ2      VQR---------------------------------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      ----------QMVVSSVSGAVDARL-----------------------------------
A0A1H2DTI1      GFV-------ESDVRIDVHP----------------------------------------
A0A1H1MGC9      SP--------PSPAEIIFRERKIVP-----------------------------------
A0A1V5L462      EIQ-------KDWVSLWAGR----------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      EIT-------PSWVSLSVVQ----------------------------------------
B5JIS2          PSM-------SAFEKILAGRMDATR-----------------------------------
A0A6N6ZC77      DLQ-------PIPVSIQPMQ----------------------------------------
A0A7C5H7K5      EKE-------PPKIKVTI------------------------------------------
A0A538NJ59      NAIPLGKDGQPLPVEIRVRQ----------------------------------------
A0A2A2R3V9      NLV-------PIPVALSAYQ----------------------------------------
A0A3C1VFY9      GVT-------PKPVALQVSV----------------------------------------
A0A2V2SMX4      NFK-------PQPVSLKVTI----------------------------------------
A0A522AC27      DIV-------VQPAELSVAI----------------------------------------
A0A6M1RFD0      DLV-------PVPVKVTVGV----------------------------------------
A0A7C3HXH0      DLV-------PVPVKVSVGV----------------------------------------
A0A1H2GQN6      LRE-------DEVYGILLGRHLKVEP----------------------------------
A0A512M3Y3      PGE-------YEMIRNRYVSSIRVT-----------------------------------
A0A4P5R5J1      DLP-------VEQVKVVVGQ----------------------------------------
A0A4P5YK43      ALG-------VHPELESSVS----------------------------------------
A0A2A2RPW6      ERL-------TRQLAYVVDARL--------------------------------------
B1ZT68          DKP-------VPSLAEIIRPNLTIFA----------------------------------
W0J7C2          DAA-------PPPLDAIIRPNVTVFA----------------------------------
B4D1I7          ELT-------PCPITLFVAP----------------------------------------
A0A353F286      EKA-------QLPVQWGMDMDDVVSLLEGIVETIP-------------------------
A0A354FSA6      EKA-------QLPVQWGMDMDDVVSLLEGIVETIP-------------------------
A0A3B9GA54      EKA-------QLPVQWGMDMDAVVSLLEGIVETIP-------------------------
A0A520LEH8      EKA-------QLPVQWGMDMDDVVSLLEGIVETIP-------------------------
A0A6B2M0T8      GNN-------APSIHNIIASANKIA-----------------------------------
A0A2D7B7R6      PRS-------ITSASKKLGANITAKL----------------------------------
A0A2E5K4P7      GGR-------DEEDPIVAGPILHEKRRIIP------------------------------
A0A2V6F9Q9      DIS-------PVPIELSVAQ----------------------------------------
A0A2V6NZZ3      ELQ-------PVPVELSVAQ----------------------------------------
A0A2V6EBU2      ELQ-------PVPVELSVAQ----------------------------------------
A0A2V6EY06      ELQ-------PVPVELSVAQ----------------------------------------
A0A2V6ME53      ELQ-------PAPVELTVAQ----------------------------------------
A0A538NUU0      ELQ-------PAPVELTVAQ----------------------------------------
A0A2V6NIJ1      ELQ-------PVPVELSVAQ----------------------------------------
A0A2V6C292      ELQ-------PVPVELSVAQ----------------------------------------
A0A2V6D2X0      ELQ-------PVPVELSVAQ----------------------------------------
A0A2V5ZUK1      ELQ-------PVPVEIFVMQ----------------------------------------
A0A2V5XFN9      ELQ-------PVTVEIFVIQ----------------------------------------
A0A2V6EZC8      ELQ-------PVTVEIFVIQ----------------------------------------
A0A2V6I7Z5      ELQ-------PVTVEIFVIQ----------------------------------------
A0A3B9LCP2      EMQ-------PVPVDITVSQ----------------------------------------
A0A3C0R669      EMQ-------PVPVDITVSQ----------------------------------------
A0A2V6EID2      EMQ-------PMRVEITVVQ----------------------------------------
A0A2V6MHB0      EMQ-------PMRVEITVVQ----------------------------------------
A0A2W5YWL9      ELH-------PVPVEINVLQ----------------------------------------
A0A2V5NH62      EMQ-------PVMVEISVVQ----------------------------------------
A0A2W6A620      ELQ-------PHLVEITVTQ----------------------------------------
A0A2V5PIJ4      EMP-------TAPVEITVSQ----------------------------------------
A0A2V6K2G8      ELQ-------PVPVEIFVLQ----------------------------------------
A0A2V5W206      ELQ-------PVPVEITVLQ----------------------------------------
A0A2V6MW77      ELQ-------SVPVEITVLQ----------------------------------------
A0A6N4WVA3      ----------ALRETEAYQVNGLNS-----------------------------------
A0A0R2XPB1      ----------ALIATEAYQIDGLRA-----------------------------------
A0A348NQP1      ----------ALMVTEAYQNDGLRA-----------------------------------
A0A357FV58      ----------ALMVTKAYQIDGLRA-----------------------------------
A0A2G4GZN8      SGP-------LTEQEVFARQRGINP-----------------------------------
A0A348NPT1      TGP-------LTPTQMLAQNRKILP-----------------------------------
A0A2E1KV60      SGP-------LTAFEILAKNRKIIP-----------------------------------
A0A2D7F4D9      SGP-------LTAFEILSINRKIIP-----------------------------------
A0A3R7RBR8      SGP-------LTAFEILSINRKIIP-----------------------------------
A0A2E0NH28      TGP-------LTPVEMLAKNRKIIP-----------------------------------
A0A350AS32      SGP-------LSPTEVLGRNRKIMP-----------------------------------
A0A368BGT4      SGP-------LTPLEVLAENRKVIP-----------------------------------
A0A6N6PLV8      GQR-------LPVQSIHNRLRRAMKLQE--------------------------------
A0A2E0V4K6      GAN-------LTRVAAMLAQRCDATV----------------------------------
A0A290QE54      GQP-------PPSIHEVVGSIGVQA-----------------------------------
A0A1H1SWX2      GAN-------PPAVGGLLGSMSPLS-----------------------------------
A0A1D8AZK8      GAN-------PPPVGGLLGSMAPQS-----------------------------------
A0A4Q1C9I5      GEN-------PPPVGQLLGSMSPQS-----------------------------------
A0A2E6NAH3      SGP-------LTPLEILAKNRKIIP-----------------------------------
A0A2A5VZA5      SGP-------LTPTEILGKYRKIMP-----------------------------------
A0A424R295      SGP-------LTPTEILGKYRKIMP-----------------------------------
B4CZV9          --------------ERKYLFKFRAS-----------------------------------
A0A1G3ZL71      GAG-------PPATGDFMGQVVADA-----------------------------------
A0A556QP09      GAT-------PPT-GVDLGVMSVQS-----------------------------------
A0A2T6DX88      GDP-------LPGVGSMLGSTSVQS-----------------------------------
A0A2T6CWI7      GSP-------PTNVGIPMGELSVFP-----------------------------------
A0A3E1E5C8      GAG-------VPSAGEALGAVSIDS-----------------------------------
B1ZZ74          GAS-------PPSAGGALGGVSIDA-----------------------------------
A0A3B9FM17      QGV-------RVGIASAYSYRITQAG----------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------------------------------------
R7E4L8          QPC-------SLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLPFATVNVCPTSYFS
A0A4Q3BVY2      VGD-------GATSEDILRVIPSLV-----------------------------------
A0A4P6PCA7      SWI-------GLEDLAYWVRQVGWY-----------------------------------
A0A2T6DSN5      NAP-------VPSVRNIVRSAIQIR-----------------------------------
A0A317ZIW7      ----------SLEQKEEFLNEGLRS-----------------------------------
A0A7C4PPT4      ----------------YADHLRAVQ-----------------------------------
A0A7C4QZX4      ----------------YAEHLVRIL-----------------------------------
A0A2D7WMI4      EGA-------VTSVAAAISYSVSVS-----------------------------------
A0A2D6VHX5      DGT-------PMKIQNIVTYNVSVS-----------------------------------
A0A2D8I214      EGI-------PVGVESTISYSISVS-----------------------------------
A0A1Z8VL41      EGX-------PIGVAXTVSYSVSVT-----------------------------------
A0A2E6TNA4      AGI-------PTGVASTVSYSVGVT-----------------------------------
A0A1Z8RG47      EGI-------SMDVGATVSYGVSVS-----------------------------------
A0A1Z8RJJ5      EGI-------SMDVGATVSYGVSVS-----------------------------------
A0A2D7V631      EGI-------SMDVGATVTYSVGVS-----------------------------------
A0A354RA24      EGI-------SMDVGATVTYSVGVS-----------------------------------
A0A2E9RV62      DQQ-------LPEIASIINYSVS-------------------------------------
A0A2E4AY96      SGI-------PTSVGSTVSYSIS-------------------------------------
A0A3B9B9P4      SGI-------PTSVGSTVSYSIS-------------------------------------
A0A2D5Y6N6      DGI-------SIDVGATISYSISVS-----------------------------------
A0A2E7HSS8      DGV-------IVDLASTVSYRVD-Q-----------------------------------
A0A2D8VCK3      QGV-------RVGIASAYSYRIT-Q-----------------------------------
A0A350QVY4      QGI-------RVGIASAYSYRIT-Q-----------------------------------
A0A2E4ZYR7      QGP-------PPPVASVVNYTVS-------------------------------------
A0A2E6TCV1      QEV-------LPTVGQVVNYKID-------------------------------------
A0A3D4HHL8      ----------MQPELDPCVVRVSVS-----------------------------------
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A5R8KAF2      ------------------------------------------------------------
A0A7C4LRZ6      GIQ-------PLSAQA--------------------------------------------
A0A2V2SDN0      GSS-------VNAANAEPSELFKLK-----------------------------------
A0A1V6GL40      ------------------RHAVALN-----------------------------------
A0A2V5X6Z6      SGS-------TSSSNAPPRFPFDVK-----------------------------------
A0A2V5VGZ7      SGS-------SSSSNAPPRFPFDVK-----------------------------------
A0A2V5U130      SGS-------TSSSNAPPRFPFDVK-----------------------------------
A0A2V6C237      SGS-------TSSSNAPPRFPFDVK-----------------------------------
A0A3R8L982      SGS-------PLPGPSGLVGGINVQ-----------------------------------
A0A6N6QBS9      --------------QEGGGATNRMA-----------------------------------
A0A2E7HPU9      AAI-------EASKMETSQLARLIR-----------------------------------
A0A388PR45      G---------PLTEQEVFARQRGVN-----------------------------------
A0A388QR61      G---------PLTEQEVFGRQRAIN-----------------------------------
A0A4P5YHI0      G---------PLTEQEVFGRQRAIN-----------------------------------
A0A2A2RS01      G---------PLSEQEVFGRQRAIN-----------------------------------
A0A2A2Y1A7      G---------PLSEQEVFGRQRAIN-----------------------------------
A0A388PDH9      G---------PLSEQEVFGRQRAVT-----------------------------------
A0A2G4H1E7      G---------PLTEQEVFAKQRSIN-----------------------------------
A0A2G4GZA6      G---------PLTEQEVFAKQRGIN-----------------------------------
A0A388P514      G---------PLTDQEVFVKQRGIN-----------------------------------
A0A2A2YG59      G---------PLTEQEVFARQRGIN-----------------------------------
A0A2G4F7D5      G---------PLTEQEVFAKQRGIN-----------------------------------
D5EML0          ENK-------PDPAVLLMRRMLSVE-----------------------------------
A0A7C4PPJ4      ----------------LVGMSGPVN-----------------------------------
A0A3C1C1M3      ----------PDDPAPEEELTARLA-----------------------------------
A0A2E9EYJ1      ----------PSDEDAYRILKRKVE-----------------------------------
A0A258AXR6      ----------PNRQAALGRLRANLE-----------------------------------
A0A3D3NZQ6      ----------PTRQAALGKLRSNLD-----------------------------------
A0A1T4WVZ9      ----------PNRQSALAKLRGNLD-----------------------------------
A0A4R7SSI6      ----------PNRQAALAKLRGNLD-----------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      -------------------------------------------------------NALMI
A0A258AXL1      --------------------------------------------------------EKLA
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      --------------------------------HAATSIDAIPLVAGNPLI----------
A0A353DI77      -----------------------------------------------------------K
A0A1V6GCZ3      --------------------------------MRGTSLIEIVVYSEKPEEAARIANAIAD
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      --------------------------------RRGTSLIDVRVKHQDAEAARVIADTLLK
A0A5E6MKA7      --------------------------------IRNTRLVRIRCESRQPIVAAQVANGYAE
A0A6B3L936      --------------------------------VRGTTLIAIKVTHPDAETAKTLANAVMM
A0A2N8IR72      --------------------------------SKESSLLEMTLTSSNPQKAEDTLNHLIQ
A0A2N8IV96      --------------------------------VRATDLVDVIVSGPDPKLVQNIAKAVPE
R7E1V8          --------------------------------VRATDLVDVIVSGPDPKLVQNIAKTVPE
A0A2E0R252      --------------------------------RKDTTLIDLYASHSDPEIARDTLEGLIE
A0A3E1EF48      --------------------------------RENTNLVDIFAAHTNPEVARDVLSCLLT
A0A2A2PVG8      --------------------------------RTDTTLLDLYATHTDPAIARDSLAAVLS
A0A2E0R421      --------------------------------RPDTKLLDIHVTHTNPEVARDVLVALLS
A0A2E5EJ69      --------------------------------RKMTRFIDVSFRHRDRVFAMNANQAIVE
A0A2G4I5Z5      ----------------------------------MTRLIDVTVELGDRVLSQTLAQAVVD
A0A4P5QQV6      --------------------------------LPQTSIFALTATGEEPLYTQKFLDAILH
A0A1T4WWY4      --------------------------------ILDQSHFQILVVSYDAEVVKKMPQALVD
A0A3D3LEQ6      --------------------------------FLDQNHIQLRVISYRPRIVREFPQAMIE
A0A3D3NW23      --------------------------------FLDQSHIQLRVISYRPRIVREFPQAMIE
A0A2E7ALI1      --------------------------------RRRTRLLDVRINHEDPKVSAELADTVVD
A0A178IDB9      --------------------------------QKGTTIVRIVVTNRDPEAAALIANRFSR
A0A290QD69      --------------------------------QRSTTILRIMVWNKDPEAAALIANRFAR
A0A2E7VDS1      --------------------------------------LRITAIARNGEGAAMIANLAQD
A0A7C8D3W3      --------------------------------IGKSSSFQLTVNSNNESYAKQLAAYWVT
A0A178IFJ2      --------------------------------QGTTFLIRITCKHREPAMAALVATRFAE
A0A357FSP9      --------------------------------------------------AARVANLFAD
A0A2A2R174      --------------------------------RRMTRLIDVTVELGDRMLAQTVAQSVVD
A0A1H2DTI1      --------------------------------LGSTPILIIRAMSSDAQFAKDFLQADID
A0A1H1MGC9      --------------------------------VRLSLVLQVQYAHPDRHVAAKVANLFID
A0A1V5L462      --------------------------------KGTTDIFQLVASGGNARYTQAYLAQIIQ
A0A3D3LGD3      --------------------------------SIRSDFVIIEFFDKDPALAATIANAVAD
A0A350ARX4      --------------------------------RSQASIFQLRAQGGSAEFTQKFLDAVME
B5JIS2          --------------------------------QRDREFFTLSFRHPEAEIALMVADRMTA
A0A6N6ZC77      --------------------------------LPDTSIIQVVATGSDREYTQRYLDALLE
A0A7C5H7K5      --------------------------------VPRASVFVLQAKGRDPRFVQAFLQACME
A0A538NJ59      --------------------------------AAKSSVFELEASAADAAYVQAYLSALMI
A0A2A2R3V9      --------------------------------QPRTSIFTLQASGSEPNYTQAFLDAVME
A0A3C1VFY9      --------------------------------LPKTTIFILRATGGNPEYTKAYLQACMD
A0A2V2SMX4      --------------------------------LPKTTIFLLVGTGDDPVYTQKFLQACME
A0A522AC27      --------------------------------TPKTTIFVVRAIGHDPQYVKAFLQACME
A0A6M1RFD0      --------------------------------TPKTTVFNLRAVGSDPAYVQAYLDAVME
A0A7C3HXH0      --------------------------------TPKTTIFNLRAVGSDPAYVQAYLDAVME
A0A1H2GQN6      --------------------------------QRGSNIIQITGISEEMEEAPLLANTIAE
A0A512M3Y3      --------------------------------LVPGNILQIEIYAYQPWLVEKWPQAMLD
A0A4P5R5J1      --------------------------------LPKAAIFVMNVYAKSPAYASAYVDALMD
A0A4P5YK43      --------------------------------KGAGSLFMMTVDSTDLRYASLYVSNWAR
A0A2A2RPW6      --------------------------------RRFTRLIDVSVELGNAKLAQVIGQSVME
B1ZT68          --------------------------------RRNTTILVVGVTNRNPENAALIANRFAR
W0J7C2          --------------------------------RRGTPILGIQVSNRSPEAAALIANRHAR
B4D1I7          --------------------------------LPQTSIFNLSAIGTEPQYPQKFLDALMH
A0A353F286      --------------------------------RRGTDFIEINVRHASASDAKNIAESVAE
A0A354FSA6      --------------------------------RRGTDFIEINVRHASASDAKNIAESVAE
A0A3B9GA54      --------------------------------RRGTDFIEINVRHASASDAKNIAESVAE
A0A520LEH8      --------------------------------RRGTDFIEINVRHASASDAKNIAESVAE
A0A6B2M0T8      --------------------------------LVGGNIFKFEFHHRNPQAAALLANRFSE
A0A2D7B7R6      --------------------------------RGDSLFIDLTANSENRDLAYWSAKYVST
A0A2E5K4P7      --------------------------------KRLSLVIQIEYIHPNPEIAATVVNHFAQ
A0A2V6F9Q9      --------------------------------RPRTSIFELQAIGSSPEYTQLYLSAVMQ
A0A2V6NZZ3      --------------------------------RPRTSIFELQAIGSSPDYTQIYLNAVMQ
A0A2V6EBU2      --------------------------------RPRTSIFELQAIGSSPDYTQIYLNAVMQ
A0A2V6EY06      --------------------------------RPRTSIFELQAIGSSPDYTQIYLNAVMQ
A0A2V6ME53      --------------------------------RPRTSIFELQAIGSSPDYTQAYLNAVMQ
A0A538NUU0      --------------------------------RPRTSIFELQAIGSSPDYTQAYLNAVMQ
A0A2V6NIJ1      --------------------------------RPRTSIFELQAIGSSPDYIQAYLNAVMQ
A0A2V6C292      --------------------------------RPRTSIFELQAIGSSPDYTQAYLNAVMQ
A0A2V6D2X0      --------------------------------RPRTSIFELQAIGSSPDYTQAYLNAVMQ
A0A2V5ZUK1      --------------------------------KPRTSIFDLSAVGSSPEYTQAYLNAAMQ
A0A2V5XFN9      --------------------------------KPRTSIFDLSAIGSAPDYTQAYLNAVMQ
A0A2V6EZC8      --------------------------------KPRTSIFDLSAIGSAPDYTQAYLNAVMQ
A0A2V6I7Z5      --------------------------------KPRTSIFDLSAIGSAPDYTQAYLNAVMQ
A0A3B9LCP2      --------------------------------KPRTSIFDLQAIGRTPDYTQAYLNAAMQ
A0A3C0R669      --------------------------------KPRTSIFDLQAIGRTPDYTQAYLNAAMQ
A0A2V6EID2      --------------------------------KPRTSIFDLQAIGRTPDYTQAYLNALMQ
A0A2V6MHB0      --------------------------------KPRTSIFDLQAIGRTPDYTQAYLNALMQ
A0A2W5YWL9      --------------------------------RARTSIFELQAIGSSPDYTQAYLNAAMQ
A0A2V5NH62      --------------------------------KPRTSIFDLVAIGTTPDYTQAYLNAVMQ
A0A2W6A620      --------------------------------KPRTSIFDLVAIGSTPEYTQAYLNAVMQ
A0A2V5PIJ4      --------------------------------QSRTSIFDLRAVGAVPEYTQAYLNALMQ
A0A2V6K2G8      --------------------------------KPRTSIFDLSAIGSAPEYTQAYLNATMQ
A0A2V5W206      --------------------------------KPRTSIFDLAAVGSAPEYTQAYLNAVMQ
A0A2V6MW77      --------------------------------KPRTSIFDLAAVGSAPEYTQAYLNAIMQ
A0A6N4WVA3      -------------------------LDIEAYVKRDTSIFVLRAYTPHAEYTQAYLDAVME
A0A0R2XPB1      -------------------------LSIESNVKRDTSIFVLSAYTPHAEYTQAYLDAVME
A0A348NQP1      -------------------------LLIEADVKRDTSIFVLTAYTPHAEYTQAYLDAVME
A0A357FV58      -------------------------LSIEADVKRDTSIFVLTAYTPHAEYTQAYLDAVME
A0A2G4GZN8      --------------------------------QRQTLVINVDFTHPNRDLARQVARLFCE
A0A348NPT1      --------------------------------QRGTLMIGVGYNHPDPVMAARVANLFAD
A0A2E1KV60      --------------------------------RRMSLMVNISYTHPNPIVAAKIANLFGD
A0A2D7F4D9      --------------------------------RRMSLMVNIAYTHPNPIMAAKIANLFGD
A0A3R7RBR8      --------------------------------RRMSLMVNIAYTHPNPIMAAKIANLFGD
A0A2E0NH28      --------------------------------RRMSLMVNVGFTHPDPIIAARVANLFAD
A0A350AS32      --------------------------------KRMSLMINIAYTHPDPIIAADVANLFAK
A0A368BGT4      --------------------------------RRMSLMINLAYSHPDPLIAAEVSNLFAK
A0A6N6PLV8      --------------------------------VRMTGLIDIGIYDVKADRAANIANMIGV
A0A2E0V4K6      --------------------------------RKRTRLLDVTVTHEDPELARTLADAVVD
A0A290QE54      --------------------------------IKNSFLISITATHRSGEGAALIANRYVD
A0A1H1SWX2      --------------------------------IRNSFLITITVNNRDPEGAALLANRFVE
A0A1D8AZK8      --------------------------------VRNSFLINISVTNRDPEGAALLANRYVE
A0A4Q1C9I5      --------------------------------IRNSFLIHISVTNRDPQGAALLANRYVE
A0A2E6NAH3      --------------------------------RRMSLMVNFTYSHPDPFLAAEVANLFAK
A0A2A5VZA5      --------------------------------QRMSLMVNVAYTHPDAQIAADVANLFAQ
A0A424R295      --------------------------------QRMSLMVNVAYTXPDAQIAADVANLFAQ
B4CZV9          --------------------------------LNTEKNIDVEAWPYSADWAHRWTETMVQ
A0A1G3ZL71      --------------------------------VRGSRLIRITARHRDPAAAALVANRTYQ
A0A556QP09      --------------------------------VRSTFLINIAVSHRDPDAAAILANRYIE
A0A2T6DX88      --------------------------------VRNSFIIRIVVSHPDPEAAALIANRTVD
A0A2T6CWI7      --------------------------------IRNTYLIAVTVTHDDPDAAALVANRFVE
A0A3E1E5C8      --------------------------------TRNSLLISITVRHPDPVAAALVANQYVN
B1ZZ74          --------------------------------ARNSLLITVRVVHPDPEAAALVANRYVN
A0A3B9FM17      --------------------------------SKSRPRFIITSDARSALGAKYVADVVQK
A0A0E3YV65      -------------------------SSVSAARQGNTFFISINVLQRDPDSAALLASRFAS
W0J900          -------------------------DNVGVVRQGSTFLVRVSYKHREPAVAALVATRFTE
R7E4L8          SGSMGRTIFVERVSVKEATDGMLGRLSVTRPDSKESSLLELTLRLSHPQKAEDALNYLIE
A0A4Q3BVY2      -------------------------IR-----AMDGRTIELTVVAHDKRAVRGFAEAIVT
A0A4P6PCA7      -------------------------K------QGNANIVHVSFQSPDPEFAAQLVNVMIE
A0A2T6DSN5      -------------------------D------DKATTIVRIGAYHRDPEAAALIANRFAR
A0A317ZIW7      -------------------------LKIAAEVKDDTSIFALSAITPDRKFSQEFLDAVMA
A0A7C4PPT4      -------------------------VR-----FNSERNLEVTVLAYRGDIVRRWTETMLE
A0A7C4QZX4      -------------------------PR-----FDSDRNVEVTVIAYSKQVVNAWVPVMVE
A0A2D7WMI4      --------------------------------GEGRPVITISSNARSAQAAMIIAREVQT
A0A2D6VHX5      -------------------------SP-----SEGRPRFKINSQSRTGKGAMIIADLVQK
A0A2D8I214      -------------------------PP-----SEGRPRFVISSTSRSAKGAMLVADLVQS
A0A1Z8VL41      -------------------------PP-----SAGNPRFTISATSRSARGAQIIADTVQL
A0A2E6TNA4      -------------------------PP-----SAGNPRFTISAVSRSARGAQIIADTVQS
A0A1Z8RG47      -------------------------PP-----SEGRPRFTINSNSRSGKGAMIVADIVQS
A0A1Z8RJJ5      -------------------------PP-----SEGRPRFTINSNSRSGKGAMIVADIVQS
A0A2D7V631      -------------------------PP-----TEGRPRFTINSNSRSGKGAMIVADVVQS
A0A354RA24      -------------------------PP-----TEGRPRFTINSNSRSGKGAMIVADVVQS
A0A2E9RV62      -------------------------VG-----GEGRPVFTITATGRSPESVQLVADLVQQ
A0A2E4AY96      -------------------------LS-----EESRPRFTITSNARSAKSAMIIAREVQS
A0A3B9B9P4      -------------------------LS-----EESRPRFTITSNARSAKSAMIIAREVQS
A0A2D5Y6N6      -------------------------PP-----SEGRPRFTINSTARSGRGAQIIADVVQS
A0A2E7HSS8      -------------------------SG-----TKSRPRFIITSDSRSAKGAMIVADLVQK
A0A2D8VCK3      -------------------------AG-----SKSRPRFIITSDARSALGAKYVADVVQK
A0A350QVY4      -------------------------AG-----SKSRPRFIITSDARSALGAKFVADVVQK
A0A2E4ZYR7      -------------------------LA-----GEGTPILRINSMARNGEGAAMVANLAQD
A0A2E6TCV1      -------------------------LI-----GKGTPTLQITAEARNAEGAQLVANLVQI
A0A3D4HHL8      -------------------------Q------SPDASIFILSAVGEKPEYTQAYLNALMN
A0A366HV03      --------------------------------LLDGATMQLDVFSTNPNVVREFPQALIN
A0A6G6K911      --------------------------------LLDGATMQLDVFSTNPNVVREFPQALIN
A0A5R8KAF2      --------------------------------TMNWSHLQISVMSPDPAVVRVFAKKLIE
A0A7C4LRZ6      --------------------------------SRGVGFFLLTVQSTNFLHAQQFALHWAR
A0A2V2SDN0      -------------------------VVE----SSKSSILELHATGAEPLSTRAFLNAVMA
A0A1V6GL40      -------------------------VLV----LPKTTIFVLQATGRDRDYTQAFLQACMD
A0A2V5X6Z6      -------------------------VLE----GAKSSTLELRAIGAEPASTRAFLNCLME
A0A2V5VGZ7      -------------------------VLE----GAKSSTLALRVIGAEPASTRAFLDCLME
A0A2V5U130      -------------------------VLE----GAKSSTLELRAIGAEPASTRAFLNCLME
A0A2V6C237      -------------------------VLE----GAKSSTLELRAIGAEPASTRAFLNCLME
A0A3R8L982      -------------------------S------VARSYLISITAYNRDPDGAALIANRYVD
A0A6N6QBS9      -------------------------RPEYDALAGRGATYVMTVRGTNFDYCQKFALAWAQ
A0A2E7HPU9      -------------------------GWTEVSNRRKTRLVDVVVSHPLPEVASALADKISQ
A0A388PR45      -------------------------P------TRQTFVVNVDFTHPNRELARLVAQRFCD
A0A388QR61      -------------------------P------TRQTFVVNVEFTHPNRELARMVAQRFCD
A0A4P5YHI0      -------------------------P------TRQTFVVNVEFTHPNRELARMVAQRFCD
A0A2A2RS01      -------------------------P------LKSTFVVTVEFTHPNRDLARQVAGIFCK
A0A2A2Y1A7      -------------------------P------LKSTFVVTVEFTHPNRDLARQVAGIFCK
A0A388PDH9      -------------------------P------LKSTFVVAVEFTHPNRELARQVASIFCK
A0A2G4H1E7      -------------------------P------QRQTLVINVAFTHPTRDLSRKVAQLFCE
A0A2G4GZA6      -------------------------P------QRQTLVINIDFTHPNRDLARQVARHFCD
A0A388P514      -------------------------P------QRQTLVINVDFTHPNRDLARQVARHFCD
A0A2A2YG59      -------------------------P------QRQTLVINVDFTHPNRDLARQVARHFCD
A0A2G4F7D5      -------------------------P------QRQTLVINVDFTHPNRDLARQVARHFCD
D5EML0          -------------------------RGE----NEESQVLNIIITHQNPRIAQQVANTYVD
A0A7C4PPJ4      -------------------------ATA----TKGLGYFLITVDATNFLFAQQYAMHWAR
A0A3C1C1M3      -------------------------NRGRFAIIKRTRLVSVTFTDPDPEFAMRACAAYAA
A0A2E9EYJ1      -------------------------TQD----VRGTDLIDIEVYDTDPNLAADIANAVAD
A0A258AXR6      -------------------------TQS----MLRSDFVTIDYYDQDPQLAATIANEVAK
A0A3D3NZQ6      -------------------------TQS----SIRSDFVIIEFFDKDPALAATIANAVAD
A0A1T4WVZ9      -------------------------TQS----SVRSDFVVIEYFDQDPGVAAEIANAVYQ
A0A4R7SSI6      -------------------------TQS----SVRSDFVTIEFYDQEPGAAAEIANAVAQ
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      EYIQYKKDIRKVVSGDTLASISEQVLRLERDLKSEQENLVAFQRTNNLAI---VQQEATI
A0A258AXL1      LLAKYRSA--------------PLPVGTIVRREPNPDPFLIKTAGPNVVP---GATGEQV
A0A2E6T1E0      --LTYKRE--------------NDIISLEESQNVTLKALIQAQTDFDMAR---SAEVTAV
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      QFINIREGVNEEGKKSDLQHLLAAAKERESELETARRRAGSYTPALEAE-----------
A0A1V6GCZ3      AYKTHRQEQRAQLSRGGIKALEERFAEQEAKVKAAQERVDNLRKELNISDAMASGDGPSP
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      VYLEKEESQLIGGSDDAFKILKKEADGARLEMELAEKSLQFYVSAIKLS-----------
A0A5E6MKA7      SFINFGLDRKLEANRHARKFLAGQMDALRKKMAQSEERLADFMAEAGIAH--LSPQEKAP
A0A6B3L936      TYVEEEEARISGGTSDAFKVVSIEADEIAAEMEAAERSFQTYRAALELN-----------
A0A2N8IR72      VYNQISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEFKTKSDIVK--DADTTMSA
A0A2N8IV96      AYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLP-TSWRNGEHR
R7E1V8          AYKQDREMRENRLVETAIKSLKDVLREQEDTVNEKMMSLKKLIAESSYLP-TTWRNGENR
A0A2E0R252      EYDRSVESKVAGSSEFALDYILESSDKVKEKMLNLERALRLYKRCLELS-----------
A0A3E1EF48      EYEKLTAESIAGSEENTINYIVEKCRELQEGIFKIESSLARYQGCVDLS-----------
A0A2A2PVG8      AYEQLSESRVEGSSEYVLEYILDSSAEIKERLLDLESTLQLYQRCLELS-----------
A0A2E0R421      EYERMTESKVADSSEYALDYILENTNRIRKGILDLERAIELYNNCQDLI-----------
A0A2E5EJ69      AFVNWDIERKMGRGTNTIAIHTTAAEELKVKWLEAQEIAHQYVKSNSLAV-----GMTDM
A0A2G4I5Z5      EYIKQINEDRAGIGTNTSQFLMGEEIRIKAGLLKAEVAVQEYLKTNSSS----LIQGQNI
A0A4P5QQV6      EYIATRREMRSQKGEFAAGAIDDEIERVAAELRKEEDRLLAFQRDNKTGF---LEQEGNA
A0A1T4WWY4      AYERIRLKIRSEYRDTAVKRYADEVTEIRKKVAEQLDSRLQFEEQSALANAQIEMERLSN
A0A3D3LEQ6      AYEGARKRLRNEYRDKAIARYVDELADVRAKVTSQLDSRLKFEEESALASAQIELERLSD
A0A3D3NW23      AYEGARKRLRNEYRDKAIARYVDELADVRAKVTSQLDSRLKFEEESALASAQIELERLSD
A0A2E7ALI1      EYLKELTEENRGTKNKRSEGLVKQAEEARVGLQEATSALAIYNRAIEAHK----------
A0A178IDB9      KYIDFTVDKAMTSTNSAIIFLKNQSEEKRSEVESVERAMQDYRARHNMAA---LGEATNI
A0A290QD69      QYIQYTIDRAMTKTSSAMLLLRGQAEEKRTELQLIERQKQDFRAKHNMAA---LGENKGV
A0A2E7VDS1      EYERIHDVRKGKKHDMAITFLEEQMNKSRKLGQAIDANTRDFKRQHNLAF---IEDEKKD
A0A7C8D3W3      NFVHHKDLKTLEEFTNKQASLEKNKTKWIRNLADVQKEYDELILKHGATG---NENLVTP
A0A178IFJ2      CYIVYLMDRNASANDSAISFLRAQTEDLRKKAEASERALHAYREKSRMVS---LEESQNI
A0A357FSP9      EFINYNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEYREDNNAVS---LESQENI
A0A2A2R174      EYIKERNEVRAGVGTNTSQFLMAEETRIKEKLLLAERAAEQYLRTNSSS----LIQSQNI
A0A1H2DTI1      AYIALQHDIKVDDKDRAIKDITDELTKAEATLQTDEDDVLGFQKANNIVF---LQEQGSS
A0A1H1MGC9      EYIAYNSRLRIEDSMKAVDDLKERAEQQKKKVEELAINLQAYREKNKMVS---LDQRKDI
A0A1V5L462      AYLEFRRQTRLETSDDVMLSIGEELRELDVKIQQIQEAIRRFQQENNTIA---IKELSEK
A0A3D3LGD3      SYMTRRVEVESKQKESALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNST
A0A350ARX4      EYQTFRSEMRSETTETTLIAVTEQLYRLEEEIENQENTVVDFQKENNLIF---LKEQDSS
B5JIS2          AYLKLVQREIKETNQAAAEMLRLQAEQLQAEISELEGKQRDFRERNNVIS---LEENQDL
A0A6N6ZC77      EYINWRQQMKGETSERALLAITEQLDDIERKIQQGEDAVVEFRKRNNLIF---IQEQGDA
A0A7C5H7K5      EFINLKREMVGRTSDVTLAGMTEEVLRLEKELRQYETELAEFQKSNDIVF---LQEQGNA
A0A538NJ59      EYLQYKKDIRKVVSGDTLASISEQVLRLERDLKSEQENLVAFQRTNNLAI---VQQEATI
A0A2A2R3V9      EYISRRKETRSEKSQSALLTIKEQVDKSEKEINQVDEEMLSFQKENNVIF---MEEQGNK
A0A3C1VFY9      EYRNLKKGMTEHASDTTVAGLTDQMLRLDPEMRKVDDQVAVFLSTNDVAF---LEEASGV
A0A2V2SMX4      EYANLKAEMRTQTSDKTLSGLSEEVESLRKELKQSSVQLEAFQGSNSVVV---LDQQGNS
A0A522AC27      EYIKLKREMREKTSDTTLAGLTEEILHLQRDLKKSDEELAEFQKTNSVVL---LQEQGNN
A0A6M1RFD0      EFINLKKEMRTRSSDVTLAGITEEVARLEKELKQYEDELLQFQATNSIVF---LQEQGNV
A0A7C3HXH0      EFINLKKEMRTRSSDVTLAGITEEVARLEKELKGYEEELLQFQATNSIVF---LQEQGNV
A0A1H2GQN6      TYIGVRTKNEKDRINRGLDNVADQIEKQRTIVTDAKKKVDDMRLQLGVDIIPGTQNESQL
A0A512M3Y3      TYKTYTQQQRSRFKDNAVEEYTKDLDRLKTRIASEQNATAKFEEDNHLIEQYIANNGLES
A0A4P5R5J1      EYMAKKKEMRQTSGESAAVAIQEELVRLEKDMKLEEEEMHGFQQKNNIGF---LKEDGNS
A0A4P5YK43      AFVAYKNEVNTELIEKKFGQTRQEVKRYEQNLEKARESTLIFKKKHNIGD---IRDAGLA
A0A2A2RPW6      EFLKQNAEDRVGAGTNAGHALLASEAAIKQRLLKAEHAVAEYRRTKNIS----LQDTSDI
B1ZT68          RYIDYNLDRANSGTNSAIIFLRNQAEELRAQVEAVESSLQEFRARNNIAA---LGENQNV
W0J7C2          KYIDYNLDNASTRTNSAIVFLRNQADETRAQVEAAEKALQNYREKNNLAA---IGETQNV
B4D1I7          EYIATRREMRTEKSEDAESSIEDEISRVQADVRKEEEKLVTFQRENNVGF---LEQGGNS
A0A353F286      AYIVRRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPY----FDGGSA
A0A354FSA6      AYIVRRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPY----FDGGSA
A0A3B9GA54      AYIVRRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPY----FDGGSA
A0A520LEH8      AYIVRRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPY----FDGGSA
A0A6B2M0T8      EFNDFLVERSRKTNDSALRFLRSQSEELKLKVERSELAVQRYRQERNLVS---LEESQNL
A0A2D7B7R6      GYTNFLKVNSRSKAMGGLIQLERGRELSQKDLEDAQKALIRFQTKNRITN---LKERKEQ
A0A2E5K4P7      SFREYQLDQSLKKGISDISKLGTEIQEKEKDVLVLEAKAVNYKTQFTSLG---LDSEENI
A0A2V6F9Q9      KYLDFKRGMREGQTQTFTTGITEHLIQVEKDLRTAEDEMLEFQKENNIGF---IQEEGNS
A0A2V6NZZ3      KYLDFKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF---IQEEGNS
A0A2V6EBU2      KYLDFKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDDMLDFQKQNNIGF---IQEEGNS
A0A2V6EY06      KYLDFKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF---IQEEGNS
A0A2V6ME53      KYLDFKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF---IQEEGNS
A0A538NUU0      KYLDFKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF---IQEEGNS
A0A2V6NIJ1      KYLDFKRGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF---IQEEGNS
A0A2V6C292      KYLDFKRGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF---IQEEGNS
A0A2V6D2X0      KYLDFKRGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF---IQEEGNS
A0A2V5ZUK1      KYLDFKRGMREDRGHEITTGITEQLIQVEKDLRNSEDEMLEFQKQNNIGF---IQEDSTS
A0A2V5XFN9      KYLDFKRGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGF---IQEEGNS
A0A2V6EZC8      KYLDFKRGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGF---IQEEGNS
A0A2V6I7Z5      KYLDFKRGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGF---IQEEGNS
A0A3B9LCP2      KYLDFKKGMREGQGQTVITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGF---IQEEGNS
A0A3C0R669      KYLDFKKGMREGQGQTVITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGF---IQEEGNS
A0A2V6EID2      KYLDFKKGMREGQGQTLITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGF---IQEEGNS
A0A2V6MHB0      KYLDFKKGMREGQGQTLITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGF---IQEEGNS
A0A2W5YWL9      KYLDFKRGMRQDQTHTLTTGMTEQLIQVEKDLRAAEDEMLEFQKQNNIGF---IQEEGNS
A0A2V5NH62      KYLDFKKGMRENQGSTVTTAITEQLIQVEKDLRGAEDEMIEFQKQNNIGF---IQEEGNS
A0A2W6A620      KYVDFKKGLRENQGSTVTTAITEQLIQVEKDLRNSEDEMLDFQKQNNIGF---IQEEGNS
A0A2V5PIJ4      KYLDFKKGMREGQGHNVTTAITEQLIEVEKDLRTAEDELLEFQKQNNIGF---IQEEGNS
A0A2V6K2G8      KYLDFKRGMREDRGHEITTGITEQLIQVEKDLRNSEDEITEFQKQNNIGF---IQEEGNS
A0A2V5W206      KYLDFKRGMREDRGHEITTGITEQLIQVEKDLRNGEDEMLEFQKQNNIGF---IQEQGNS
A0A2V6MW77      KYLDFKRGMREDRGHEITTGITEQLIQVEKDLRNGEDEMLEFQKQNNIGF---IQEQGNS
A0A6N4WVA3      EYINRRVEMRSKTSERTYDAIVAQLQILEKEVDEGEDAIVEFQQRNNIVF---IQEQGSA
A0A0R2XPB1      EYINRRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVF---IQEQGAA
A0A348NQP1      EYINRRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVF---IQEQGAA
A0A357FV58      EYINRRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVF---IQEQGAA
A0A2G4GZN8      SIKKNSEDDRLMVTNPLIEKARIEIETLEDKVRRLNEQKNGLIKNQKLLS---IAKDTNT
A0A348NPT1      EFINYNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEYREDNNAVS---LESQENI
A0A2E1KV60      EYINSMLSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKNAIS---LDKQENI
A0A2D7F4D9      EYINTMLSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKKAVS---LDKQENI
A0A3R7RBR8      EYINTMLSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKKAVS---LDKQENI
A0A2E0NH28      EFIAYNLTKSVDASMDAVEDLRIRADQQRQRVEELELKLAEYREEHNAVS---LDQQENI
A0A350AS32      EFIDYNLKLNIDGSMKAVEDLRIRADQQKERVEELDMKLADYREQNNAVS---LDSQENI
A0A368BGT4      EFIDYNLRLNIDGSMKAVEDLRIRADQQKDRVEELELKLAEYREQNNAVS---LQSDENI
A0A6N6PLV8      VYVERRRADLQKNVDRGLEQLTEEVAKQREVMKKASAEAAQLRTEGNINDPNPDEQNVII
A0A2E0V4K6      EYLKELAEEDKGSADRRSAGLLGQADVARESLQEANSALAVYNRALETHA----------
A0A290QE54      QFMQDLLMNVGGKNEYAVQSLRTRAEQLRKEVEVADQRLQTYMKEQRLVS---LDSSVNI
A0A1H1SWX2      QFMRYLMENVGGKNEFAVDYLRSRAKELQQESEAAEGKLQDYRRKHNLVS---LDNSMNI
A0A1D8AZK8      QFMRYLLENVGGKNEFAVDYLKTRAEELRKESEIAEGRLQDYRRKHNLVS---LDNSINI
A0A4Q1C9I5      QFMRYLFENAGGKNEDAVNFLRSRADELRKDSETAEGRLQDYRRKHNLVS---LDNSINI
A0A2E6NAH3      EFIDYNLKLNIDGSMKAVEDLRIRADQQKNRVEELELKLAEYREQNNAVS---LQSDENI
A0A2A5VZA5      EFINYNLSENIDASMVAVEGLRIRADQQKERVEEIELKLAEYRERHNAVS---LDSQENI
A0A424R295      EFINYNLSENIDASMVAVEGLRIRADQQKERVEEIELKLAEYRERHNAVS---LDSQENI
B4CZV9          QFIAYRQERRNEEKNLIVNTYSEELKELVGRLDQQFSEKLDFQDQQDFTKTLILVNSINN
A0A1G3ZL71      QFVNQLIENAGGSSEFTVEFLQLRATELRKELGEKEALLQDYKKRHNLIS---LDDSLNI
A0A556QP09      QFIESLLENVSGGHDYAVKYLRDRATQLQEEARIAEQRLQDYMRAQNLVS---LDNSTNI
A0A2T6DX88      QFMQYLLDSVSGKNEYAVERLRLSAEQLRKEAEAADQKLQSYMREHNLVS---LDNSVNI
A0A2T6CWI7      VFMKRLYDTAGGRTADAVKFLREQASRLEREAQEKEQALQQYMTKHQLTS---LDTSQSM
A0A3E1E5C8      QFVGYLMDYYGGKNETGVEYLRAQADRLGKDAADAEQKLMAYKKEHNLVS---LGNSTNI
B1ZZ74          QFMTYLIERVGGVNESAVEFLRNRADQLRKEAEQADVKLNAYMQAHNLVS---LDKNKDI
A0A3B9FM17      EYEKLHKSTKNEKVEFVKQTLEDLLDTSLGKEKKIAADMANYKKEHNLPF---LEDEKRD
A0A0E3YV65      QFIIHLLDRNSAVNNSAIAFLREQTQELRVKAESSERALQQYREKSGMVS---LDESRNI
W0J900          CYIVYLMDRNTSSNDSAISFLREQTEDLRKKAEASERALQAYREKTRMVS---LEESQNI
R7E4L8          VYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVK--DMDTTLDA
A0A4Q3BVY2      AYQDIQQENYEEYRDEALRRYAEQVDRLEAEISQTLSSLSSVERSQNLTEAMLEQQSLLE
A0A4P6PCA7      AAGVLMERDNKELSDGAVKWLVDQTEVLRKELEAVELELAGKRQDFQIAT---LEQRRES
A0A2T6DSN5      KYIDFMLDEAMSGTTSAILWLRNQAEETRSQLEAATRELQEFRERHNMAS---VGENKGV
A0A317ZIW7      EYINRRSEMRAKTSEKTYDAIAAKIKSLEDEINQNEDAIVDFQRKNNIVF---IQEQGSA
A0A7C4PPT4      EFLKDREEKRVEMREKIISSYTEELKEVSRRMEEALMTTHQVESGRKTEL-QTKLALLQE
A0A7C4QZX4      EFLKELEEKRAEMRNRILAAYNAEMKDMGEEIESILNAKYQVEGGRKMEI-AVKMDELKQ
A0A2D7WMI4      EYEILHRSRSNLKVESAKQTLEGLLQKEIQKEENIKRQITALKIKRSVPN---LEDIKRD
A0A2D6VHX5      EYDKLNSIKKTEQVQTAKGILELLLDKSLMEEDRILKEISDIKESNDIPF---IEDAKKI
A0A2D8I214      EYEKLHKSKKNQQVESVRNLLEKLLAQSIEKESQLADEMSAYKKNLGLPF---IEDEKRD
A0A1Z8VL41      EYEKLHKSRKSEKVESARNLLELLLENRQSEEKRIAQEMSQFKKGKNIPY---LEDAKNS
A0A2E6TNA4      EYEKLHKSRKSEKVESARNLLELLLENRQSEERRIAQEMSQFKKGKNIPY---LEDAKNS
A0A1Z8RG47      EYEKLHRSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSGYKKNNQLPF---LEDEKKD
A0A1Z8RJJ5      EYEKLHRSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSGYKKNNQLPF---LEDEKKD
A0A2D7V631      EYEKLHKSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSEYKKANQLPF---LEDEKKD
A0A354RA24      EYEKLHKSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSEYKKANQLPF---LEDEKKD
A0A2E9RV62      YYDESHKKGAGEIVRGARSVLESLLEKSQSREDSILEEMTKYKGERELPF---VEDERLD
A0A2E4AY96      EYEILHRSNSSLKVESAIKTLERLLDREMKKEKDIQAKISQYKAEKEAPF---LEDDKKD
A0A3B9B9P4      EYEILHRSNSSLKVESAIKTLERLLDREMKKEKDIQAKISQYKAEKEAPF---LEDDKKD
A0A2D5Y6N6      EYEKLHKSKKSLQVENVKNVLQLLLDKSLQEEERISQEQSSFKKKYDLPF---LEDEKQD
A0A2E7HSS8      EYEKLHKSSKSEKVEFVKKTLEDLLENSLSKERKIAYDMSEFKKVNQLPF---LEDEKRD
A0A2D8VCK3      EYEKLHKSTKNEKVEFVKQTLEDLLDTSLGKEKKIAADMANYKKEHNLPF---LEDEKRD
A0A350QVY4      EYEKLHKSTKSEKVEFVKQTLEDLLDTELSKEKKIAADMANYKKDNNLPF---LEDEKRD
A0A2E4ZYR7      EYERIHESRQGKKHDTAIAFLEEQMTRSRNAETEIDNKVREFKRRHNLAF---IADEKKD
A0A2E6TCV1      EYERAHKSRKGQNQTKSVAFLDIQMAESRKKEDAIIKQINSFKTNHNLTY---IEDDKKD
A0A3D4HHL8      EYLSFKREMRSETADRTFLAITEEMMDLQKEIESGEDEKLNFQKENNIVF---IQEQGSS
A0A366HV03      QYDSYTREKRFEFFEVALKRYNEELGLLKKKIDESLQVKTSFERDNEINELLIKQNSLAQ
A0A6G6K911      QFDTYTREKRFAFFEVALKRYNEELGLLKKKIDESLEVKTNFERDNEVNELLIKQNALAQ
A0A5R8KAF2      VYRAQREEAWAKYRNEALIRYAREVDTLEGLAVDSYKDLSKLERESRMTEVKIEQSRLFM
A0A7C4LRZ6      EFMNFKEEQTASAVDQRLTETRREIERYERKLETARRALQDFQLSNNIAS---VKETADA
A0A2V2SDN0      EYLSFKRESREKTSDRAVASLARQVNQLANELKAQQEKMYAFQMSNNVVF---LQEQGSG
A0A1V6GL40      EYIALKKEMRSQTSDTTVAGLTEQVMRLEKDLRRAEAEMVQFQSTNSMML---TQEQGNS
A0A2V5X6Z6      EYLSFKKESREKTTDRTATSLGVEVTQLKGELEAQQEKLHAFQASNNVVF---LQEQGNS
A0A2V5VGZ7      EYLSFKKESREKTSDRTAASLAAEVTQLKSELEAQQEKLHAFQASNNVVF---LQEQGNS
A0A2V5U130      EYLSFKKESREKTSDRTATSLGAEVTQLKGELEAQQEKLHAFQASNNVVF---LQEQGNS
A0A2V6C237      EYLSFKKESREKTSDRTATSLGVEVTQLKGELEAQQEKLHAFQASNNVVF---LQEQGNS
A0A3R8L982      QFITYLIDSVSGRNEDAVSYLNTSADRLRDEANAAEQRLLDYMRRENLVS----------
A0A6N6QBS9      EFIDYKKQMLVNLKSSAEATLHREILQSERELENVRDEIDQFTRKWNIAN---FTDAGAR
A0A2E7HPU9      TYANELGVERATGRTNSSSVLAQKSEEAEKL-----------------------------
A0A388PR45      VIQKSSEDERLTITHPLVEKARIEIESLEDKIRRLYEKKNGLVKSGDLLD----------
A0A388QR61      VIQKSSEDERLTMTHPLVEKARIEIESLEDKVRRLYEKKNGLVKSGELLD----------
A0A4P5YHI0      VIQKSSEDERLTMTHPLVEKARIEIESLEDKVRRLYEKKNGLVKSGELLD----------
A0A2A2RS01      AIQKNSEDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKTQKLLS----------
A0A2A2Y1A7      AIQKNSEDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKTQKLLS----------
A0A388PDH9      AIQKNSEDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKSQKLLS----------
A0A2G4H1E7      AIKKNSEDGRLMMTNPLVEKARIEIETLEDKVRRLFEQKNDLIKNQKLLS----------
A0A2G4GZA6      SIKKSSEDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKSQKLLS----------
A0A388P514      AIKKYSEDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLLS----------
A0A2A2YG59      AIKKYSEDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLLS----------
A0A2G4F7D5      AIKKYSEDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLLS----------
D5EML0          EYIAYKAGLRSSSTGEAVNFLERQVAEMREELELQEVELQDYRQQHNLVS---VQQDKGI
A0A7C4PPJ4      EFMSFKEELTASTVDLSLAETQREIERYERKLEKARQDLLAFQVKHNIAS---VKETADA
A0A3C1C1M3      GAEAAARAENRSGSNAAVAWLEAQALAQRQELEKADQELFDARQTLQM----------DV
A0A2E9EYJ1      AYRTRRQEEEQSRAQKALALLDQQIKSQEGRLEKARXNMIELMEELNIVD--LSLGEPVW
A0A258AXR6      SYMTQRNNIETGKKHKALEVLQQQISDQEGLRSQAQVRSQEARRKAGIVGDWIVGGGSSL
A0A3D3NZQ6      SYMTRRVEVESKQKESALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNST
A0A1T4WVZ9      SYMTRRVEVETSQKQEALAMLAKQIAEQEQLRDQARLKMQEAKKKGGIVGEWFSSGTNST
A0A4R7SSI6      SYMTRRVEVESKQKQDALTMLGQQISEQEQLRDQARLKMQEARKKGGIVGEWFSNGSNST
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      AGGSLARLSTELSDGILQTQLLES------------------------------------
A0A258AXL1      NGANTAR-----------------------------------------------------
A0A2E6T1E0      AAAEEAA-----------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      LMTAETLRKIESLRIESQAEYVRQ------------------------------------
A0A3C1UJT2      -------EKARPDNLTNEQLEIVS------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      AEKESVQIRDSLLRARLLMLQKQI------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      DFSTSQALEKEIFDLETQIKLAST------------------------------------
A0A2N8IV96      STLTAGMEEEEFRNAKAQAMDFER------------------------------------
R7E1V8          STLTAGMEEEDFRNAKSQAMQFEK------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      KRMELESIGKELTVSKNEKLKLDT------------------------------------
A0A2G4I5Z5      VTEEFKSLSERRSAATDERRDMER------------------------------------
A0A4P5QQV6      AAAYLSKLNTRLAELRNESQLLDL------------------------------------
A0A1T4WWY4      IPVDIVRAKYRLKEHEEISRILQE------------------------------------
A0A3D3LEQ6      VPVQQVRVRYKLQEMDGVRQVLKD------------------------------------
A0A3D3NW23      VPVQQVRVRYKLQEMDGVRQVLKD------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      VRQKVGLLGNDLAQAQLEQTTLQT------------------------------------
A0A290QD69      VQQKVTMLGNSLAEAELRQTNLRT------------------------------------
A0A2E7VDS1      VADRKSQYQGAITLAQVEKLRIQS------------------------------------
A0A7C8D3W3      IREVIVSINRELDRTEIQLQKLEL------------------------------------
A0A178IFJ2      VVDRMKAISSALTEAQVALLAIEA------------------------------------
A0A357FSP9      AATQLSSLNTIKIENKHLYDNLET------------------------------------
A0A2A2R174      VTEEFKALNERRAVATDERRDVER------------------------------------
A0A1H2DTI1      LGSHLAQLNNQLVDRRNEYDLLVK------------------------------------
A0A1H1MGC9      VTEKLKALNAYVTQTTSRLNEAEI------------------------------------
A0A1V5L462      AAGRLSELKTRLEDYRTQLRILES------------------------------------
A0A3D3LGD3      VPGAELRTTGDSMAVTREQAIFQA------------------------------------
A0A350ARX4      TGAYLARLTTQQAELKTQLLILEN------------------------------------
B5JIS2          LAERLKGIDANRIEARLDRFRLET------------------------------------
A0A6N6ZC77      AGSNLAALERRRSELRTQMRLLES------------------------------------
A0A7C5H7K5      IGAYLAQLNQRITSLKSEYDLLST------------------------------------
A0A538NJ59      AGGSLARLSTELSDGILQTQLLES------------------------------------
A0A2A2R3V9      NATYLINLSKQLDDLNTEFQLLSK------------------------------------
A0A3C1VFY9      A-NYLSVLYQRLAESKSEYDLLQS------------------------------------
A0A2V2SMX4      AGNYLTALNQRLAGLKSELELLRT------------------------------------
A0A522AC27      YGMYLASLTRKLADLKSEYDLLTT------------------------------------
A0A6M1RFD0      AGNYLAQLNQQLAMLQSELNLLNM------------------------------------
A0A7C3HXH0      AGNYLAQLNQQLAMLQSELNLLEM------------------------------------
A0A1H2GQN6      LDQELEGKQKQLDDARQDAVARRV------------------------------------
A0A512M3Y3      VPGEMLTTKNRMDSMQQVIEMIES--------GKLPAVEQLSLLKKFRGTPVPVGTIMRN
A0A4P5R5J1      AATYLSILNRRLDELKTEFNLLQR------------------------------------
A0A4P5YK43      AQDRLNRLTAELDEIVLVRKRLES------------------------------------
A0A2A2RPW6      QTADFKAMAEKLNEAKDEVRLLEL------------------------------------
B1ZT68          VLQKVGTVGTALVRAQMEQVEMRS------------------------------------
W0J7C2          VLQKMSSLGTAVVAATLDQIDAKS------------------------------------
B4D1I7          AGAYLAKLNTQLAEFKKEAQLLDL------------------------------------
A0A353F286      GNRLGLSEQAMFQSAKGKLANFET------------------------------------
A0A354FSA6      GNRLGLSEQAMFQSAKGKLANFET------------------------------------
A0A3B9GA54      GNRLGLSEQAMFQSAKGKLANFET------------------------------------
A0A520LEH8      GNRLGLSEQAMFQSAKGKLANFET------------------------------------
A0A6B2M0T8      IVDRMKNLSGSLNDAKVELLNLSA------------------------------------
A0A2D7B7R6      LETKNNSDRLVLDNLKLELSRIQN------------------------------------
A0A2E5K4P7      FLRELTVLREHLIKKDDVRKAVES------------------------------------
A0A2V6F9Q9      AAQYLVKLNQDFARLKTEYELLQK------------------------------------
A0A2V6NZZ3      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A2V6EBU2      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A2V6EY06      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A2V6ME53      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A538NUU0      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A2V6NIJ1      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A2V6C292      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A2V6D2X0      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A2V5ZUK1      AAAYLVKLNQQYAQLKTEYALLNL------------------------------------
A0A2V5XFN9      AAAYLVKLNQQYAQLKTEYALLNL------------------------------------
A0A2V6EZC8      AAAYLVKLNQQYAQLKTEYALLNL------------------------------------
A0A2V6I7Z5      AAAYLVKLNQQYAQLKTEYALLNL------------------------------------
A0A3B9LCP2      AAAYLVKLNREYAGLKTEHDLLSL------------------------------------
A0A3C0R669      AAAYLVKLNREYAGLKTEHDLLSL------------------------------------
A0A2V6EID2      AAAYLVRLNRDYAGLKTEYDLLNL------------------------------------
A0A2V6MHB0      AAAYLVRLNRDYAGLKTEYDLLNL------------------------------------
A0A2W5YWL9      AAQYLVKLNQDYARLKTEYELLEK------------------------------------
A0A2V5NH62      AAAYLVRLNQQYAQLKTEYDLLSL------------------------------------
A0A2W6A620      AAQYLVRLNQQYAQLKTEYDLLSL------------------------------------
A0A2V5PIJ4      AAAYLVKLNQSFAALKTEYDLLSM------------------------------------
A0A2V6K2G8      AAAYLVKLNQQYAQLKTEYDLLNL------------------------------------
A0A2V5W206      AAQYLVKLNQQYAQLKTEYDLLNL------------------------------------
A0A2V6MW77      AAQYLVKLNQQYAQLKTEYDLLNL------------------------------------
A0A6N4WVA3      AGVYLAELKREVAELNTESRSLTS------------------------------------
A0A0R2XPB1      ASTYLAELKRELAELNTENRVLTS------------------------------------
A0A348NQP1      ASTYLAELKRELAELNTENRVLTS------------------------------------
A0A357FV58      ASTYLAELKRELAELNTENRVLTS------------------------------------
A0A2G4GZN8      LTAERSVLVRDREETRKQIDENEI------------------------------------
A0A348NPT1      AATQLSSLNTIKIENKHLYDNLET------------------------------------
A0A2E1KV60      AAEELASLNQIKTAAKMELDQSET------------------------------------
A0A2D7F4D9      AAEQLASLNEIKTMAKMNLDQAEI------------------------------------
A0A3R7RBR8      AAEQLASLNEIKTMAKMNLDQAEI------------------------------------
A0A2E0NH28      ANEQLMTLNAIKSGNKNQFDAQET------------------------------------
A0A350AS32      AREQLASLNEMKLNAKNVYDMIET------------------------------------
A0A368BGT4      AGAQLAHLNEIVLTNKNTYDQFQT------------------------------------
A0A6N6PLV8      TTDGFRAASQERNLLELESRVSTL------------------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A290QE54      VSDRLKTVNAALSSARLDRLQLEE------------------------------------
A0A1H1SWX2      VGERLRTVNATLTTARLARLDIET------------------------------------
A0A1D8AZK8      ISERLRTINATLTSARLSRIDLEN------------------------------------
A0A4Q1C9I5      ISDRLRGYNTSLTDARNARIAIEN------------------------------------
A0A2E6NAH3      AAVQLSHLNEIELTNKNIYDQFQT------------------------------------
A0A2A5VZA5      AREQLVTLNQIKLESKNNYDQLDT------------------------------------
A0A424R295      AREQLVTLNQIKLESKNNYDQLDT------------------------------------
B4CZV9          LPADLTKLQMRIDEIGRVRVRLQD------------------------------------
A0A1G3ZL71      VADQLRRANEARTAARHERLRVEN------------------------------------
A0A556QP09      AQANLSSVNQALQGARLDRLAIAE------------------------------------
A0A2T6DX88      VSDRLKSVNAALQTARLERLSIEE------------------------------------
A0A2T6CWI7      SDEALKKAHTMRDDARLRLMAVDE------------------------------------
A0A3E1E5C8      VGTRLTTVNDALTKARLARIDLET------------------------------------
B1ZZ74          VSERLKTISSTLTSAQLVRLNFEN------------------------------------
A0A3B9FM17      TGDRKSQFSSEVTKSRLEQIRINS--------------------------LLRQI-----
A0A0E3YV65      VVDRMKALSSTVTGARVSRVTIEA--------------------------RLNQA-----
W0J900          VVDRMKAISSALTEAQVARFAINA--------------------------RLQQA-----
R7E4L8          TFNRVQEIGTELFSTRTELIQVKV------------------------------------
A0A4Q3BVY2      IPKQLIQTRERLARMRDVRILLTN--------------------------LENKASAEGS
A0A4P6PCA7      LRAILADLGTQKAGLENQLALRQT------------------------------------
A0A2T6DSN5      IAQKVVQLGQSLVGIELEQTNLRT------------------------------------
A0A317ZIW7      AGTYLADLKRRLAELKTESRTLSS------------------------------------
A0A7C4PPT4      VPKQLVEVSERLEVLERVKKTLDD------------------------------------
A0A7C4QZX4      LPRKIAIISSRLSQLDRIQSTLES------------------------------------
A0A2D7WMI4      NATRKSQYQSEITRCNIEQLRLDS--------------------------TLSQI-----
A0A2D6VHX5      NSSKKSQFQAKITASKLDQIQINS--------------------------ILRQI-----
A0A2D8I214      TADRKSQYSAEVTTSKLEQIKIDS--------------------------LLRQV-----
A0A1Z8VL41      IFARXSQYQSEITRSKXXQXKITT--------------------------LLKQI-----
A0A2E6TNA4      IFARKSQYQSEITKSKLEQIKITT--------------------------LLKQI-----
A0A1Z8RG47      TADRKSRYQAEITKCKLEQIRINS--------------------------LLRQI-----
A0A1Z8RJJ5      TADRKSRYQAEITKCKLEQIRINS--------------------------LLRQI-----
A0A2D7V631      TADRKSQYQAEITRCKLEQIRINS--------------------------LLRQI-----
A0A354RA24      TADRKSQYQAEITRCKLEQIRINS--------------------------LLRQI-----
A0A2E9RV62      NAARKSSYHSEITKAKVEKVRINS--------------------------LLRQI-----
A0A2E4AY96      ISAKKSQYQAEITRCRIERLRIES--------------------------LKSQV-----
A0A3B9B9P4      ISAKKSQYQAEITRCRIERLRIES--------------------------LKSQV-----
A0A2D5Y6N6      TSARKSQYQSEITSSKLEQIRINS--------------------------LLRQI-----
A0A2E7HSS8      TGTRKSQYSEEVTKSRLEQIRINS--------------------------LLRQI-----
A0A2D8VCK3      TGDRKSQFSSEVTKSRLEQIRINS--------------------------LLRQI-----
A0A350QVY4      TGDRKSQFSSEVTKSRLEQIRINS--------------------------LLRQI-----
A0A2E4ZYR7      VADRKSQYQSAITQAQVEKLKIQS--------------------------TLRQI-----
A0A2E6TCV1      NAERKSQYQNAITTADVKLLEIDS--------------------------HLVSI-----
A0A3D4HHL8      VGAYLAELNQQLAELETQYRFLDT--------------------------LSLDA-----
A0A366HV03      IPLDILRVQHRMRQYDEVRGIVQS--------------------------RSQNSVIAPL
A0A6G6K911      IPLDILRVQHKIRQYDEVRSIVES--------------------------RVQNGAMDPL
A0A5R8KAF2      VPAELIMTKEVVRRMEEVRLSLDQRGTLGTAPEKLTAEQIFAELSMLTAFEKERE-----
A0A7C4LRZ6      AQQRLDGLLDEYTAVQTLRQRLEN--------------------------KTSLD-----
A0A2V2SDN0      AGSYLALLNRQLATLRTELQLLQL--------------------------VQPDQ-----
A0A1V6GL40      PAHYLTTLYQRLVTLKSEYALLQR--------------------------LTLDQNLARR
A0A2V5X6Z6      AGSYLASLNKQLATLRTELRLLQS--------------------------LQPEQ-----
A0A2V5VGZ7      AGSYLASLNKQLATLRTELRLLQS--------------------------LQPEQ-----
A0A2V5U130      AGSYLASLNKQLATLRTELRLLQS--------------------------LQPEQ-----
A0A2V6C237      AGSYLASLNKQLATLRTELRLLQS--------------------------LQPEQ-----
A0A3R8L982      -------LDNSTNIVRERLTSVNA--------------------------ALQTA-----
A0A6N6QBS9      SRERLERAKSEYLTLQTERKLYEA--------------------------ATAEE-----
A0A2E7HPU9      -------LNQKENALANYQIILLT--------------------------LEDLE-----
A0A388PR45      -------IAGTTNSIAAQRSKLIQ--------------------------DREDY-----
A0A388QR61      -------IAGTTNSIAAQRAKLIQ--------------------------DREEY-----
A0A4P5YHI0      -------IAGTTNSIAAQRAKLIQ--------------------------DREEY-----
A0A2A2RS01      -------IAKDTTTLNTERGVLVR--------------------------NREDA-----
A0A2A2Y1A7      -------IAKDTTTLNTERGVLVR--------------------------NREDA-----
A0A388PDH9      -------IAKDTTTLNTERGVLVR--------------------------NREDA-----
A0A2G4H1E7      -------IAKDTNTLTAERSVLVR--------------------------DREET-----
A0A2G4GZA6      -------IAKDTNTLTTERSVLVK--------------------------DREET-----
A0A388P514      -------IAKDTNTLTTERSVLVK--------------------------DREET-----
A0A2A2YG59      -------IAKDTNTLTTERSVLVK--------------------------DREET-----
A0A2G4F7D5      -------IAKDTNTLTTERSVLVK--------------------------DREET-----
D5EML0          TADRLARLNDAL-----------T--------------------------DAEIR-----
A0A7C4PPJ4      AQQRLDKLLDEMTAVQTLRQRLEN--------------------------KSSRD-----
A0A3C1C1M3      LAGRRKTIEESLLHFNESLSEVEA--------------------------KASME-----
A0A2E9EYJ1      LRGSQPNTGTASLVMAAKQREFAA--------------------------EEAIQ-----
A0A258AXR6      NPGGEMRSEKDSMVISREQALMIA--------------------------DQEIL-----
A0A3D3NZQ6      VPGAELRTTGDSMAVTREQAIFQA--------------------------DLDVE-----
A0A1T4WVZ9      APGANLRTTEDSMVVTREQALLNT--------------------------ELEVQ-----
A0A4R7SSI6      APGSTLRTKEESMVMSREQALLQA--------------------------DLEVQ-----
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      -----------------------RALGLEANGPVGAGVSVGLNGPLLGADSEIPS---TG
A0A258AXL1      --------------------------------RLSPEVG--AATPEASTTTIVTPQVAKR
A0A2E6T1E0      --------------------------------RVFHETKQYGTIPEVATDTEVRK-----
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      -----------------------------------ASTLADNLKESERKQGLISVETGLP
A0A2V6N5E0      ---------------------------DLDQNLDRAQNKTEAASGQGSDNQGMPFSDVGP
A0A2V6NH44      -----------------------------------------------------PFSDVGP
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ---------------------------ATRLDRLKNLGKELGPEGLAQ-----AITTDAP
A0A3C1UJT2      -----------------------------------------------------LIPSVAK
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------RLERAKAALADGRAGVPE
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      --------------------------LADNLKESERKHGLI------------SVETGLP
A0A2N8IV96      --------------------------REKELASYVQELQRLPDDKLLDYVISSDLLNAET
R7E1V8          --------------------------DEKELASYVQELQRLPDDKLLDYVISSDLLNAES
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      --------------------------DWKMIQQYSNNVERLLTVQSIL-----------D
A0A2G4I5Z5      --------------------------------DFEMTRRVGGKVSELL-----ILASISR
A0A4P5QQV6      --------------------------FDADQQIARDRKMPKPDGGDLREGDPRIPSATGP
A0A1T4WWY4      ----------QQSSLDVIGKLSLISGFTDEEKDPLEAGRVVRKGG---AVAPFTFSSPST
A0A3D3LEQ6      ----------QGGTLDTVGTLALLTSMTSDKDDPLSVGRIVRRTGDPRTSAPATFQTPEM
A0A3D3NW23      ----------QGGTLDTVGTLALLTSMTSDKDDPLSVGRIVRRTGDPRTSAPATFQTPEM
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      --------------------------LIQLIEDYRKRGQSLYEISAII-----------G
A0A290QD69      --------------------------LIESVEDYQKNNKNILEISDIA-----------S
A0A2E7VDS1      -------TLRQIIAIQGRVEQSTRTTKDNEHARTNDEMEKIKEYFEIS-----AVETYGN
A0A7C8D3W3      ---------------TAKEDYAQFVSSGASSSSPLNSTANQLTEPFIKDTNDERYRKIAK
A0A178IFJ2      --------------------------RLQQAESVIAKNSSPLELASIT-----------E
A0A357FSP9      --------------------------RINLIESFRRAGRNLSELPFIA-----------E
A0A2A2R174      -------------------------------------DFEMTRRVGVKVAELLTLSTVSR
A0A1H2DTI1      -----------------------------LTAKQGDLQGLPVVAGASNSQQESRMRLAAA
A0A1H1MGC9      --------------------------RWRQVQERKATPAQLLDLPFIS-----------S
A0A1V5L462      ----------------------------------FDENVSLDQIQDVV-----NLDTIES
A0A3D3LGD3      ----------------------------DLDVETLSAEIGQLQTLEGDELVARAGGLKLD
A0A350ARX4      ----------------------------------LKTGDITTSVVEQS-----PLIEAES
B5JIS2          --------------------------KLGNVKAALGEDGRPFDNPFLA-----------N
A0A6N6ZC77      --------------------------LDVDMQLQNPEGLGLDK----------ALLNSAA
A0A7C5H7K5      ----------------LTENAGFLDILTGEQTPLITDQLVGQRAIRIE---------DSV
A0A538NJ59      ------RALGLEANGPVGAG----VSVGLNGPLLGADS----------------EIASTG
A0A2A2R3V9      ------LTLDQNIERRSTNTSKPQTTTKNPATTNTAEKRTPDSEEIKAAAGDLLSPE---
A0A3C1VFY9      ------MTLDQNLLLEQGRS----PALAGAGMPGGLGTGNGILANAALGGQSTLFAPSTM
A0A2V2SMX4      ------MSVEQTLERRQQGG----GVLPAPEPVADVNN----------SASSSLSANDSS
A0A522AC27      ------MTLDQNIERQRQQG----VAS--TSSEAGSER----------GGGG---RN---
A0A6M1RFD0      ------LDLEQNLERQQAAG----VITGVRPVPPGQQR----------SPVDVLRAD---
A0A7C3HXH0      ------LNLEQNLERQQASG----VITGVRPVPPGQQR----------SPVDVLRAD---
A0A1H2GQN6      ------------------------------------RYEQLKNLSTEDLIDTLPSLGLND
A0A512M3Y3      SRPDEVVSIAAPIAGSTVAGLSSDSPSAPIPAVPAGASAGAMMIAAMSQPKIVVPSMVEE
A0A4P5R5J1      --------------------LDIDQTLDRTPSVATGAEGQLNRMDSLA-------GAPGP
A0A4P5YK43      --------------------YTKDELLEGKMPEILSKNPAKDAASAVTAGPDKSKTADPL
A0A2A2RPW6      --------------------------EWGMSQKVGNSVDELLKLPMIS-----------R
B1ZT68          --------------------------VLDKIDEYRKEG---KDLFEIP-----AILGYGQ
W0J7C2          --------------------------LIDKIEEYQAGN---RDLLEIT-----QIRTSGQ
B4D1I7          --------------------------FQLDQKIAADESRAGDKDGERN-----PRLTGQP
A0A353F286      --------------------------------QADQIKIQIGKLVQLTSEELISYAAGLD
A0A354FSA6      --------------------------------QADQIKIQIGKLVQLTSEELISYAAGLD
A0A3B9GA54      --------------------------------QADQIKIQIGKLVQLTSEELISYAAGLD
A0A520LEH8      --------------------------------QADQIKIQIGKLVQLTSEELISYAAGLD
A0A6B2M0T8      --------------------------TLEKIQEAKGDLDLLAKLPAIN-----------Q
A0A2D7B7R6      ----------------DLEDLESVGYVDAASEKARPDNLTNEQLEIVS-----LIPSVAK
A0A2E5K4P7      --------------------------RWQQLLAYEAEGRSLLDLGFIS-----------N
A0A2V6F9Q9      --------------------LDLDQNLDRGEKTKTEASPG----ASPTDQAGMPFSDVGP
A0A2V6NZZ3      --------------------LDLDQNLDRGEKTQTEASPN----PSANDQVGMPFSDVGP
A0A2V6EBU2      --------------------LDLDQNLDRGEKTQTEASPN----PSANDQVGMPFSDVGP
A0A2V6EY06      --------------------LDLDQNLDRGEKTQTEASPN----PSANDQVGMPFSDVGP
A0A2V6ME53      --------------------LDLDQNLDRGEKTQTEASPN----PSANDQVGMPFSDVGP
A0A538NUU0      --------------------LDLDQNLDRGEKTQTEASPN----PSANDQVGMPFSDVGP
A0A2V6NIJ1      --------------------LDLDQNLDRGEK--TESSPG----ASPTDQVGMPFSDVGP
A0A2V6C292      --------------------LDLDQNLDRGEK--TESSPG----ASPTDQVGMPFSDVGP
A0A2V6D2X0      --------------------LDLDQNLDRGEK--TESSPG----ASPTDQVGMPFSDVGP
A0A2V5ZUK1      --------------------LDLDQNLDRAQT-KLDS-SS----GQASDNQGLPFADVGP
A0A2V5XFN9      --------------------LDLDQNLDRAQN-RTETAAS----NQPVENGGLPFSDVGP
A0A2V6EZC8      --------------------LDLDQNLDRAQN-RTETAAS----NQPVENGGLPFSDVGP
A0A2V6I7Z5      --------------------LDLDQNLDRAQN-RTETAAS----NQPVENGGLPFSDVGP
A0A3B9LCP2      --------------------LDLDQNLDRAQI-KPESLAN----GQTAEDQGLPFAGVGP
A0A3C0R669      --------------------LDLDQNLDRAQI-KPESLAN----GQTAEDQGLPFAGVGP
A0A2V6EID2      --------------------LDLDQNLDRAQN-KSEMNLG----GQSTEDQGMPFSGVGP
A0A2V6MHB0      --------------------LDLDQNLDRAQN-KSEMNLG----GQSTEDQGMPFSGVGP
A0A2W5YWL9      --------------------LDLDQNLDRGQS-TAKPEASPSASASEQT--GMPFSDVGP
A0A2V5NH62      --------------------LDLDQNLDRAQG-KNDMPSAPNTQSNDDKPPGMAFSDVGP
A0A2W6A620      --------------------LDLDQNLDRTSG-KNDGTTPPSTQSTDEKAPGMAFSDVGP
A0A2V5PIJ4      --------------------LDLDQNLDRKQV-QPDGAGSTNTQPSDDSA-GMAFTDRGP
A0A2V6K2G8      --------------------LDLDQNLDRAQN-KMDSAGGAN--PGSDNQ-GLPFSDVGP
A0A2V5W206      --------------------LDLDQNLDRAQN-KTEAASG----QGSDNQ-GMPFSDVGP
A0A2V6MW77      --------------------LDLDQNLDRAQN-KTEAASG----QGSDNQ-GMPFSDVGP
A0A6N4WVA3      ------------ILNENAQQ------KSLLIDQLQGAGRGEAPSSEAF-----NGGGVDE
A0A0R2XPB1      ------------ILNVDAVK------MSLLLDQWQGA----EDTSSAT-----TGGSAGD
A0A348NQP1      ------------ILNVDAAK------MSLLLDQWQGA----EDTSIAA-----SGGSDGD
A0A357FV58      ------------ILNVDAAK------MSLLLDQWQGA----EDTSIAA-----SGGSDGD
A0A2G4GZN8      --------------------------LVLVIASYESEGRPVGDIPQIR-----------A
A0A348NPT1      --------------------------RINLIESFRRAGRNLSELPFIA-----------E
A0A2E1KV60      --------------------------RWNLIQDYLRQNKDLWELPFIS-----------Q
A0A2D7F4D9      --------------------------RWNLTQDYQKQGKELWELPFIS-----------E
A0A3R7RBR8      --------------------------RWNLTQDYQKQGKELWELPFIS-----------E
A0A2E0NH28      --------------------------QWNLIESYRRDGRDLWELSFIA-----------D
A0A350AS32      --------------------------KWNLVESYRREQRDLWELSFIS-----------E
A0A368BGT4      --------------------------KWNQVETYRKEGRNLWELAFVA-----------E
A0A6N6PLV8      -------------------------KLHLDLLQKLKPEELPQALRALQ-----IIDPAVE
A0A2E0V4K6      ------------------------------------------------------------
A0A290QE54      --------------------------LNNQIASFKKDA---RNLLEIA-----AISNHGT
A0A1H1SWX2      --------------------------LLSQIEKMQKENP--ANLLEIG-----YISAYGN
A0A1D8AZK8      --------------------------LLGQIERMQQAG---GNLLEIG-----YITAYGN
A0A4Q1C9I5      --------------------------RLAQIERMQQAG---GNLLDID-----YISAYGN
A0A2E6NAH3      --------------------------KWDQIETYRLEGRNLWELPFVA-----------E
A0A2A5VZA5      --------------------------KWNLIETYKREERKLWQLTFVA-----------E
A0A424R295      --------------------------KWNLIETYKREERKLWQLTFVA-----------E
B4CZV9          --PALDSVAKLSLIASADDNDTRLSVGQTVAQPQSGQSADKKDAAANN-----SVVVVPS
A0A1G3ZL71      --------------------------LFRQVEAYRQNG---RDLLELS-----EITGYGN
A0A556QP09      --------------------------QERLVERYQAEK---RNLLEIT-----AIAAYGS
A0A2T6DX88      --------------------------QVNQVASYKREG---RDLLQIS-----SIANHGT
A0A2T6CWI7      --------------------------KITQVEAYQKEK---RNLFEVV-----EIANYGA
A0A3E1E5C8      --------------------------QYHQVEAYRKEG---RNLMEIA-----YIAGHAT
B1ZZ74          --------------------------QYALVEAYRKEG---RNLVEIQ-----FIAGHGT
A0A3B9FM17      -------LAIKTRIGSNSNSV--------SSKDIKDDIAVIKEFFEID-----AIEQFGN
A0A0E3YV65      ----------EFIMAGGGDPL--------------------------------ELAAATE
W0J900          ----------ESIISKNSDPL--------------------------------ELASVTE
R7E4L8          --------------------------LARLLADRSRQQDMIPANIGIQ------------
A0A4Q3BVY2      EGGTGSDQKIGNMMSLLSLLGSFENEAEVNVGDIVPNGQFKGSLTSVKTPETNIVSP--A
A0A4P6PCA7      --------------------------EYDYLSEWEESGR--------------SIETLPT
A0A2T6DSN5      --------------------------ILETIETYQKNN---RDLMEIP-----QIASFGG
A0A317ZIW7      --------------ISDSSEV-----EELILKDVPTPDDGSSDGTIVS-----AIGSKED
A0A7C4PPT4      -----ESMDAVSRLSLLAAILKNSTIRPGDLVPAGDG------SAKASVVVLPPNVTSPS
A0A7C4QZX4      -----TNLSLVDKLSLLQVLQRESQLQPGEVINAGTGEEIAGENPKTALVVLPTMLPQGN
A0A2D7WMI4      -------RSILKRINSNKE-------SSNS---IEERFELFSEIFKID-----EIENFAN
A0A2D6VHX5      -------LDIRKRISSNKESSIDSTNTGVD---VESNIAQIKQYFEID-----VIEGFGS
A0A2D8I214      -------LQIQARIGSRNSSS-----RSKD---IDNDIALIKDFFEID-----AIESFGN
A0A1Z8VL41      -------INVRVNIGVQNESL-----KSQD---IETDIAMIKEFFEID-----AIESYGS
A0A2E6TNA4      -------INVRXNXGXQNESX-----KSQD---XEXDXAXIKEXFXID-----AIESYGX
A0A1Z8RG47      -------LQIQMRIGNETSSL-----QSAD---VAGDIAVIKEFFELD-----AIESYGN
A0A1Z8RJJ5      -------LQIQMRIGNETSSL-----QSAD---VAGDIAVIKEFFELD-----AIESYGN
A0A2D7V631      -------LQIQMRIGAQTSSL-----KSDD---VEGDIAVIKEFFELD-----AIETYGS
A0A354RA24      -------LQIQMRIGAQTSSL-----KSDD---VEGDIAVIKEFFELD-----AIETYGS
A0A2E9RV62      -------IQIQASISSRIQND-----GASKD--VNANIDAIKEYFKID-----AIESFGN
A0A2E4AY96      -------LAVDNKI----KSR-----KVES---IEERYALFGEFFKIK-----EINQFGR
A0A3B9B9P4      -------LAVDNKI----KSR-----KVES---IEERYALFGEFFKIK-----EINQFGR
A0A2D5Y6N6      -------LQIQVRIGSQSEST-----SSQD---IDDDIAVIKEFFEID-----AIESYGS
A0A2E7HSS8      -------LAIKTRIGSGSDSV-----SSKD---VNDDIAVIKEFFEID-----AIEEYGN
A0A2D8VCK3      -------LAIKTRIGSNSNSV-----SSKD---IKDDIAVIKEFFEID-----AIEQFGN
A0A350QVY4      -------LAIKTRIGSSTNSV-----SSKD---IKDDIAVIKEFFEID-----AIEQFGN
A0A2E4ZYR7      -------IAIQGRVERATNAV-----KDNEHARANAETDKIKEYFEIS-----AIEGYGN
A0A2E6TCV1      -------RGIHNKVVQSLKAL-----TATGPARTTAKIKIIEDFFKIS-----AIAEYGN
A0A3D4HHL8      ---------------IGERAQ-----AVAELAKAKRKNNTEVVPAENHSGAALTSELYKL
A0A366HV03      EHLSLLESAKKSSLDENPVGQ-----LVVPASGDLKDALLVPSNSPAPLAAP-SIVVQPS
A0A6G6K911      EHLSLLDSAKKSSLDENPVGQ-----LVVPATGDLKDNLLTPSVAPVAAITPSSIVVQPS
A0A5R8KAF2      ------------LRVGDLLRR-----QSQQGMVDKPEGAPAQPVPASF-----VVQP--N
A0A7C4LRZ6      ------------LLKGGVMDA-----PKRPPARGSEDALGPNRREASD-----PLERFLG
A0A2V2SDN0      ------------WVEIGSRTR-----PSGPGEPPAGEA---SPQDIMA-----GLTG--P
A0A1V6GL40      QAAGGTFSLGNEPLAEGNDSL-----PDTNAVALTAGG---TPGQSST-----AAGD-RG
A0A2V5X6Z6      ------------WIETGHKGV-----PSG-------------EMLASL-----AE----P
A0A2V5VGZ7      ------------WIEAGHKVV-----PSSESLPDQATE---KEMLASL-----AE----P
A0A2V5U130      ------------WIETGHKGV-----PAGESLPDPATE---KEMLASL-----AE----P
A0A2V6C237      ------------WIETGHKGV-----PSGESLPDQAAE---KEMLASL-----AE----P
A0A3R8L982      ------------RLERLAIEN-----LNNQVEAFRKDN---KDLIELN-----IIST---
A0A6N6QBS9      ------------VAAGNIESK-----RPARVRVSKDRT---QEEQDEE-----GYLQ---
A0A2E7HPU9      ------------KREATFSEL---------------------------------------
A0A388PR45      ------------RKQLDEIGI-----VVALVAQYRAAG---RDLSEIP-----LVRS---
A0A388QR61      ------------RKQVDEVGI-----VVALVKQYRVAG---RDLAEIP-----LVRA---
A0A4P5YHI0      ------------RKQVDEVGI-----VVALVKQYRVAG---RDLAEIP-----LVRA---
A0A2A2RS01      ------------RKQIDELEI-----IWKLILEYKTAG---KDAYDIA-----QVRT---
A0A2A2Y1A7      ------------RKQIDELEI-----IWKLILEYKTAG---KDAYDIA-----QVRT---
A0A388PDH9      ------------RKQIDELEI-----IWKLILEYKKAT---KDVYDIA-----QVRT---
A0A2G4H1E7      ------------RKQIDENEI-----LVLVIASYEQEG---RSLGDIP-----QIRA---
A0A2G4GZA6      ------------RKQIDENEI-----LVSVIASYEKES---RPLGDIP-----QIRA---
A0A388P514      ------------RKQIDENEI-----LVSVIASYEKEG---RPLGDIP-----QIRA---
A0A2A2YG59      ------------RKQIDENEI-----LVSVIASYEKEG---RPLGDIP-----QIRA---
A0A2G4F7D5      ------------RKQIDENEI-----LVSVIASYEKEG---RPLGDIP-----QIRA---
D5EML0          ------------QLSVETRQR-----QIA------AAD---GVIDRLM-----EIPYIGE
A0A7C4PPJ4      ------------LLKGGMVET-----RRMPDRTTSDAS---QPAPQST-----GDTL--E
A0A3C1C1M3      ------------Q-----KML-----DAL------SEG---KLPAEIP-----G------
A0A2E9EYJ1      ------------NLRSTIKSL-----TQL------EGA---ELIKSAV-----DLGV--K
A0A258AXR6      ------------TLQSEIDQV-----SKL------TPD---ELIDQAS-----GLRL--E
A0A3D3NZQ6      ------------TLSAEIGQL-----QTL------EGD---ELVARAG-----GLKL--D
A0A1T4WVZ9      ------------ALQAEIAEL-----SKL------SDE---ELVARSS-----GLKL--E
A0A4R7SSI6      ------------SLRAEIDEL-----SKL------EGD---ELVSRAS-----GLKL--E
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      TSERQGAS------------RDLELLKLQRERL----SKFLRPKHPKIAQLDTQIQRAEK
A0A258AXL1      ANEWEYIE------------GQLHSSEREYERL----SNSLLPGHEKMRELRKQIENYQF
A0A2E6T1E0      ------IR------------GDLALAEAELAEL----LKRYLDKHPKVIEKRGKIESLIE
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      DSGIARQI------------EHYNEAYLEYQKI----AGSAGSQNPITVSLKDRMNSTRA
A0A2V6N5E0      EGDYLKAK------------QQIQLLKAERETL----AKDLRPNHPKILKLNDEITKQDK
A0A2V6NH44      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPKHPKIIKLNDEISKQEK
A0A432FDF6      ----------------------------TLANH----GIDLGEEHPRIKGLKKVVATLEG
A0A522ACN3      -----------------------NIAEQRLLAL----RKEHGEDHPEVINTQKQIDLLNT
A0A353DCA1      ---------------------------------------------------------MKQ
A0A3C1AXQ2      --------------------------------V----NSGRGREHPEVEGVDSQILLSKQ
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      -----------------------------------------------MIQLLQRLQESEI
A0A3D3DET9      -----------------------MLLRVEQQEL----GRYLRPNHPKMIAMQEDIARREE
A0A355SVK9      --------------------------------------------EVELVSAVEN------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      --------------------------------------------HPKIIAATEEIAHLER
A0A2V6FIP7      --------------------QDMRKSLAEREALLANLLKRYKDKYPDVIRVREEIASLKE
A0A353DI77      --------------------KEMAVAEKAVQDL----SIRYGPKHPKIISATDHIDLKTK
A0A1V6GCZ3      DTLLTSLL------------DQLTMAEQRLIAL----EADYGPENTEVLKCKGLAEDLHK
A0A3C1UJT2      NEDFKSIN------------GLYKAAKTTVRNL----EVDLKSKHPLMIDALRNVNNTRR
A0A2S7U0Z3      --------------------EQIQEKRNQVIIL----RQRYLPKHPARIQEEALYTDLLE
A0A5E6MKA7      NPYTLEIK------------KLLLKEVARYQQM----EETYKPEYPGMTRLHAEIEGLKG
A0A6B3L936      --------------------QELNTFRSELSAF----RQRYKSKHPRLIEAEAIYQDLYR
A0A2N8IR72      DSGIARQI------------EHYNEAYLEYQKI----AGSAGSQNPIAVSLRDRMNSTRA
A0A2N8IV96      VGADALR-------------KTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERILGD
R7E1V8          VGAKALR-------------ETYAEFSDKLKEKENLKAQNIGARHPKMLALLETERILGE
A0A2E0R252      --------------------DEIRGSETAIAQM----EKRYLPKWPALVEAKELGAILKK
A0A3E1EF48      --------------------KRIETTRIAIIEM----EKRYLPKWPDLIEAKELLALLLN
A0A2A2PVG8      --------------------KEIDEAERQVAEM----EKRYLPKWPALVEAKELLKILQD
A0A2E0R421      --------------------TEIKLVESRIAGM----EKRYLPKWPALVESKEHSKILKQ
A0A2E5EJ69      DKQVSALR------------TQELEKRSEISQL----EERYREKHPKMIAARKEVVDLGA
A0A2G4I5Z5      APEVAALK------------EKLQVQEATLANH----QLRYREKHPEMIKAKTELESIRQ
A0A4P5QQV6      LLEYERAR------------QRIETLKAERAGY----ARDLTPRHPIMVELDEQIAQQQQ
A0A1T4WWY4      DKKFTQVVVQPNMVDGLKSWQELERTKRATEEKLRLIQTKFLDDHPEVIKLKDELKQVES
A0A3D3LEQ6      AKEYNQIVVQPDMVEGIEPWRELDKKKRSLEEKMAQSRAKFLDDHPEMIKLREELRETVS
A0A3D3NW23      AKEYNQIVVQPDMVEGIEPWRELDKKKRSLEEKMAQSRAKFLDDHPEMIKLREELRETVS
A0A2E7ALI1      ---------------------LLELEAIKVSDL----ARRYRAKHPKMISTVAKLEDSRK
A0A178IDB9      FGNVASLK------------TQYENILAERTAL----AERYLEEHPRMRQNALALADTRA
A0A290QD69      YGNVSEMK------------TRIDTLRAERRQL----DERYLSEHPRMKQNQLAMEDAEA
A0A2E7VDS1      VQALRQKL------------LDLETTRKAF-------EVKYLEKHPKMSANTRAVQELHR
A0A7C8D3W3      DSSYRKIV------------LELAGLTEEWEKQ----SKLLKTQHPYMVNLSSQIEEFNA
A0A178IFJ2      FSSLASVQ------------SQLDELVARKAVM----AEKYGRRHPAMIDQERSIQALEK
A0A357FSP9      QGQVSQLL------------SQISAIKIGISSS----SKRYREKHPVMIEQQQTLQESEV
A0A2A2R174      VPEVVALK------------EKLQAQEAVLVNH----QLRYKEKHPEMIKARAELESIRQ
A0A1H2DTI1      TTEFFKAQ------------QKAQERITELETQMKEEEEYLRPAHPKRVALAAQIADLKR
A0A1H1MGC9      SQLIGQLV------------QQVSAQKIVMSQL----REHYRDKHPKMIEAVNSLAQTER
A0A1V5L462      SQNYRNTK------------RQHQQLLAMKEQF----GIYLKPKHPRMMDIEAELEILSN
A0A3D3LGD3      NANVAQMT------------GELQRLEVAREGLV---NQGRGRRHPEVLANDSQITKYKE
A0A350ARX4      VALLNKTQ------------QEWTQLKAQLEEY----SLYLKPKHPKIIDLELNIERATN
B5JIS2          FANNERLR------------QELDKLNGQREVM----ALRYGRNHPKMRDLDSRIEAVEG
A0A6N6ZC77      TDDYQAAK------------RRLTQLKAERDQF----GRYLKPRHPKMISLGDEISRTEE
A0A7C5H7K5      SAGYLKVK------------QQLLLLKAEQIDL----GQYLRPKHPKMVALAEEISRRER
A0A538NJ59      TSERQGAS------------RDLELLKLQRERL----SKFLRPKHPKITQLDTQIQRAEK
A0A2A2R3V9      -SEYRNSN------------QQIQLLLLQRDEL----SQYLKPKHPKIIALNAEIQRQQT
A0A3C1VFY9      GMQYLSIK------------QQILLLKAEQDRF----GEFLKPKHPKMVAMNEESEKMGR
A0A2V2SMX4      QNDYFKAK------------QQIALMEAQKQDW----SEFLRPKHPKMVALDEDISRRRR
A0A522AC27      -ANYELTY------------QKRTVLLAEKERL----EEYLRPKHPRLIGINEEIAQQER
A0A6M1RFD0      -SEYLKVK------------QEIQVLKAEEQQL----SEYLRPKHPKMIALREEIQRKEK
A0A7C3HXH0      -SDYLKVK------------QEIQMLKAEEQQL----SEFLRPKHPKMIALREEIQRKEK
A0A1H2GQN6      ANIDQIRQ------------QELQGSANIQSLL----KGGFGEEHPRVQSLRAAVGRAQE
A0A512M3Y3      LEPWERTE------------RDLRVARQKREQA----AQTYLPGHEIMRNLDREITDLEA
A0A4P5R5J1      LAEYLKVK------------QAINQLKADRQEF----LQTLKPKHPAVVALDEQIAKNEA
A0A4P5YK43      APFRQNSY------------TEHKLNLKAREAEYFRYQATLKPKHPFLVSLQNEIQRTRQ
A0A2A2RPW6      SPEVAALK------------EKLQSHEAALSNL----QLRYKDKHPTMIQARNELSTLKA
B1ZT68          VSALRTRY------------AELQAQRKLL-------GEKYLRLHPKMTQNELETTETKR
W0J7C2          VADLNNSL------------ISLLTQRTLL-------AEHYLGEHPKMKQNEAETRETRR
B4D1I7          EMEYTHAR------------QQIEVLKSERAEY----AKDLRSKHPIMVELDRQIAQQQQ
A0A353F286      LPQNQVTA------------YALQN-RSAVDRMLDLEAQGIGKKHPDMVTMKQRAEGALA
A0A354FSA6      LPQNQVTA------------YALQN-RSAVDRMLDLEAQGIGKKHPDMVTMKQRAEGALA
A0A3B9GA54      LPQNQVTA------------YALQN-RSAVDRMLDLEAQGIGKKHPDMVTMKQRADGALE
A0A520LEH8      LPQNQVTA------------YALQN-RSAVDRMLDLEAQGIGKKHPDMVTMKQRADGALE
A0A6B2M0T8      MGTLPSKF------------ESRNNLLAERNSL----SLRYGRRHPRMIENASSLEGVET
A0A2D7B7R6      NEDFKSIN------------GLYKAAKTTVRNL----EVDLKSKHPLMIDALRNVNNTRR
A0A2E5K4P7      TTHVATLV------------ARNSLKKEELGLL----AARYRSKHPKMLQALQAQALVKK
A0A2V6F9Q9      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPRHPKIIKLNDEISKQEK
A0A2V6NZZ3      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPKHPKIIKLNDEISKQEK
A0A2V6EBU2      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPKHPKIIKLNDEISKQEK
A0A2V6EY06      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPKHPKIIKLNDEISKQEK
A0A2V6ME53      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPKHPKIIKLNDEISKQEK
A0A538NUU0      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPKHPKIIKLNDEISKQEK
A0A2V6NIJ1      EGDYLKAK------------QQVQLLKAERDTL----SLDLRPKHPKIIKLNDEISKQEK
A0A2V6C292      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPKHPKIIKLNDEISKQEK
A0A2V6D2X0      EGDYLKAK------------QQVQLLKAERDTL----SQDLRPKHPKIIKLNDEISKQEK
A0A2V5ZUK1      EADYLKAK------------QQAQMLKAERDTL----AKDLRPNHPKILKLNDEVAKQDK
A0A2V5XFN9      EADYLKAK------------QQVQLLKAERDTR----AKDLRPNHPKIIKLNDEITKQDK
A0A2V6EZC8      EADYLKAK------------QQVQLLKAERDTL----AKDLRPNHPKIIKLNDEITKQDK
A0A2V6I7Z5      EADYLKAK------------QQVQLLKAERDTL----AKDLRPNHPKIIKLNDEITKQDK
A0A3B9LCP2      EGDYLKAK------------QQLQLLKAERDTL----AKDLRPKHPKIVKLNDEISKQEK
A0A3C0R669      EGDYLKAK------------QQLQLLKAERDTL----AKDLRPKHPKIVKLNDEISKQEK
A0A2V6EID2      EGEYLKAK------------QAVQLLKAERDTL----AKDLRPKHPKILKLNDEISKQEK
A0A2V6MHB0      EGEYLKAK------------QAVQLLKAERDTL----AKDLRPKHPKILKLNDEISKQEK
A0A2W5YWL9      EGDYLKAK------------QTVQLLKAERDTL----AKDLRPKHPKILKLNDEITKQEK
A0A2V5NH62      EGDYLKAK------------QALQLLKAERETL----SKDLRPKHPKIIKLNDEVTKQEK
A0A2W6A620      EADYLKAK------------QTLQLLKAERETL----SKDLRPKHPKIIKINDEITKQEK
A0A2V5PIJ4      EGDYLKAK------------QALQVVKAERDTL----AKDLRPRHPKILKLNDEIAKQEN
A0A2V6K2G8      EGDYLKAK------------QQVQLLKAERDTL----AKDLRPNHPKIIKLKDEISKQEK
A0A2V5W206      EGDYLKAK------------QQIQLLKAERETL----AKDLRPSHPKILKLNDEITKQDK
A0A2V6MW77      EGDYLKAK------------QQIQLLKAERETL----AKDLRPNHPKILKLNDEITKQDK
A0A6N4WVA3      NQKYIQSK------------EQLQLLHAQLDEF----SIYLKPKHPKIIGLKNQIERTEN
A0A0R2XPB1      NQSYQLSK------------KQLQVLHAQLDEF----SIYLQPKHPKIIGLKNQIERTEN
A0A348NQP1      DQSYQYSK------------KQLQVLHGQLDEF----SIYLQPKHPKIIGLKNQIERTEN
A0A357FV58      DQSYQYSK------------KQLQVLHGQLDEF----SIYLQPKHPKIIGLKNQIERTEN
A0A2G4GZN8      DNDVAAAQ------------TAISGSKIRVSQM----TETYTDQHPKLVAEREALKQLER
A0A348NPT1      QGQVSQLL------------SQISAIKIGISSS----SKRYREKHPVMIEQQQTLQESEV
A0A2E1KV60      QIRVASLT------------EQISNIRIAMSTM----SKRYREKHPEMRSLLQQLQESQS
A0A2D7F4D9      QIRVATLI------------EQISAIRIAISTK----SKRYREKHPEMRSLLQQLQESQS
A0A3R7RBR8      QIRVATLI------------EQISAIRIAISTK----SKRYREKHPEMRSLLQQLQESQS
A0A2E0NH28      QSRVAFML------------QEVSKTKIEISSL----GKRYRSKHPVMIQLLQRLQESEI
A0A350AS32      QSRVASLL------------ESISQAKIQISSL----SKRYREKHPVMIQLLQQLQESEA
A0A368BGT4      QLRVSSLL------------QQISSTRISISSA----SKRYREKHPAMIELLQTLQEGEL
A0A6N6PLV8      KAGQSIGE------------FSIEEKRLL--------TSGVGENHPRVATLRGQLAVYRS
A0A2E0V4K6      ---------------------ALEVEEVKVADL----ARRYRGKHPKMIAASAKLAAAKG
A0A290QE54      IPAVSSQL------------SELTRQQSVL-------AQRYFERHPKMIELEKSIKAARE
A0A1H1SWX2      IPVLKNNL------------AELNKQQAIL-------SERYLERHPKMIELANSIDVVTA
A0A1D8AZK8      IAALKTQL------------AELQNQQSLL-------AERYLERHPKMISVANSIDVIAA
A0A4Q1C9I5      VAALKTQL------------TDLQNQQSIL-------SERYLERHPKMINVANSIDVLTA
A0A2E6NAH3      QSRVASLL------------QQVSSTRIEISSL----GKRYREKHPAMIQLLQTLQEGEL
A0A2A5VZA5      QSRVSRLL------------ESISATRIEISSY----SKRYREKHPIMIQLLQTLQESEI
A0A424R295      QSRVSRLL------------ESISATRIEISSY----SKRYREKHPIMIQLLQTLQESEI
B4CZV9          LLKSLHPW------------DELAQQQQQVKKEISEGLRKYLPTAGAMKPLYQQLDVINQ
A0A1G3ZL71      IPALRNQL------------SELLQTQKVL-------SDRYLERHPRMIELARQIATVRA
A0A556QP09      VPDLSKQL------------ETLNRDHSLL-------AERYLERHPKVINVVNAIHVAQE
A0A2T6DX88      IPAIRTQL------------ADLQRQQSVL-------SERYFERHPKMMDLARAIKVSQD
A0A2T6CWI7      VPSLRAQL------------STLQQEQNIL-------SERYYERHPRMIDVANRIDVTEK
A0A3E1E5C8      VPTLKNQL------------SNLHQNQSVL-------GERYLERHPKMVDLANQVTVVQD
B1ZZ74          VPTLSAQL------------SSLLQSQSVL-------AERYLERHPKMIDLANSIAIVQE
A0A3B9FM17      IPALRQTL------------YDLEKTRRDYEET----GSGYLERHPKMLENARSVQQVKS
A0A0E3YV65      FANLSAVQ------------SQLDTLRTQRATM----GERYGVRHPSMIENDRSREALER
W0J900          FSSLASVQ------------SQLDGLIAKKAVM----SEKYGRRHPAMVEQERSIQALEK
R7E4L8          DAGIAKQI------------ELFNDNFLQHKKL----FASAGRQNPMVSSLAENMKEMRE
A0A4Q3BVY2      EVDSIEPW------------RKLEKERRLLISQIRQNSTIYQPGHRVMKDLEKKLEDTER
A0A4P6PCA7      GLPKEQQL------------YELLGVWQTALDEFQRVSEKYTEKHPRYQEAKRAEERALS
A0A2T6DSN5      VGALRGEL------------ENLKAERRMLSET-------YLDEFPKMKENALATENTEK
A0A317ZIW7      NEKYTEAK------------NQLDQLKADLEEF----EIYLKPKHPKIIGLKDQIERTSN
A0A7C4PPT4      QMRWEDLQ------------REYEKLQLTSNEL----SKKYLPGHPKMAEVLKKMEEIKS
A0A7C4QZX4      TPPWEQLQ------------RDREQCKTALDEA----AKKYLPAHPKMAELLRKMDQINK
A0A2D7WMI4      IPALRSSL------------FELYKQRRDYQEV----GTGYLSKHPKMLSNARQIQDTYG
A0A2D6VHX5      IPSLRQEL------------LEHELQRKTYVET----GTGYGPNHPKMIENARQVQEVQE
A0A2D8I214      VPSLRKTL------------FDLEKTRMRYQEG----SPGYLERHPKMLENARQVNEVKN
A0A1Z8VL41      VPALRKNL------------FDLEKTRRDYQEL----EPGYLERHPKMLSNAKQVKDVKK
A0A2E6TNA4      VPAXRKNL------------FDLEKTRRDYQEL----EPGYLERHPKMLXNAKQVKDVKK
A0A1Z8RG47      IPSLRQTL------------YNLELTRKNYQET----GTGYLERHPKMMENARQVLEVKQ
A0A1Z8RJJ5      IPSLRQTL------------YNLELTRKNYQET----GTGYLERHPKMMENARQVLEVKQ
A0A2D7V631      IPSLRKTL------------YDLETTRKNYQET----GTGYLERHPKMMENARQVSEIKT
A0A354RA24      IPSLRKTL------------YDLETTRKNYQET----GTGYLERHPKMMENARQVSEIKT
A0A2E9RV62      VPALQKRL------------FDLEQSHKLY-------GQKYLANHPKMIETARQIKDVER
A0A2E4AY96      IAFLREDL------------QKLYSTRKNYQEV----GTGYLEKHPKMLANARQIRDTNM
A0A3B9B9P4      IAFLREDL------------QKLYSTRKNYQEV----GTGYLEKHPKMLANGRQIRDTNM
A0A2D5Y6N6      IPSLRQNL------------YDLESKRRDYQET----GSGYLERHPKMIENARQVQLVKQ
A0A2E7HSS8      IPSLRQTL------------YNLEKTRRDYEET----GSGYLEKHPKMLENARNVLQVKN
A0A2D8VCK3      IPALRQTL------------YDLEKTRRDYEET----GSGYLERHPKMLENARSVQQVKS
A0A350QVY4      IPALRQTL------------YDLEKTRRDYEET----GSGYLERHPRMLENARSVQQVKS
A0A2E4ZYR7      VQTLRQKL------------LDLETIRKEHE-------VKYLELHPKMSSNTRAIMELHR
A0A2E6TCV1      VNSLRTEL------------QEHEKTRKTYE-------AKYLENHPKMKENALAIGELHK
A0A3D4HHL8      SEQYLVAK------------KELNLLKAQRDEY----LTYMKGKHPKLAAVNLEIERKEN
A0A366HV03      MVEGLNSW------------QMLERDKRKVETEIAEASRVYLEDHEILKALRTKQRQIDE
A0A6G6K911      MVEGLNPW------------HTLERDKRKVETEIAEAARVYLEDHKVMKELRAKQRQISE
A0A5R8KAF2      MVEGLRPW------------QDLEKKRRVIEEELMEANKRYLPAHAIVKGLEEDLANNTR
A0A7C4LRZ6      ESKYAELE------------FKLRGLEMDYEAR----LKTLKPQHPFMVALQAGLDQVKR
A0A2V2SDN0      QSDLFRAN------------QQIRLLKDKRDEL----SKGLRPMHPKILKLNEDIAAQEK
A0A1V6GL40      DTAYLQAQ------------QQLLLLRVEQQEL----GRYLRPNHPKMIAMQEDIARREE
A0A2V5X6Z6      QLELFKAN------------QQMQLLKAKRDEL----SRFLRPLHPKILKLNEQIATQEK
A0A2V5VGZ7      QLELFKAN------------QQMQLLKAKRDEL----SRFLRPLHPKILKLDEQIATQEK
A0A2V5U130      QLELFKAN------------QQMQLLKAKRDEL----SRFLRPLHPKILKLNEQIATQEK
A0A2V6C237      QLELFKAN------------QQMQLLKAKRDEL----SRFLRPLHPKILKLNEQIATQEK
A0A3R8L982      YGTVPALR------------AQLAEHLRTQAVL----SERYLDRHPRMIEIDNSIRVTRQ
A0A6N6QBS9      SASYPALK------------FELRKLQALYLEK----GNNLRTNHPYMVDLARNVALKQQ
A0A2E7HPU9      -------------------------------------DLRYLSKHPKLIAAKNALEEYAF
A0A388PR45      DADVAAAR------------AKMTDAQTRVRAM----EEIYTDLHPKMIAERQALAQLSA
A0A388QR61      DVEVTNTR------------NKVAEETAKTRAM----EEIYTDLHPKMINQRQVLAQCVA
A0A4P5YHI0      DVEVTNTR------------NKVAEETAKTRAM----EEIYTDLHPKMINQRQVLAQCVA
A0A2A2RS01      DERVAALG------------PKVTELRVLVSTM----EKKYTDEHPTLIQTRAQLDQTQK
A0A2A2Y1A7      DERVAALG------------PKVTELRVLVSTM----EKKYTDEHPTLIQTRAQLDQTQK
A0A388PDH9      DERVAALG------------PKVTELRVLVSTM----EKKYTDEHPTLIQTRAQLDQTQK
A0A2G4H1E7      DTDVATTL------------TALSASKIRMSQM----TEKYTDQHPTLVAEREALNQVDR
A0A2G4GZA6      DTDVAAVQ------------MVISASKIRVSQM----TETYTDQHPKLVAEREALKQLDL
A0A388P514      DSDVAATQ------------TAISASKIRVSQM----IETYTDQHPKLLAEREALKQLDN
A0A2A2YG59      DSDVAATQ------------TAISASKIRVSQM----IETYTDQHPKLLAEREALKQLDN
A0A2G4F7D5      DSDVAATQ------------TAISASKIRVSQM----IETYTDQHPKLLAEREALKQLDN
D5EML0          RDAVNAVY------------AQLSELKRERLVL----DERYLRKHPKIVENEAAMKSVST
A0A7C4PPJ4      RLLSESKY------------AELEFRLLSKQDEVKKYSATLKPQHPFMQNLLAEVAKLQR
A0A3C1C1M3      AADVAASL------------DRWRQAMTERDALL---SR-YTPEHPAVEAQDKAVALYKE
A0A2E9EYJ1      NETLNSGW------------SEYQTLELSRAALI---XSGVGVKHPKIVNIDSQLNLRMN
A0A258AXR6      NQNITAIT------------VKLQDLKVAREGLV---NEGRGRLHPQVLSVDSQMAEYQS
A0A3D3NZQ6      NANVAQMT------------GELQRLEVAREGLV---NQGRGRRHPEVLANDSQITKYKE
A0A1T4WVZ9      NANVTNML------------AELTRLQVTREGLV---NAGRGRRHPEVMGVDSQIALSKQ
A0A4R7SSI6      NTNVTGMM------------ADLNKLQVTREGLV---NAGRGRKHPEVIGVDSQIILSKQ
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      LIELFRNQSR---------EQIAAAQQVLKLKMNGIQTSIKE----SLGKVLAANDR--I
A0A258AXL1      SLDAEWKKQI---------ASFHLEKEHLQQRLESLQDKLPE----YRKLIAGYDDF--R
A0A2E6T1E0      GLASSQKRIF---------DSIINKAELAKATALNLKGVLEI----RKSEQQAMNQK--S
A0A2D5W0Q9      -------------------PNIKSQSLVERDLQAHLHPQSNA------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      AANKALSNYR---------SNLDLKLNQLIDKRNSLTERLTE----TAIK---------E
A0A2V6N5E0      LIQLFRADAL---------EKLKTRRESIGKQMENLQANIKE----WEAKALDLSQR--L
A0A2V6NH44      LIELFRSDAF---------EKLETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--L
A0A432FDF6      QIDNRIKGIL---------AGLGLRVNSSQAQVEQLQRDVDA----AKKRESDMRKT--G
A0A522ACN3      KIEARVSGIM---------YSLSNQVEIARSEVGALKRQVED----AKRVDRDKAEK--C
A0A353DCA1      MV--------------------------------------RE----KKDGTVDLSMR--Q
A0A3C1AXQ2      LILDAVKSHL---------SALQTRMDFAIKRRASLQNSNED----AKKGMLDQQSA--Q
A0A3D0IZR7      -----------------------------------------------MRGQLRADRSDRL
A0A520LRZ3      ------------------------QLSMAEQQFQNSKETKEK----TEKASLKERKD--N
A0A356FSV4      ELTEAVTNST---------DKIYAAYIEAKRNFEVSSQRLAE----KENELIQLSKT--R
A0A3D3DET9      LLKILRTQSE---------EQLKNRKELLAVEIEILEKDLKA----WDARNQEFQHK--N
A0A355SVK9      --------SV---------GKVDSAYAEAKTNFELASRRLAE----KESELIQLSKT--R
A0A2E5D7I3      ----------------------------------VELKEVQS----NESEGLATARRLLL
A0A2V5NYE2      LLPIYREQSN---------EQLTNKLNSLDMQIKNRRKDIKE----QEEQVLEINRK--T
A0A2V6FIP7      SIQKESQKVR---------QAIRAEAELAKAKETTMASELKK----KEQESFELSQL--R
A0A353DI77      ILLSAMMDVLSNDLETDYWRGFQDQIDDVKNEENFRELRNAM-----------------K
A0A1V6GCZ3      KIKSRVEGIM---------LGLDTRVLSLSNSLVNLQQEVGR----ATTNDVTQANL--T
A0A3C1UJT2      VLLETISDVP---------KGLYAQIKYQQEFIEELTQSIEN----QTSKLFEWEQL--Y
A0A2S7U0Z3      SFGGAIKRSSGKPSEKSYWLEYKDEMDALEKIIDGDGPDKSD--AADKWVLLSQGAL--A
A0A5E6MKA7      ELAQEKEGSV---------ADLEADFEAAKANYEGLEQEFQH----SMEKVRGESKA--L
A0A6B3L936      RFRLEIETAARTGDEVDYWKPLMADVDRLDKQIASAESEADRRDATDRWLSFVQNKL--S
A0A2N8IR72      AANKALSNYR---------SNLDLKLNQLIDKRNSLTERLTE-----------TAIK--E
A0A2N8IV96      KLNKELIGLR---------SSLKSKLEMVAASRKHWEATVAQ----KEEDLQKHVLQ--V
R7E1V8          KLNKELIGLR---------SSLKSKLEMVSASRKHWEATVAQ----KEEALQKHVLQ--V
A0A2E0R252      NFSKELDQVI---------RLSDEEKAFWEQHSESFSSMDAD-----TRIDSQIQIA--S
A0A3E1EF48      RFSTELAQVI---------AGSAEEQRFWKENASVLAGLEGE-----ALIAAQLRTV--A
A0A2A2PVG8      RFVQEFNQVM---------NLSEEERKYWETSLASLQGAPME-----ALTNAKRQVV--S
A0A2E0R421      RFSAELERVL---------RLSEEERQFWEDAGTSIADVEGE-----ELATDQMQIV--A
A0A2E5EJ69      RLQEAILAAP---------SKVHTTILTLSSQIDSQQGRLEA----QEKKVAADQQK--E
A0A2G4I5Z5      QFEVEVLKAP---------LRLNQQLQAAIDKEKGLELAVKE----QEKKLSLLNSQ--R
A0A4P5QQV6      LIDTFRKQST---------EELKRRRDATTLEIRNLETTVKE----WEAKAASNSER--L
A0A1T4WWY4      ALDIELKVAL---------TSFDLEKARLTEKLEELDGKLPE----YHKAIKSYDTK--K
A0A3D3LEQ6      ALELELQVAR---------RAFDLEYEKLKEQLVELEAKLPD----YYKAAKSYDEK--K
A0A3D3NW23      ALELELQVAR---------RAFDLEYEKLKEQLVELEAKLPD----YYKAAKSYDEK--K
A0A2E7ALI1      KFMSEFLVAA---------SSAADKSYWEGAGAELQQIANDE----EAGLASARRLL--L
A0A178IDB9      RLDAAVDLAI---------AETHARLNLARQHEQRLRSEYAA----AEKQAQDLDRI--T
A0A290QD69      GFKSAVDLAI---------AELKNRFNFAKQHELRLRTDYAE----TEKQAQELDKI--T
A0A2E7VDS1      LLRLEVKTAI---------KDLTNRVSEMASQESEFTKAMDA----VQRESQKLDDI--E
A0A7C8D3W3      QKNRLLVLAT---------TELDNSIHSLKTTQKLLKSQIKNREEELKIALIKQQEL--Y
A0A178IFJ2      LRGDLILTAV---------ANLRNQREKALENERQLQRQLAD----SEKASLALDRQ--A
A0A357FSP9      ELAAAVKDSV---------DKLSSALVEAKSNFELASQRLAE----KELELIKLSKT--R
A0A2A2R174      QFEAEVLKAP---------LRLGLQLQAAIEKEKGLEAAFKE----QEKKLSDLNAR--R
A0A1H2DTI1      SITLSKEQNI---------EEANVRRETLALEIQHLEAMVKE----YEPKAISLGAK--L
A0A1H1MGC9      ELSRAIDSTA---------AMFEADFQTAKRNDEEARANLVR----QESESLELDRY--A
A0A1V5L462      RIRIFRAQAF---------GQIEEEKSALRNRIDTLLPEINK----WEEEVIQYSLG--V
A0A3D3LGD3      LIAAAAKDHL---------AGLQNRLESARKRKEALEASNQD----AKSELLGQQSA--F
A0A350ARX4      LIDILERQTT---------DSLDDRKDQLRRQIQNLDAVIAQ----WEKQALSISRK--S
B5JIS2          NLNRNMEMAL---------KDLEGQYTNVVSLEKRLDDDFRK----KFTESIEVGRL--A
A0A6N6ZC77      LMEIYREQAE---------QQMGDRKQELKAQLENLNIIISE----QEKVALENSRL--S
A0A7C5H7K5      LLEIYKQQGL---------EQLESRKNSLAIQLKNLEKEAAE----ANAKALEVNAK--M
A0A538NJ59      LIELFRNQSR---------EQIAAAQQVLKLKMNGIQTSIKE----SLGKVLAANDR--I
A0A2A2R3V9      LLDMFKKQSI---------EQLNNRREGLRLQIQNLQELIKS----EEVKALDVNRR--M
A0A3C1VFY9      LLGIYRDQSV---------EQLEAKKSALALQIKNLENQTKQ----WGRQNIELGHK--S
A0A2V2SMX4      LLGIFKDQSS---------EQLQTLQKTLELQIANMERDVRE----WDAKCLEISRK--T
A0A522AC27      LLNTYRKQTS---------EYLENLKKSLELQITNVEKDVVE----WDAKNLSISQR--T
A0A6M1RFD0      LLDIVREQSA---------EQIENRKKSLQLQIENLQKEIKQ----WEARALEASSK--M
A0A7C3HXH0      LLDIVREQSV---------EQIENRKKSLALQIENLQKEIKQ----WEARALEASSK--M
A0A1H2GQN6      QLKSLAEGKR---------RALLIDLNVSEEKLKLLEADVASL---RDKLRQEKSDK--M
A0A512M3Y3      SLSSEVNTAI---------TSFRLQKEQMAARMQELSKKMPD----YRRVLNDFDHY--K
A0A4P5R5J1      MLGTYKQLGQ---------DAITSRRGAIKTQIESLDDNIKT----WETKALDLAKR--V
A0A4P5YK43      ELQFQLDNIE---------ERRRAEIEKLRKDEIGLRPRVEE----MRREVFEKSTV--L
A0A2A2RPW6      QFEVEIRRAP---------ERLKLMREGAMAKEKKLEQELRE----QEKKLGQLSLL--R
B1ZT68          LLDEAAAQAI---------ANLETRNRIAAQHEIRLRAELEQ----AERSAHELDKT--S
W0J7C2          MLAESIAKAV---------ADLRARYDVSAHYLQRLQAETTG----SEAQARELDKI--S
B4D1I7          LIDAFRKQSA---------EDLQHRREATRLEIENLEKTIKE----WEAKALDLSQR--L
A0A353F286      KAHEEVISLK---------EVLKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--Q
A0A354FSA6      KAHEEVISLK---------EVLKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--Q
A0A3B9GA54      KAHEEVISLK---------EVLKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--Q
A0A520LEH8      KAHEEVISLK---------EVLRTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--Q
A0A6B2M0T8      EIQAALEKNV---------SDFVQQHSQLKARVSNLEEALTQ----AEQESLELDQV--A
A0A2D7B7R6      VLLETISDVP---------KGLYAQIKYQQEFIEELTQSIEN----QTSKLFEWEQL--Y
A0A2E5K4P7      ELDNAILMAR---------NKAEAEHLLATVHYKEAQRDVAI----KEQEYLALEKN--R
A0A2V6F9Q9      LIAVFRADAV---------EKLETRRKSIGKQMENLQSNIKE----WETKALDLSQR--L
A0A2V6NZZ3      LIDLFRSDAV---------EKLETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--L
A0A2V6EBU2      LIDLFRSDAV---------EKLETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--L
A0A2V6EY06      LIDLFRSDAV---------EKLETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--L
A0A2V6ME53      LIDLFRSDAV---------EKLETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--L
A0A538NUU0      LIDLFRSDAV---------EKLETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--L
A0A2V6NIJ1      LIELFRSDAV---------EKLETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--L
A0A2V6C292      LIELFRSDAV---------EKLETRRKSIGKQMENLQGNVKE----WEVKALDLSHR--L
A0A2V6D2X0      LIELFRSDAV---------EKLETRRKSIGKQMENLQGNVKE----WEVKALDLSHR--L
A0A2V5ZUK1      LIELFRADTL---------ERLKTRRESIGKQMENLQGNIKE----WEAKALDLSQR--L
A0A2V5XFN9      LIELFRADTL---------EKLKTRRESIGKQMENLQANVKE----WEAKALDLSQR--L
A0A2V6EZC8      LIELFRADTL---------EKLKTRRESIGKQMENLQANVKE----WEAKALDLSQR--L
A0A2V6I7Z5      LIELFRADTL---------EKLKTRRESIGKQMENLQANVKE----WEAKALDLSQR--L
A0A3B9LCP2      LIDLFRADTV---------EKLETRRKSIGKQMENLRANIKE----WEAKALDLSQR--L
A0A3C0R669      LIDLFRADTV---------EKLETRRKSIGKQMENLRANIKE----WEAKALDLSQR--L
A0A2V6EID2      LIDLFRADTV---------EKLETRRKSIGKQMENLQANIKE----WEAKALDLSQR--L
A0A2V6MHB0      LIDLFRADTV---------EKLETRRKSIGKQMENLQANIKE----WEAKALDLSQR--L
A0A2W5YWL9      LIQLFRSDAV---------EKLETRRKSIGKQMENLLGNIKE----WEAKALDLSQR--L
A0A2V5NH62      LIELYRQDTV---------EKLDTRRKSIGKQMENLQTNIKE----WETKALDLSQR--L
A0A2W6A620      LIELYRQDTV---------EKLETRRKSIGKQMENLQTNIKE----WEAKALDLSQR--L
A0A2V5PIJ4      LIKLFREDSI---------EKLDTRRKSIGVQMENLEKSIAE----WEKKALDLSQR--L
A0A2V6K2G8      LIELFRADTL---------EKLKTRRESIGKQMENLQTNVKE----WEAKALDLSQR--L
A0A2V5W206      LIQLFRADAL---------EKLKTRRESIGKQMENLQANIKE----WEAKALDLSQR--L
A0A2V6MW77      LIQLFRADTL---------EKLKTRRESIGKQMENLQANIKE----WEAKALDLSQR--L
A0A6N4WVA3      QLKIHRAQAL---------ERIAERQQVVGNQIKNLNAEIEI----WEKTALENGRL--I
A0A0R2XPB1      QLEIQRDQTL---------RRIRERQSVLNNTAANLTLEIAI----WEKSALEHGRL--I
A0A348NQP1      QLEIQREQTL---------TRIRERQSVLNNTAANLSLEIAI----WEESALDNGRL--I
A0A357FV58      QLEIQREQTL---------TRIRERQSVLNNTAANLSLEIAI----WEESALDNGRL--I
A0A2G4GZN8      QLKEATTQAI---------KSRRSSLDNAKARHEAILRNLLA----KEEEISRLQAA--N
A0A348NPT1      ELAAAVKDSV---------DKLSSALVEAKSNFELASQRLAE----KELELIKLSKT--R
A0A2E1KV60      ELDYAVQNAV---------DNLNASFKEAKDNFAQASKRLVE----KERDMIELSKT--R
A0A2D7F4D9      ELEYAVQNAV---------DNISGYFAESRDNFKQASKRLLE----KEREMIELSKT--R
A0A3R7RBR8      ELEYAVQNAV---------DNISGYFAESRDNFKQASKRLLE----KEREMIELSKT--R
A0A2E0NH28      ELTEAVTNST---------DKIYAAYIEAKRNFEVSSQRLAE----KENELIQLSKT--R
A0A350AS32      ELSSAVQNAV---------NKLDSSFSESKSNYEVASQRLAE----KEQELIELSKT--R
A0A368BGT4      ELELAVQNSV---------DKIYAGYSESKSNFEMASLRLAE----KERELIELGKT--K
A0A6N6PLV8      QLQIALNGQL---------SAIANTYALENKKLADTKASAED----TAKRVIEEKTK--M
A0A2E0V4K6      SFLEEFLVAA---------RSPVDKSYWEGVSDQLGTIKDGG----EAEVAIARRLL--L
A0A290QE54      QLTRATDLAI---------ADLHASLEKSRANEKSLEQEYAL----NEKEQIRLRDL--S
A0A1H1SWX2      QITRNIEQSI---------SDLRTQYVKLQDTEASYIKEYQA----AEKDNLRLGDL--S
A0A1D8AZK8      QIQNDIAQSL---------SDLRTQYTKVKETEASYQKEYKE----AEMGQLRLGEL--S
A0A4Q1C9I5      QIKTDIAQAI---------AALRAQHETLKQTEASYVREYKE----AEKEQLRLGEL--S
A0A2E6NAH3      ELSRAVQNSV---------DKIYAGYSESKSNYEVASLRLAE----KEKELIELGKT--K
A0A2A5VZA5      ELQEAVTNSV---------DKLYASYIEAKSNFELSSKRLAE----KESELIALSKT--R
A0A424R295      ELQEAVTNSV---------DKLYASYIEAKSNFELSSKRLAE----KESELIALSKT--R
B4CZV9          RLDAEVEVAT---------NRFNLEYQELLNKKHDLEAKLPE----YQELSRKHAKL--L
A0A1G3ZL71      DLEKSIQLAV---------ADLSASLEKARDGEQTFEKEYAQ----HEKDQIKLNEL--K
A0A556QP09      QLDTAIRLSI---------ADLKTSLERAVAREKTLEKEYAA----QEKEQLRLRDL--S
A0A2T6DX88      QLASAIDLAI---------ADLQASLEKARANEKSLEQEYQL----HEKEQMHLRDL--A
A0A2T6CWI7      ELAKAVQLAI---------DDLRARQAEARQAYESFSAEFAQ----REKDAMRLGEL--R
A0A3E1E5C8      QLEKAVDLAV---------ADLATQLSEARQSEANLQTEYDR----AEKESLHLGDL--S
B1ZZ74          QLGKALDLAI---------ADLGTRLNEARENERTLQEQFAK----AEKESLDLGAL--A
A0A3B9FM17      ALRQSVTSAI---------EDLRDKHIQLSAQEKEFADEMEK----VQKQSEQLSEI--E
A0A0E3YV65      LRTELITAAM---------SNLRNQRAKALNEETQLQSQLAQ----AEKESFRLDEM--A
W0J900          LRGDLVRAAL---------STLRNQREKAVENERQLQEKLAD----AEKASLGLDRL--A
R7E4L8          SIGRSIANYC---------NALEVRMGELEKERNELNRLLSD-----------MASK--D
A0A4Q3BVY2      ALETEFKMLR---------QKFDLNFAGLTEKEKQLEARVPE----YHAITEQVGKS--S
A0A4P6PCA7      RLDQFVEVSW---------KAIQNELTLLKTKISQMQSRMENIETELRDLDKQIADG--K
A0A2T6DSN5      RLQANIELAI---------AELRSRYEVAGQHEKRLRQDFAD----AEKRLQELDRA--T
A0A317ZIW7      QLEILRRQAF---------ERIGERKLVIERRIDNLNDEIAI----WEQSALENGRL--I
A0A7C4PPT4      ALEAELRAAQ---------QTYNLEYVSLKQKKAELQQRLPE----YEQALLEQKMF--M
A0A7C4QZX4      SIEAELAGAQ---------KQYALEQASLREKKAELMAKLPE----FEKVLRDSERL--R
A0A2D7WMI4      RINKQVKDAI---------FDMDNRKLQLQALANDFTVAMTT----VQDEANFLSKI--D
A0A2D6VHX5      LLRKEVTLAI---------EDLRDRHIQLDAQEREFMGAMDK----VQTESRRLGHI--E
A0A2D8I214      SLIKEVTSAI---------EDLKDKRVQLTAQEKEFQQAMEK----VQQDSMKLSEI--E
A0A1Z8VL41      ALALEVKSAI---------DDSRDKLLELQHQEGEFTMAMQE----VQSQSNELSEI--E
A0A2E6TNA4      ELAXEVKSAI---------DDSRDKLLELEHQEGEFTKAMQK----VQLQSNELSEI--E
A0A1Z8RG47      SLNLAVKSAI---------EDLRDKYIHLVAQENEFAKAMQK----VQEDSRKLSEI--E
A0A1Z8RJJ5      SLNLAVKSAI---------EDLRDKYIHLVAQENEFAKAMQK----VQEDSRKLSEI--E
A0A2D7V631      TLNLEVKSAI---------EDLRDKHIQLNAQEKEFATAMQK----VQEDSRKLSEI--E
A0A354RA24      TLNLEVKSAI---------EDLRDKHIQLNAQEKEFATAMQK----VQEDSRKLSEI--E
A0A2E9RV62      ILQLEVKASI---------EDLKNSYHQLEAQEQEYANEMDK----VQVEAVELSEM--E
A0A2E4AY96      QILSEIRNAI---------SDLYERENQLLALEDKFSIAMND----VQIEAKDVSLI--D
A0A3B9B9P4      QILSEIRNAI---------SDLYERENQLLALEDKFSIAMND----VQIEAKDVSLI--D
A0A2D5Y6N6      ALNKEVKSAI---------EDLRDKHIQLTAQEKEFASAMAK----VQEESRTLSEI--E
A0A2E7HSS8      ALKDEVTSSI---------EDLRDKHIQLSAQEKEFGDEMAK----VQLESEKLSEI--E
A0A2D8VCK3      ALRQSVTSAI---------EDLRDKHIQLSAQEKEFADEMEK----VQKQSEQLSEI--E
A0A350QVY4      ALRQSVTSAI---------EDLRDKHIQLSAQEKEFADEMAK----VQKQSEKLSEI--E
A0A2E4ZYR7      LLRLEVKTAI---------EDLTNRVSELASQEREFTKAMLA----VQKESQKLDDI--E
A0A2E6TCV1      ILLNEVQVAI---------EDLTNQKNELNVQKAKFVYLREK----IKKQAQQLGQK--E
A0A3D4HHL8      EMSVLKRQAL---------HELKDEKEVLQSKISHLKDVIDE----QEVKALDYSRR--L
A0A366HV03      SLTTELEVER---------KRFEVERLRLGDQLKELEAKLPE----YSEMTEKLNKL--R
A0A6G6K911      ALTTELDVER---------KRFEVERLRLGDQLKELESKLPE----YSEMTEKLNKL--R
A0A5R8KAF2      ALAAELEVMR---------RRFELDFQQQTQKIATLEKRLPE----YYQTNEEAGLA--G
A0A7C4LRZ6      EMQFQVELIE---------EKRKAKVESLRRDEESYKPLIEN----LRKQVFESRGV--Q
A0A2V2SDN0      LVEGSRSEVM---------KQLVNRRDGLQLEVKNLEKVFRE----WEGKALEASRK--M
A0A1V6GL40      LLKILRTQSE---------EQLKNRKELLAVEIEILEKDLKA----WDARNQEFQHK--N
A0A2V5X6Z6      LVQISRDEAL---------KQLAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--M
A0A2V5VGZ7      LVEISRDEAL---------KQLAHRRRAIELQVQNLEVAFKE----WDAKAIESSRK--M
A0A2V5U130      LVQISRDEAL---------KQLAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--M
A0A2V6C237      LVQISRDEAL---------KQLAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--M
A0A3R8L982      QLAAAIALAI---------ADLQATLEKARAREASLAIEYTA----NEKEHLRLRDL--S
A0A6N6QBS9      EIDEALRMAD---------EGRRATIRRLRMREDAYPKLILE----LEEEVFEKNSL--E
A0A2E7HPU9      RFLREFDQVR---------KAAADKSYWDKNKSEWDKQDLDQ----LSRLQVARRLL--T
A0A388PR45      EFQRAVKTKA---------DSLAAAQVDLRAKLDNAVEILRQ----KDEAINRLQAA--A
A0A388QR61      EFKRSVNTKA---------DSMQTTWLDLQAKLANSVEILRQ----KDEAINKLQAA--A
A0A4P5YHI0      EFKRSVNTKA---------ESMQTTWLDLQAKLANSVEILRQ----KDEAINKLQAA--A
A0A2A2RS01      ELTQAVANSV---------NRIQASVQNARSSYDAIVANLER----KDDEIYRLQAA--N
A0A2A2Y1A7      ELTQAVANSV---------NRIQASVQNARSSYDAIVANLER----KDDEIYRLQAA--N
A0A388PDH9      ELTQAVANSV---------NRIQASVQNARSSYDAIVANLER----KDDEIYRLQAA--N
A0A2G4H1E7      QLREAVVQAV---------KSRRASLENAKARHEAILRNLVA----KEEEISKLQAA--N
A0A2G4GZA6      QLKESISQAI---------KSRRSSLENAKARHEAILRNLVA----KEEEISKLQAA--N
A0A388P514      QLKEAVSQAI---------KSRRSSLENAKARLEAILRNLLA----KEEEFSKLQAA--N
A0A2A2YG59      QLKEAVSQAI---------KSRRSSLENAKARLEAILRNLLA----KEEEFTKLQAA--N
A0A2G4F7D5      QLKEAVSQAI---------KSRRSSLENAKARLEAILRNLLA----KEEEFSKLQAA--N
D5EML0          ELSRAIRQAE---------QQSTIEYQTVQKEVSDLTARIQE----TEGRVLVAERS--L
A0A7C4PPJ4      EMQYQLDLIE---------DKRLARIESLKRDEESYKPLIED----LRRQVFESRNI--Q
A0A3C1C1M3      QANQALNRAK---------NTAAANLALYQEQAGSLQKKNEELLETASKLDRDILEG--E
A0A2E9EYJ1      QLLDAVETHK---------KALTTQLAMAEQQYENSKESKER----TEKMSLQERKQ--N
A0A258AXR6      LILGAAKAHV---------AGLQNRLDASRKKRESLKIYNDD----AKQELQNMSSL--Y
A0A3D3NZQ6      LIAAAAKDHL---------AGLQNRLESARKRKEALEASNQD----AKSELLGQQSA--F
A0A1T4WVZ9      LILDAVKAHL---------AALQTRLDFSIQRRETLRSSNEE----AKSEMLDQQSA--Q
A0A4R7SSI6      LILDAVKSHV---------AALQTRLEFAIKRHTALQSSNED----AEKEMFDQQSA--Q
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ---------------------------------------------DLATAQMAPIKPKKM
A0A660Q3A0      -EYENLQRSVSRLQALYDLVFNRLKEVDVSIGIEPER----IRIVERAEVPTSPVTPRKL
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ADAERMKMNISRIQFHYDRVVNLLQNVDISRNIDQGT---LAILD--PASEAVRSYKQDV
A0A258AXL1      RDYKLQSSGHLAWEAAYVGMKGRLAAMDYTGPEVQVE---FQFKGFTDVRDDIPVSPNKQ
A0A2E6T1E0      IQYFALEREAKQSETLYNLALQRLKETELQEKDIVQN---MHVIDLATAQMS-PIKPKKL
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------NRALYESVLKRLSETNVSNDIAVSN-MQIMQSAERPRSPDAPN---IP
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      QEIIPLIREHKVKEELYLMLLSKEQENALAMAVTESN-ARVLEAAHGPNLPISPK---TI
A0A2V6N5E0      AQFNRIKGKVDRLKTLYDRLTTNLKDIDVSQVTGSEDQVSIMEMATPPISV-RPG---LI
A0A2V6NH44      AQFNRIKGKVDRTKLLYDRLTNDLKSVDVSQVIDTGDQISIMEPATPPVSV-RPG---LL
A0A432FDF6      REYFDAKRELSNTTRIRDTILFRIMQEEVDLALPKESTVEITDDADLPIKAVRPN---IP
A0A522ACN3      RPYFEKKRELEEAIRLRTILNMRIAQERTDINLPHTTMVEIIDRATPGARPVRPN---KP
A0A353DCA1      HQYNSAKEEYEQSRMMYREMSVKQQQQRVLLKMPRTP-ITLHERAKKAKAPAYPN---VT
A0A3C1AXQ2      NDYKTAADEVAYIESLLLQLKSTYFQTKAELELVKSP-ATIYAIATPEGKPAKPN---VA
A0A3D0IZR7      APYNEARRDFETQSQLLEVLMSRYRQQSVESRIETRP-VQVVNRAEPAVRPVKPS---LK
A0A520LRZ3      INYIEAKKEYELSKEMLNGMQSKLAKEKIDAAGQRTP-MVIHEIAEAADPG-NPARPNIK
A0A356FSV4      VDYNTLYREFEVQQGFLTAIVSRMTMQKAQINLKNPN-ARIVDEALPPLRHSSPN---LF
A0A3D3DET9      AEYQALKANVQRIRALYDQLLATMQTLDVNKEISPES-VETIEAASPA----YAARLDLW
A0A355SVK9      VEYSSLERELNVQQGFLQALVSRLTEEKAQVTLKNPN-SRVIDEALPPMRHSSPN---IP
A0A2E5D7I3      ARTQVLDGETKSRMSVFNSILVALEESKVNSIDEEVI-AELHSRAAPSDSAVFPNRLRVQ
A0A2V5NYE2      AEWQRLKDNKQRIQAAHDSLQATMDKLDVGKEAAPES-VTIHQKASPA----VPNRPQLS
A0A2V6FIP7      IQYDVLSRQADQSKLLYNIVLQRMKETDLTS---KDK-AQNMRVVDKAVVPMNPIKPRVV
A0A353DI77      LRASLLTNSVETKNELYNTLLSRVGVLKTDA---EGV-EAEVIKHEDAPRAWAPFSPNRK
A0A1V6GCZ3      RPYFEAKRALEELQRFRQVLDAKIAFEKIDVEL--PK-TLMVEVVDRAMPGLRPVRPNKP
A0A3C1UJT2      MQQAALEQDLEIGTKLIDNIKDQIQSIEFT----AES-EGTTIELAEKATEPSTIEPNKT
A0A2S7U0Z3      SRAKLLNNTSEQTRDKYQSISQRMTEIDVA----DNQ-SMNNLKVVEPAFIGLAKESVRL
A0A5E6MKA7      AHYALLKREADTDREMYSSVMRRMRETDITSAL---N-ASNVEVVESAEVPNMPSRPKKA
A0A6B3L936      SRASVLESRIGSLRGRYETFTRRLAEIDVADDEGVNS-KVRVNEAATIP---PPSKYKHL
A0A2N8IR72      QEIIPLIREHKVKEELYLMLLSKEQENALAMAV---T-ESNARVLETAHGSNLPISPKTI
A0A2N8IV96      PMYEQASRDYDAALDQLKELDSRYKDEIARLRV---P-REAIEMYQLPTYPAAPYKPNVT
R7E1V8          PMYEQASRDYDAALDQLKDLDSRYKDEIARLRV---P-REAIEMYQLPTYPAAPYKPNVT
A0A2E0R252      TRASVLERELEAEQQIYDNLITKLKEGNVSKGF---D-SKQFDVVQPPSLPANPTGPNKK
A0A3E1EF48      SRASILSKALETEQGIFENLNTKLKEADVTRGI---A-TRQFEIIQPPTLPGGPIAPSMN
A0A2A2PVG8      TRSNVLERELEAEKAVYDNLILQLKEGNVTRGF---A-SRQFEVVQPPTMPAAPVAPIKT
A0A2E0R421      TRSRSLGRELESEQDIYNNLIAKLKEGNVTKNF---A-GKQFDIVQPASLPGGPIGPNKK
A0A2E5EJ69      IEYKHLKAQAESLQAMYQRVLGAKQESSVTEGI---Q-NRTVEVYNPASLPGAPVSPRKS
A0A2G4I5Z5      SGFDHLQAEVMQNRKLHDTVIQRLKELDIVSG--NKN-KNEVRIIEPASLPLTPIRPNKK
A0A4P5QQV6      TQHAGIQAGISRMRAQYENLSRSKGSVEITRNV-----DQEIISVRQKATPAQTARFGVA
A0A1T4WWY4      LDYDLMEKSQLAWDKAYEKLSQRIESLEFDGD--KAP-LSLEFRGFTNLRSEMPVSPNKS
A0A3D3LEQ6      LAYELMEKGQLAWDKAYEQLSRQIEGLEFGSD--ESA-VSLEFRGFTDIRSEAPVSPNKS
A0A3D3NW23      LAYELMEKGQLAWDKAYEQLSRQIEGLEFGSD--ESA-VSLEFRGFTDIRSEAPVSPNKS
A0A2E7ALI1      ARTQVLDGETKSRMSVFNSILVALEETKVNS---IDD-EVIAELHSRSAVPSSPVFPNRL
A0A178IDB9      IDYKFLEEDAVSKRQAYNSILSRLNETTIVSQL---E-NVNIKVLDKALVPGAPSNSPSS
A0A290QD69      SEYKYIEDESNIKSKNYQDILSRLSEISIISQL---D-NVNITIHDKALVPGFPDTGTPK
A0A2E7VDS1      TRINEMTREKEIHEKTHDIMLNRLNEVKVTRAL-PQE-DDPLKRDSPAVTPTSPFEPDKS
A0A7C8D3W3      QKFNEIENA-----------KNRLEEYTQLLAFFQEE-PESEFYEILASGVVEKIDPQRV
A0A178IFJ2      VEYNVLRREAETNRATYTQVLSRLNEASLTAQL---G-NSNIKIAERARPPTVPLEPNPK
A0A357FSP9      VAYSSLQREMDVQQGFLQALVQRMTQERAAVNL---K-NPNSRVIDEALPPLRHSSPNIV
A0A2A2R174      SGYEHLQADVTLHRSLHDAVIKRLRELDIVSG--DKS-KSEVRVIEPANLPLTPIRPNKK
A0A1H2DTI1      AEFERLKSKRSMDQSLYESLLQSVQKIDLNRRL-----DEQRFTLMEPPSDATSIKDQYQ
A0A1H1MGC9      VEYSNLVRDYDINEHLLNSILGRMRETSMSSTI---E-TQSARVVDRAAPALKPFSPNIP
A0A1V5L462      ADLETMNSNLSRLLSTRESLIRRKERLDIGRNV-----DTELISVLVPATSAVLRQVDKR
A0A3D3LGD3      NEYKTAKDDVTDIEAILRTLKTRYFETKAGLEI---F-KSPATIYAKAEPEGRPAKPNVA
A0A350ARX4      AEFERLQYRLDRSRNTYQRLLDSIQAIQSNQNI-EQD-TIGILAHASRA---GVQPPQVG
B5JIS2          DQFLVIGSEVDAKREALTSLLRRVSNANVVSNL-----PVDVMRVVDPAFIAKPKLAKRK
A0A6N6ZC77      AEFERLQANLERFRNQHETLLRSLQTIETGQDI-----STEIVSVLERPQYFGETRMSLQ
A0A7C5H7K5      VEYQRIKNNLQRVQALYDRLLGTIQNLDVNLKI-TPE-SVTILEDASEA---KPARFGIG
A0A538NJ59      ADAERMKMNISRIQFHYDRVVNLLQNVDISRNI-DQG-TLAILDPASEA---VRSYKQDV
A0A2A2R3V9      ADYQRMKSKRQRLQAFYERLVSSVQSVDLSQNI-DQE-MISIMEHPGLA---QPVHVGMS
A0A3C1VFY9      AEYASLKAKSQRLQALYDQLLATFQTLNVNKDA-SPE-TVTIYQPASDA---FPDTTLLK
A0A2V2SMX4      AEYQRLKNDSQRVQGLYDRLLATMQTLDVNKQI-NPE-SVTIYEKATQA---YPDRVNLP
A0A522AC27      AEYQKLKAGQSRVQALYDRLLATMQTLDVNKEI-SPE-SVTIMEPAFDA---VPERPPII
A0A6M1RFD0      AQYQKIRANINRVQSLYDRLLQTMQAVGVDKDI-IPE-SVTILERASVA---EPDRLSLS
A0A7C3HXH0      AQYQKIRANITRVQNLYDRLLQTMQAVGVDKDI-TPE-SVAILERASEA---EPDRLSLS
A0A1H2GQN6      APFQEAVKERDRQQYILDQYEIRYKQENLDQQSPSQP-ATVISPANTNP---NPVRPILW
A0A512M3Y3      REYSLMSSGKLLWESAYADLSKRLTAMDYTGI--DVR-VEFEWQGFTYLRNDVPISPNKQ
A0A4P5R5J1      ADFDKIKSKIERTKVHYDRLNGQLRSMDVYKNLAQDT-VLILEHATKPE----QIQMELN
A0A4P5YK43      NEFEKLKKEEDYLEKELDRQKRSLLALEST----PTN-EETISTVEEGVGLEKPVGPNRP
A0A2A2RPW6      IEYDRLQREAASERKLYDTVINRLREIDLTGNI--EK-KSEFRIIEPASLPSIPIRPNKK
B1ZT68          VDYKFLEQDAATKRATYSRIVDRLNEASVASQM---E-NTNIKIFDPAYVPGGPIGDALA
W0J7C2          IDYKFLEQDANAKRATYARIMDRLTEAGITSRM---A-NTNIAIFDPAWVPDAPSDTGAL
B4D1I7          AEYGSLQANVTRARAQLESLSRSKGNVEINRNV-----DQDIISIRQRASAATPQKPGAV
A0A353F286      TSYTQAKEQYEQARGMLREMKFKHSEAKILLKM---P-RDPITLHEKPKKASKPVFPNFT
A0A354FSA6      TSYTQAKEQYEQARGMLREMKFKHSEAKILLKM---P-RDPITLHEKPKKASKPVFPNFT
A0A3B9GA54      TSYTQAKEQYEQARGMLREMKFKHSEAKILLKM---P-RDPITLHEKPKKASKPVFPNFT
A0A520LEH8      TSYTQAKEQYEQARGMLREMKFKHSEAKILLKM---P-RDPITLHEKPKKASKPVFPNFT
A0A6B2M0T8      IEYNVLRRKLDTDKRLFTQVHQRLNEAILASQL---S-DVNLRVVDQAWPAGAPFTPDVK
A0A2D7B7R6      MQQAALEQDLEIGTKLIDNIKDQIQSIEFT----AES-EGTTIELAEKATEPSTIEPNKT
A0A2E5K4P7      EEYGGLTRKLEQARKSLEHLRMLKFKEDVRTDT---K-NSSVNIYVDGVAPTKHFTPSLT
A0A2V6F9Q9      AQFNRIKGKMDRTKQLYDRLTNDLKAVDVSQVVDAGD-QISIMEPATPP---VSVRPGLI
A0A2V6NZZ3      AQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGD-QISIMEPATTP---VSVRPGLL
A0A2V6EBU2      AQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGD-QISIMEPATTP---VSVRPGLL
A0A2V6EY06      AQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGD-QISIMEPATTP---VSVRPGLL
A0A2V6ME53      AQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVVDTGD-QISIMEPATSP---VSVRPGLL
A0A538NUU0      AQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVVDTGD-QISIMEPATSP---VSVRPGLL
A0A2V6NIJ1      AQFNRIKGKVDRTKLLYDRLTNDLKSVDVSQVVDSGD-QISIMEPATPP---VSVRPGLL
A0A2V6C292      AQFNRIKGKVDRSKLLYDRLTNDLKSVDVSQVVDSGD-QISIMEPATSP---VSVRPGLL
A0A2V6D2X0      AQFNRIKGKVDRSKLLYDRLTNDLKSVDVSQVVDSGD-QISIMEPATSP---VSVRPGLL
A0A2V5ZUK1      AQFNRIKGKSDRLKQLYDRLTNNLKEIDVSQVVGGED-QVSIMEMATTP---VSVRPGLI
A0A2V5XFN9      AQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGED-QVSIMEMATAP---ISVRPGLI
A0A2V6EZC8      AQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGED-QVSIMEMATAP---ISVRPGLI
A0A2V6I7Z5      AQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGED-QVSIMEMATAP---ISVRPGLI
A0A3B9LCP2      ALFNRVKGKVDRLKTLYDRLTNNLKEVDVSQVVDSGD-QVGIMDMATPP---ISVRPGLI
A0A3C0R669      ALFNRVKGKVDRLKTLYDRLTNNLKEVDVSQVVDSGD-QVGIMDMATPP---ISVRPGLI
A0A2V6EID2      AQFNRVKGKVDRLKVLYDRLTNNLKEVDVSQVVDSAD-QVSVMEMATPP---ISVRPGLI
A0A2V6MHB0      AQFNRVKGKVDRLKVLYDRLTNNLKEVDVSQVVDSAD-QVSVMEMATPP---ISVRPGLI
A0A2W5YWL9      GQFNRIKGKVDRTKQLYDKMTNDLKSVDVSQVVDTGD-QISIMEAATAP---ISVRPGLL
A0A2V5NH62      AQFNRIKGKAERLKTLYDRLTNSLKDVNVSQSVDSGD-QVSIMEMASGP---VSVRPGLI
A0A2W6A620      AQFNRIKGKAERLKTLYDRLTNNLKDINVSQSVDSGD-QISIMEMAGAP---ISVRPGLL
A0A2V5PIJ4      AQFNRIKGKADRLKTLYDRLTNNLKEVNVSQVVDTGD-QIAIMENATAP---VSVRPGLI
A0A2V6K2G8      AQFNRIKGKVDRLKTLYDRLTNNLKDIDVSQVTGSED-QVSIMEMATAP---ISVRPGLI
A0A2V5W206      AQFNRIKGKVDRLKTLYDRLTTNLKDIDVSQVTGSED-QVSIMEMATPP---ISVRPGLI
A0A2V6MW77      AQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGED-QVSIMEMATSP---VSVRPGLI
A0A6N4WVA3      AEFERLQSRLKRSKEAYASSQDSLRAIDTNQNLQQDT-VSILVNARKPV----PAGVGLV
A0A0R2XPB1      AEFERLQSRLERSKAASVNSQDSLQAIDTNQNLQQET-VSILVNARKPI----PAGVGLV
A0A348NQP1      AEFERLQSRLERSKAASVNSQDSLQAIDTNQNLQQES-VSILVNARKPI----PAGVGLV
A0A357FV58      AEFERLQSRLERSKAASVNSQDSLQAIDTNQNLQQES-VSILVNARKPI----PAGVGLV
A0A2G4GZN8      VDLERVDKEIRASEEFLGRMKLSYEDAKLRSST-SGT-STSISILDAPSVSDKPINKNYY
A0A348NPT1      VAYSSLQREMDVQQGFLQALVQRMTQERAAVNL-KNP-NSRVIDEALPPLRH--SSPNIV
A0A2E1KV60      VEFNSLIRDLEVEQMTYQKLISLMAEEKIQVNI-KNA-NARIIDKAFPPPEDQPSSPNVF
A0A2D7F4D9      VEFNSLIRDLEVEQMTYQKLTALMAEEKIQVNI-KNA-NARIIDKAFPPREDRPSSPNVF
A0A3R7RBR8      VEFNSLIRDLEVEQMTYQKLTALMAEEKIQVNI-KNA-NARIIDKAFPPREDRPSSPNVF
A0A2E0NH28      VDYNTLYREFEVQQGFLTAIVSRMTMQKAQINL-KNP-NARIVDEALPPLRH--SSPNLF
A0A350AS32      VEYNSLLRDLDVQQSFFIALTSRMTQEKAQVNL-KNP-NARIVDEAFPPMKH--SSPNVV
A0A368BGT4      IEFNSLLRDLEVQQSFFQALNLRMTTEKAQVNL-KNP-NARIVDEAFPPPEDQPSSPNIV
A0A6N6PLV8      KDYIEAKNRYIQEKKILESSEINLKAERMKRGI---E-MDPARVWEKAEPSLAPDKPNVP
A0A2E0V4K6      ARTQVLDGETKSRMSVFNSILVAMEESKVNQ---IDD-EVIADLHSRASTPETAVYPNRI
A0A290QE54      IDFKSLENQAAVAKGNYTQILDRLSQATTSSNL---E-RISVRPLDPATPAGAPYTPDIR
A0A1H1SWX2      VDFKSLENQAQVAKSNYLEILNRLNQVTTSKNL---E-NIPVKPLDRALPKGSPDTPNIR
A0A1D8AZK8      VEFKSLENQATVAKNNYIEILNRLNQVTTSKNL---E-NIPVKPLDRALPAGAPFTPNIR
A0A4Q1C9I5      VEFKSLENQAAVAKNNYLQILDRLAQATTSKNL---E-NIPVKPLDQALPAGAPYTPNLR
A0A2E6NAH3      IEFNSLLRDLEVQQSFFQALNQRMTTEKAQVNL-KNP-NARIVDEAFPPREDQPSSPNVV
A0A2A5VZA5      VEYNTLLRDLDVQQSFFQALNSRMTQEKAQVSL-KEA-NARVVDDAFPPL--RHSSPNIT
A0A424R295      VEYNTLLRDLDVQQSFFQALNSRMTQEKAQVSL-KEA-NARVVDDAFPPL--RHSSPNIT
B4CZV9          SQLSIFDASRVPYDTYLANMQREINEVEFAG---EKE-RINLKYSGLLEVRDDPVSPNRL
A0A1G3ZL71      PEYGSLENEALAKRTAYLQVLDRLNQTTTSKNL--DS-RVPLRVIDRATPSHAPYTPNLA
A0A556QP09      IEYRSLENQAQVAKSNYSQILDRLSQATTSKYL--E--KIPVRPLDPALPAGKPYTPDLG
A0A2T6DX88      VDFRSLENQATVAKSNYSQILDRLSQTTTSSKL--E--KIPVRPLDRATPTPAPYTPNMT
A0A2T6CWI7      VEFNSLVQQSQVARENYQNIFKRLTDTTTVKNL--D--KIPLHPLDHAVANRWPVSPNRQ
A0A3E1E5C8      VEYNSLENQANVAKSNYVQILNRLNETTTTRNL--E--KIPLHPLDAAVVPGGPYEPDLA
B1ZZ74          PEFNSLQNQAQVSKANYLSILDRLNQTTTTKNL--E--KIPLHPLDHAVVPGAPFTPNLN
A0A3B9FM17      ETLKNFERELAVVQRSTDSIHSRLNDVNIEQALPSEQ-DEPLRVDSVAYEPGGPYAPDKN
A0A0E3YV65      VQFNVLRREAETNRATYAQLLNRLNETSITAQL---A-NSNVRVADGGTPAGLPLEPDPR
W0J900          VEYNVLRREAETNRATYTQVLGRLNETSLTAQL---G-NSNIKISERAQIPTFPIEPDPK
R7E4L8          EGLVPLLREQKVMEELYLMLLKKREENALALAT---T-EPSARILEPAFGSNAPVAPRLS
A0A4Q3BVY2      HVYSTIAAKQQMWDKARERLAQKLATVTFAEDF--DW-VELRFKGLVSLRDEVPISPSKF
A0A4P6PCA7      RRLLKLERKRDAAETSYRSILQRTENTRLAA---EQD-TAFVKVLREATVPRIPVAPDKK
A0A2T6DSN5      DRYKFLEDDYNRKNQALNSIEGRLQEATIVSRL---E-NVNIRILDRANVPSVPANGTPK
A0A317ZIW7      AEFERLQSRLERSKAAYERNQEALRAIDTGQSL-SQE-TVSVLEDASPA---YPAGQGTV
A0A7C4PPT4      QELERKGAGNLGFAAMYKEMATRLSMIDFGAD--KER-SQLQFMGHLELRDEIPVSPNRL
A0A7C4QZX4      HDVQYQEVGKGVFSRAYGELARRLSMVDYGAE--RER-IHLQFLGHLELRDQVPVSPNRM
A0A2D7WMI4      DNISSMERELEIVQTSSGQMQKRLNDVTIEQAFPQDQ-DDPLQKEQFAFVPGGPYSPDKN
A0A2D6VHX5      EAISKAERTLAVVRSSTDIIRKRLDDVRIEAALPSEQ-DDPLQKDQLAFTPXSPYSPDYN
A0A2D8I214      EWLINKERELTVVRTSTDQIQKRLNEVRIEQALPSEQ-EEPLHKEQYAFLPGGPYTPDKA
A0A1Z8VL41      ERLEDYKRELSVVRASTDQIHKRLNDVKIEQSLPSEQ-DDPLHKENFASLPGGPFSPDKN
A0A2E6TNA4      ERLEDYKRELSVVRASTDQIHKRLNDVKIEQSLPSEQ-DDPLHKEQFASLPGGPFSPDKN
A0A1Z8RG47      EKLINFERQLAVVRKSTDQIHDRLNDVRIEQALPSEQ-EEPLHKEQFATQPSAPYTPDKN
A0A1Z8RJJ5      EKLINFERQLAVVRKSTDQIHDRLNDVRIEQALPSEQ-EEPLHKEQFATQPSAPYTPDKN
A0A2D7V631      ETLTNFDRQLAVVRKSTDQIQSRLNDVRIEQALPSEQ-EEPLHKEQFAYQPFAPYTPDKN
A0A354RA24      ETLTNFDRQLAVVRKSTDQIQSRLNDVRIEQALPSEQ-EEPLHKEQFAYQPFAPYTPDKN
A0A2E9RV62      KDLEVLDRKLQIQRGSTDTIQRRLQDVVIQIELPQEQ-DDPLHKGNIAY-PGIQISPNLP
A0A2E4AY96      DTLRNFERELQIVQTSSAQMQKRLNDVTIEQAFPQEQ-DNPLQKEQFASLPASAYSPDKA
A0A3B9B9P4      DTLRNFERELQIVQTSSAQMQKRLNDVTIEQAFPQEQ-DNPLQKEQFASLPASAYSPDKA
A0A2D5Y6N6      EKLKNLDRQLAVVTRTTDQIHNRLNDVRIEQALPSEQ-EEPLNKEQFAYLPGAPFTPDKN
A0A2E7HSS8      DRLKNFTRELAVVQRSTDGIQSRLNEVKIEQALPSEQ-DEPLRMESFANEPGGPYSPDKQ
A0A2D8VCK3      ETLKNFERELAVVQRSTDSIHSRLNDVNIEQALPSEQ-DEPLRVDSVAYEPGGPYAPDKN
A0A350QVY4      ETLKNFERELAVVQRSTDSIHARLNDVKIEQALPSEQ-DEPLRVDSVAYEPGGPYAPDKN
A0A2E4ZYR7      VQILGMTREGLVHRTTYDQMLKRLNEVKVTRELPQDE-DDPLRRGDVAMTPATPISPDKA
A0A2E6TCV1      QQIARLEQDLTLERQTFSSLHKRKKEVEVTGALPEAQ-TDPLQISDVATVPYLPVSPDKA
A0A3D4HHL8      AEFERINSRLDRQKSLLENLTASIQSIDINLNL-DQE-FLTILENASPA---YAVRISIV
A0A366HV03      QDYKLGHEGDLAWTKAYTDLSKMIATINFGGDK-DRV-DLQFREFALLR-DVDPVSPTKS
A0A6G6K911      QDYKLGYEGDLAWTKAYADLSKMVATINFGGDK-DRV-DLQFREFALLR-DVDPISPTKS
A0A5R8KAF2      EQYMSASQGRAMWGRARDKLSDKLSMISFTQDL-DWV-EMHFKEFVNLR-DVEPTSPNKM
A0A7C4LRZ6      NAFERLKNEEADVKADLENLRRQARALEASNTR-ENL----LAILEEGLGSPSPIGPNRQ
A0A2V2SDN0      VDYDRLRQDVQRTQAAYDKLLSVISTVDVGKSV-DQE-NVSVLEPASPAGRAS----KLV
A0A1V6GL40      AEYQALKANVQRIRALYDQLLATMQTLDVNKEI-SPE-SVETI---EAASPAYAARLDLW
A0A2V5X6Z6      ADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV-EQE-NVGIL---EPASVAAPTH-RLF
A0A2V5VGZ7      ADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV-EQE-NVGIL---EPASVAAPTH-RLF
A0A2V5U130      ADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV-EQE-NVGIL---EPASVATPTH-RVL
A0A2V6C237      ADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV-EQE-NVGIL---EPASVATPTH-RRL
A0A3R8L982      VEYKSLENTAAVAKSNYAQILDRLSQVNTSRNL-EKL-PVRRLDRALPA--GAPYSPNPR
A0A6N6QBS9      NDYERLLKKEARVKEQLESQNRNLAAT---TRL-AVE-DEQFNVAESGGGDPIPVAPARP
A0A2E7HPU9      ARATVLTSGIASQREVYNSLNTQLAE--LNAKK-GET-AVEVELDSFSELPRKPSSPKQL
A0A388PR45      VELEKIDKDIRANEEFLGRMKLNYEEAKLRTAT-SGI-STSIRVMDKPSVSDKPVNKNFS
A0A388QR61      VELEKIDKDIRANEEFLGRMKLNYEEAKLRTAT-SGI-STSIRVMDKPSVSDKPVNKNFT
A0A4P5YHI0      VELEKIDKDIRANEEFLGRMKLNYEEAKLRTAT-SGI-STSIRVMDKPSVSDKPVNKNFT
A0A2A2RS01      NELERVDKEIRGQEEFLARQKQNYEEQKLRSST-SGT-STSIKIQEMPSVADRPVNKNYY
A0A2A2Y1A7      NELERVDKEIRGQEEFLARQKQNYEEQKLRSST-SGT-STSIKIQEMPSVADRPVNKNYY
A0A388PDH9      NELERVDKEIRGQEEFLARQKQNYEEQKLRSST-SGT-STSIKIQEMPSVADRPVNKNYY
A0A2G4H1E7      VELERVDKDIRASEEFLGRMKLSYEDAKLRSST-SGT-STSISILDAPSVSDRPINKNYY
A0A2G4GZA6      VELERVDKDTKASEEFLSRMKLSYEEAKLRSSN-SGT-STSINILDAPSVSDKPINKNYY
A0A388P514      VELERVDKDIKASEEFLGRMKLSYEEAKLRSST-SGT-STSISILDQPSVSDKPINKNYY
A0A2A2YG59      VELERVDKDIKASEEFLGRMKLSYEEAKLRSST-SGT-STSISILDAPSVSDKPINKNYY
A0A2G4F7D5      VELERVDKDIKASEEFLGRMKLSYEEAKLRSST-SGT-STSISILDQPSVSDKPINKNYY
D5EML0          LEYKRMERDVDQKREMFNKLMNRYRETRIAQQM-NLN-NMLVLDRANLP--MQPLTMSRT
A0A7C4PPJ4      NQFDRLKSDETDIKNELESLRRKARALEASNTR-GDK-ELAILEEGIGS--PLPISPNRQ
A0A3C1C1M3      MRITALNRTRSAADASYLGLLTRIQEARLSADE-NTA-TVKLASEVAP---ARQIFPRPA
A0A2E9EYJ1      VRYIEAKKEYELSKEMLNGMQSQLAKETIDSAG-QRT-PLVIHELAEPQDVDKPARPNXK
A0A258AXR6      TEYKTAKDEVTYLEDLLVKMRSRYFEEKAGIEL-VKS-PATIYSDAEPE--GKPAKPNVP
A0A3D3NZQ6      NEYKTAKDDVTDIEAILRTLKTRYFETKAGLEI-FKS-PATIYAKAEPE--GRPAKPNVA
A0A1T4WVZ9      NDYKTAADDVAYIENLLLQLKSSYFETKAGLEL-VKS-PATLYAKAEPE--GKPAKPNVA
A0A4R7SSI6      TDYKTAVDDVAYIENLLLQLKSSYFETKAGLEL-VKS-PATIYAIATPE--GKPAKPNVA
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      LTLFLGIVGGLGAGFGLAFFVNFLDDSIKSQDDVESYLKLPFLGYIPNIK-TTSVIERD-
A0A660Q3A0      QSIFIAALIGLGLGIGLVFGLEYLDDTIRYPEEVTEGLGLPFFGVIPTAQWDPDDLATH-
A0A4Q3AQI1      --------------------------------------RRQDAEAVE--AIRRPKLADES
A0A6N2CMN7      -----------------------------------------MLGVVP--RIKKLDTSTKA
A0A2V5UAD5      SLLAMTLVAGLLAGFGCVFLVAVRDDRFITLTDVIEKLGDAVLGQVPEVRKRRRKSPLP-
A0A258AXL1      KLLTYALALSIGLGLGGPVLTERLRFTSSFVGEAEKYCQYPACGIVPLMEIDDRRL-VP-
A0A2E6T1E0      LTLFLGIVGGLGAGFGLAFFVNFLDDSIKSQDDVETYLNLPFLGYIP-----NIKT-TS-
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ----------MGXXLVIPIALEVIDNRIKSPWDIETFVGEDLLTGIQ--KISEIDELRR-
A0A7C5CZ90      -----GIIFGLLIGVGLAFFIEYLDTSVKTIEDVERSLQAPVLGVIP--QNVKL------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      -------------------------------DDVEHYLGVPVLAVIP--KDVGV------
A0A2V5U7A0      INLTMYAALGLFLGVGMAFALEYIDSHLNTPEHVWRAVDLNTLGVVPDLDSLGHRPLIS-
A0A3D4CZT6      --LSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-------------
A0A4V1S9Q4      --------------VGIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP-------------
A0A355VK99      KYVAGGTAGGALLSILAFMGVAMLNNKVNNKHDLPSVNRQPVIAELP-------------
A0A2V6N5E0      KSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENILGQIP-------------
A0A2V6NH44      KSLLLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIP-------------
A0A432FDF6      LNIALGVVVGLVLGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIP-------------
A0A522ACN3      LNIALGVIIGLVVGVGLAFFIEYLDTSVKTIDDVERTLQSPVLGVIP-------------
A0A353DCA1      LNLLLGAGVGLIFGIGIAFLLEHLDTSVKSLEDVERYLQVPVLAVIP-------------
A0A3C1AXQ2      LNLALGGVLGLMLGVGLAFFLEYMDTSVKSLDDVERFLGVPVLAVIP-------------
A0A3D0IZR7      LNLALSMVVGLILGLSLAFFIEYLDTSIKTMDDVERFLGISVLAVIP-------------
A0A520LRZ3      LHLVLGAAVGLVFGIGMAFFLEYLDTSVKSLDEVEHFLELPVLAVIP-------------
A0A356FSV4      LNIALGAFGGVVVGLGLVFGIAFLDDRVKSAFDIEGTIGLPLIGIIP-------------
A0A3D3DET9      KGAVNGALLGLALGLGLLLVLDRLDDRVGSFTELQDLFDENVLGQVP-------------
A0A355SVK9      MNLAAGFLGGLAAGAGFVLLIAFLDDRVKSAFDIEGAIGLPLLGVVP-------------
A0A2E5D7I3      ---AVGGIGGVASGLGLVLLLLXLDNRFXTVSQVEXETGMPVLAAVPVLEAKKLEAAEX-
A0A2V5NYE2      RKLATGALVGLALSVVLLLILDRLDDRVNSVTELQDLFDEPILGQVP-------------
A0A2V6FIP7      LTLFLGVIGGLGVAMGLAFFVNYLDDSIKSQDDVETYLRLPFLGYVP--NIKTNSVLERD
A0A353DI77      KIMVKTTMLGLCGGLALAFMFQFVDNKIHGVADIEQTFGISILSAIQ--KLPPEEELLKE
A0A1V6GCZ3      LNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQCPVLGVIP-------------
A0A3C1UJT2      QRIILGVLLGLGLAYGYLYLMNMMDQSIKSVEQAEKILQLPVLAAVP---VSEINGKPTD
A0A2S7U0Z3      IYLAAGSIFGIFTGFAAAFGLSILDYKIYDVRSAEEATGLTCMAAIP--ASSKFGRQDKW
A0A5E6MKA7      RNLLLGFLGGGMGGIGLAIGLAKFDTRLRGKEEVERALGLPVLGMVPDTEKLRAKGIDEI
A0A6B3L936      ITLAAGSVLGGGVGVGLVFLLSLMDYKIYDVRSAEEATGLPCLAAIP--LSSAVDSEDGE
A0A2N8IR72      KYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQMSKKESKNTKL-
A0A2N8IV96      INLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------------
R7E1V8          INLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------------
A0A2E0R252      KITMKYLFGGAALGVGIILLLGFLDPTVRTVADLEVLTGTPVIGAMP--ASK---NTERK
A0A3E1EF48      DIVGRFSGGGFLLGIACIFLIGFLDPSIRTVGELERDARLPVIGAVP--SSSSKGDGTKR
A0A2A2PVG8      RMLVQFAGGGAALGIAIIMLLGFLDPTLRTVAEVEQFCGIPVVAGLP--AFK---KRESR
A0A2E0R421      SIMSKYTMGGVAVGVALILLMGFLDLTIRTVSELEGMTGKPVLGAIP----D---EKNPG
A0A2E5EJ69      VIMMVAMIVGCGLSFMLVFIVQQLDKTVKSIDEAERLFGVPVVGAVP--KNPEIKDDQG-
A0A2G4I5Z5      MLLIYALALGTALSVGLIWLLVQLDTTIKSVDHAERLLGIPVLGAVP--KNKLIKNGKG-
A0A4P5QQV6      RTLTTGFVLGLLGGIVCLLGISMFDDRIDSVVDFQATFPDRLLATIP--HVSCAVGAVDV
A0A1T4WWY4      KLFMMGCLLGLGLAGGVPFLLRRFDSSVVELSEFEGTLGINGIGLVPLSDPKELESLNR-
A0A3D3LEQ6      KLLMLGCLLGLGMAGGVPFLLKQMDSTVTDLNEFEETLGIPGIGLVPLTDPEVLEEVNR-
A0A3D3NW23      KLLMLGCLLGLGMAGGVPFLLKQMDSTVTDLNEFEETLGIPGIGLVPLTDPEVLEEVNR-
A0A2E7ALI1      RVKAVGGLGGIAGGLGLVFLLLRLDNRFRTVSQVEEETGMPVLSAVPVLELRKIEAAEK-
A0A178IDB9      QILLQAGAFGFILFLGLPIGIGLMDTRVKSSHDVETGLDHPLLGGIK--TMKKLTEAER-
A0A290QD69      EVIKQAAALAFVLFFGIPVGLGFLDTRVKSSHDVESGLNQTLLGGIK--AMKKLSETER-
A0A2E7VDS1      SIHRTGALIFLACFILIPMAFEFIDNRVKSPWDIEVFLGRDLIAGIP--KISTIKEAER-
A0A7C8D3W3      KKILQGLMFGLALGLGIVYLCQRLDDRMELAEDIETALELPVLGQIP--QMNLKDMNQD-
A0A178IFJ2      KILLSIGFLGVLIVIGYPVGMELLFNRIKTWTDVERYIGLPLLSEFP--VLKNLPGDTL-
A0A357FSP9      MNLAAGFFGGLAVGAGLIFVVAFLDDRVKSAFDIEGTVGLSMLGVVP--RIKKLDSNSK-
A0A2A2R174      MLLLYALAAGTALSVGVIWLLVQLDTTIKSVDHAERILGLPVLGAVP--KNKLIRDGKG-
A0A1H2DTI1      VRLLSAGLGGLIVGMAILFIIDRFDDRINSTTELRDYFSERILGQMP--FEVSLGDRSN-
A0A1H1MGC9      LNLALGFLGGLALGTAFAFFVAYIDDRVKSSFDIESVVGLPLIGIVP--EIKRLDQPEK-
A0A1V5L462      REIAKGGALGLGMGAAIVFLLAALNNRITSADDLRRMFSSKVIGLIP--QTKAKITV---
A0A3D3LGD3      LNLALGGILGLMFGFGLAFALEFMDTSIKSLDDVERFLGVPVLAVVP--KNVGILHRAT-
A0A350ARX4      KKVAEGAAFGLAVGIVIIAAISFLDVRIRNSDELAKRFDHPVIGVIP--EELQNANGQI-
B5JIS2          LVAAFTVLLAGGAFFGVPLGMQLFDQRLKCATDIEKEFGKGLLGGIP--KLSRVKVADR-
A0A6N6ZC77      RSLVEGGILGLGFGLVLIAGLGLIDNRVVSGEDLRNRFDAPILGLIP--VEDQRQDGRV-
A0A7C5H7K5      YHAGFGAAAGLLLGILLIMILERVDDRICSYSDVVNNFSEPLLGQIP--NWKSFRTKQDA
A0A538NJ59      SLLAMTLAAGLLAGFGCVFLVAVRDDRFITLTDVIEKLGDAVLGQVP--EVRK-RRRKSP
A0A2A2R3V9      GMLLNGFLLGLLAGVGILFLLDRIDDRINSFTELRDHFEEPVLGQIP--MDPTLARKKGG
A0A3C1VFY9      KGLMFAGLLGLGLGLAILILMDRVDDRMSSFTELEELFDEDVLGNVP--REKS-PDKNTV
A0A2V2SMX4      MKLALGAVAGLGLSLLVMLFVDRLDDRMASFTELQELFDEEILAQIP--REGK-AREVSG
A0A522AC27      QSLFKAGLIGLGASLAILLLLDRLDDRMNSYTDLQDLFDEEVLGQIP--HEGL-EKGQKH
A0A6M1RFD0      VSLALAGLVGLMLGMGLLLIVERFDDRMNTFVELQDHFEEPVLGQIP--RERS-GRNGD-
A0A7C3HXH0      ISLTLAGMVGLMLGVGLLLLVDRFDDRMNTFVELQDHFEEPVLGQIP--RERS-SRNHD-
A0A1H2GQN6      LNITLSGVAGLLLGLSVAFFIEYLDTSVKSLNDVEKTLGVPVLGIIP--RGVKPLNKEP-
A0A512M3Y3      KLLLYGVMLGVGCAAGGCFGLEKLRSTTSLVTETEKLTGLNAVGVVP--LLANSAQVET-
A0A4P5R5J1      KLLLIGGFGGLALGLLVLFVLDKMDDRIGSFFEFRERFPEPLLGQVP--RELTKAGLDL-
A0A4P5YK43      KIILLGLLLGLFSGIGIVYVLYRLDDRLDLAEDIEESLQEPVLGQIP--AVDRKNHADG-
A0A2A2RPW6      MILLYALMVGMAASVGLIWLLVQVDSSIKSVDHAERVFGLPVLGAIP--KNKLITDGKG-
B1ZT68          ILIAKASFIGVGLFVLIPLGMGLMDTRIKTVSHVEDALGEVLLGAVK--TIDGLGEIER-
W0J7C2          EIAVKAGAAGLGLLFVLPLGIGLLDSRLRTPAQVEDSLQEPLLGVVK--HMGKLGETER-
B4D1I7          KTVGTGIGLGLFVGLLLLVLIDQLDDRVASYTEFQSYFRERVFAQIP--HSPSDGRSES-
A0A353F286      MNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVPVLAVIP--KDVGVLHKQS-
A0A354FSA6      MNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVPVLAVIP--KDVGVLHKQS-
A0A3B9GA54      MNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVPVLAVIP--KDVGVLHKQS-
A0A520LEH8      MNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVPVLAVIP--KDVGVLHKQS-
A0A6B2M0T8      KIYSVTVFLFLFAFSCVPFGIHYLNLNLKTATDIEQQLRVPFLGEIR--TFPRRLKKLH-
A0A2D7B7R6      QRIILGVLLGLGLAYGYLYLMNMMDQSIKSVEQAEKILQLPVLAAVP--VSEINGKPTDS
A0A2E5K4P7      LNLAFGTIGGAGFGLFMVFFTAFIDNRVKSPFDIEQVIKLPLVGVIP--QIRKLDSFKK-
A0A2V6F9Q9      KSLLLGFGGGAVAGILILLVLDRIDDRMASYGEFQRHFLENVVGQIP--KEKAKGKMPL-
A0A2V6NZZ3      KSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSENVVGQIP--KEKVKGTMAL-
A0A2V6EBU2      KSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSENVVGQIP--KEKVKGTMAL-
A0A2V6EY06      KSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSENVVGQIP--KEKVKGTMAL-
A0A2V6ME53      KSLFLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIP--KEKVKGTMAL-
A0A538NUU0      KSLFLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIP--KEKVKGTMAL-
A0A2V6NIJ1      KSLLVGFGGGALVGIVILLLLDRIDDRMASYGEFQRHFSENVVGQIP--KEKVKGTMAL-
A0A2V6C292      KSLLLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIP--KEKVKGTMAL-
A0A2V6D2X0      KSLLLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIP--KEKVKGTMAL-
A0A2V5ZUK1      KSLLIGFGAGALLGLGILILLDRIDDRMASFSEFQHHFSENVLGQIP--KEKAKGRVEL-
A0A2V5XFN9      KSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENVLGQIP--KEKTKGKVDL-
A0A2V6EZC8      KSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENVLGQIP--KEKTKGKVDL-
A0A2V6I7Z5      KSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENVLGQIP--KEKTKGKVDL-
A0A3B9LCP2      KSLLIGLGCGLLAGIGILILLDRIDDRMASFGEFQRQFSENVLGQIP--KDKTKGEVTL-
A0A3C0R669      KSLLIGLGCGLLAGIGILILLDRIDDRMASFGEFQRQFSENVLGQIP--KDKTKGEVTL-
A0A2V6EID2      KSLLIGLGCGLLAGIGILFLLDRIDDRMASFGEFQHQFSESVLGQIP--KEKTKGKLTL-
A0A2V6MHB0      KSLLIGLGCGLLAGIGILFLLDRIDDRMASFGEFQHQFSESVLGQIP--KEKTKGKLIL-
A0A2W5YWL9      KSLLIGLGCGALAGFGILLLLDRIDDRMASFSEFQHHFTENVLGQIP--KEKSKGKVQL-
A0A2V5NH62      KSLLIGLGIGALAGIAILLLLDRIDDRMASFGEFQHHFSENVLGQIP--KEKTKGRVSL-
A0A2W6A620      KSLLIGLGCGALAGIGILLLLDRIDDRMASFGEFQHQFSENVLGQIP--KEKTKGRVTL-
A0A2V5PIJ4      KSLLMGLGAGILGGLAVLFLLDRIDDRMASFGEFQHQFSENVLGQIP--REKVKGDVML-
A0A2V6K2G8      KSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENVLGQIP--KEKTKGRVDL-
A0A2V5W206      KSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENILGQIP--KEKTKGKVDL-
A0A2V6MW77      KSLLIGFGIGALAGLAILVLLDRIDDRMASFSEFQHHFSENILGQIP--KEKTKDKVDL-
A0A6N4WVA3      RQFAMGGLFGFVLAGGVLFLLGALDNRILSANELSAQFQHPLIGAIP--YEKVNEGDVH-
A0A0R2XPB1      QQFAMGALFGVVLAAGILFVLAAIDNRILTASELSAQFKDPLIGVIP--FEVNHDGDVN-
A0A348NQP1      RRFAMGGLFGLILAAGVLFVLAAMDSRILTASELSAQFKDPLIGAIP--FEASNDGDEN-
A0A357FV58      RRFAMGGLFGLILAAGVLFVLAAMDSRILTASELSAQFKDPLIGAIP--FEASNDGDEN-
A0A2G4GZN8      FSALVGIGSGLLFGVVLIIVIGTLDDRIKSAKDVEGSLGLPLIGTIP--RATVTSGPDR-
A0A348NPT1      MNLAAGFFGGLAVGAGLIFVVAFLDDRVKSAFDIEGTVGLSMLGVVP--RIKKLDSNSK-
A0A2E1KV60      LNLAGGFFGGIFFGLGLVFAVALLDDKVKSVFDIEASIGLPMLGIIP--KVKKLDSVSK-
A0A2D7F4D9      LNLAGGFFGGMIFGLGLVFAVALLDDKVKSVYDIEASLGLPILGIIP--KVKKLDSVSK-
A0A3R7RBR8      LNLAGGFFGGMIFGLGLVFAVALLDDKVKSVYDIEASLGLPILGIIP--KVKKLDSVSK-
A0A2E0NH28      LNIALGAFGGVVXGLGLVFGIAFLDDRVKSAFDIEGTIGLPLIGIIP--QIKKLDSTTK-
A0A350AS32      MNLAAGLFGGVAVGMGLVFIVAFLDDRVKSAFDIEGTIGLPMLGIVP--RIKKLDTNSK-
A0A368BGT4      LNLFAGFFGGIAFGVGLIFSVAFLDDRVKSAFDIEGTIGLPMLGVIP--RIKKLDSNAK-
A0A6N6PLV8      VYMVAAAALGLVLGIGLAFFIEYLDTSVKTLDDVERFLQIPVLAVIP--KDI--------
A0A2E0V4K6      RSYFAGGAGGAACGVGLILLLLRIDNRFRTVAQVEEETALPVLAAVP--VLSAKRLS---
A0A290QE54      SIAKTSIGLFVLVFVGVAIGLSFIDDRIKSSWDVEHFIGVHLLGIVP--DLSGLKDDDK-
A0A1H1SWX2      NIVKTSIGLGLVVFAGVAIGLSFLDDRVKSAWDIEGFIGAHLLGIIP--ELGDVPDTEK-
A0A1D8AZK8      SIIKTSIGLGLLVFAAVAIGLSFIDDRVKSAWDIEGFIGAHLLGIIP--ELGDVPDTEK-
A0A4Q1C9I5      NIIKTSLGLGLLVFVGVAVGLSFVDDRVKSAWDIEGFIGAHLLGIIP--ELGDVPDTEK-
A0A2E6NAH3      LNLAAGFFGGIATGVGLIFAVAFLDDRVKSAFDIEGTIGLPMLGVIP--RIKKLDTSTK-
A0A2A5VZA5      VNLLVGVFGGLAVGGGLVFIVAFLDDRVKSAFDIEGTIGLPLLGVIP--RIKKLDSSTK-
A0A424R295      VNLLVGVFGGLAVGGGLVFIVAFLDDRVKSAFDIEGTIGLPLLGVIP--RIKKLDSSTK-
B4CZV9          RIMLLSFVGGLVLALGIPFLIEYLDHTMTNLEEVEHSFRLRGLGVVP--QTEATDMFLPA
A0A1G3ZL71      RVVRTSTIVGLLIFFGVAFGLSVVDDRIKSAWDVESYLGVHLLGIIP--ELAHVATDSLH
A0A556QP09      RIARTAVGVGVLVFFGVAIGLSFIDDRIKSAWDIEHFIGANLLGIIP--DLSSLKDSEKY
A0A2T6DX88      RVIRLSVIVGLLVFVAVAFGLSIVDDRIKSAWDVESFIGVTLLGIVP--DLSSLKDDEKY
A0A2T6CWI7      KITRTAIGLGLMVFLGVALGLSFIDDRIKSAWDVESFVGANLLGIVP--DLGNLKDEEKY
A0A3E1E5C8      RIIRTCLGVGLLVFFAAGLGLAFLDDRIKSAWDVESYIGANLLGIIP--DLSAVTDDDKY
B1ZZ74          AIIRLCVGVGVMVFFGVAFGLSFIDDRIKSAWDVESFIGASLLGIIP--DLAALKDDEKY
A0A3B9FM17      RIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDIEVFVGNDLIGGIP--KISEVEERER-
A0A0E3YV65      KIAITLLVLGLGVFVAYPVALELIFNRVKGWSDVENYLGLPLLAELP--LLNKIKTEFL-
W0J900          KIFRALGFLGLLIIIGYPVGMELIFNRVKTWTDVERYIGLPLLSEFP--VLKKLPDDKL-
R7E4L8          LMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELP--LLSGKERKKL-
A0A4Q3BVY2      KVAIIALTLGVAGAFGVPTALNLLNTSASTVPQLEQLTGLEGIGIVP--MTSKEMLEDVA
A0A4P6PCA7      KIVIVTVFLFGIIGAGLAILMDFMMNRVGSVTDLKD-LGLHVLGILP--RESKYMTRAD-
A0A2T6DSN5      DTALQASALGLFLLFGIPLGLGLLDTRVKSPSDVEAGLEQVLLGGIK--TMKKLSETER-
A0A317ZIW7      IRLAEGAAYGIVLAIGVLALISFLDNRIFSAADITNHFDEPLLGAIP--FEKNHDGDHT-
A0A7C4PPT4      KLVVYSLGLGIFLAIGIPFLIEFLDHTVSNVEEMEQNHRLRGLGIVP--RLEPSQLPGS-
A0A7C4QZX4      KLLVYSLGLGLLLAFGAPFLLEFLDHTVTSVEQIEQHHRLRGLGVVP--LVAQSQGARS-
A0A2D7WMI4      GIYKKSFGIFVGIFFVVPFLLEFIDNRIKSPWDIEVFLGRELISGIP--KISNIIENER-
A0A2D6VHX5      KIKQQGVLIFVGIFLVIPIALEVIDNRIKSPWDIETFVGEDLLTGIQ--KISEIDELRR-
A0A2D8I214      KIKRTGIYIFLGLFILIPVSLELVDNRVKSPFDVEVFIGKDLIGGIP--KISDVEEAHR-
A0A1Z8VL41      AIKQKGLXIFFAVFIIVPILLEFVDNRVKSPWDVDVFIGKDLIGGIP--QISQVEETKR-
A0A2E6TNA4      AIKQKGLIIFFVVFIIVPILLEIVDNRVKSPWDVDVFIGKDLIGGIP--QISQVEETKR-
A0A1Z8RG47      QIRQSGFMIFFSVFFALPILLEFVDNRVKSPWDVEVFVGHDLIGGIP--KISEVDERER-
A0A1Z8RJJ5      QIRQSGFMIFFSVFFALPILLEFVDNRVKSPWDVEVFVGHDLIGGIP--KISEVDERER-
A0A2D7V631      KIRKSGFIIFFAVFFALPILLEFVDNRVKSPWDVEVFVGHDLIGGIP--KISEVEERQR-
A0A354RA24      KIRKSGFIIFFAVFFALPILLEFVDNRVKSPWDVEVFVGHDLIGGIP--KISEVEERQR-
A0A2E9RV62      EIHKTGFMIFAALFVLIPFGFEFIDNRIKSPWDIEVFLGQDLIAGIP--KISEVKEVDR-
A0A2E4AY96      AIQKKAATVFLAIFILFPFLLEFIDNRIKSPWDIQVFLGRDLISGIP--KISNIDEQER-
A0A3B9B9P4      AIQKKAATVFLAIFILFPFLLEFIDNRIKSPWDIQVFLGRDLISGIP--KISNIDEQER-
A0A2D5Y6N6      KIKRDGTMLGLAIFVIIPFLLEFIDNRVKSPWDVEVFIGRDLIAGIP--KISEVEENQR-
A0A2E7HSS8      KIKEQGIMIFSVLFILIPICLEFIDNRVKSPWDVEVFIGNDLIGGIP--KISEIEERER-
A0A2D8VCK3      RIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDIEVFVGNDLIGGIP--KISEVEERER-
A0A350QVY4      RIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDIEVFVGNDLIGGIP--KISEVEERER-
A0A2E4ZYR7      AIRRTGILIFVACFILIPIGFEFIDNRIKSPWDVEVFIGRDLIAGIP--KISTIKEADR-
A0A2E6TCV1      AIKTKGILIFFACFVLIPIAFEFIDNRVKSPWDIEVFIGRDLVAGIP--KISTIKEADR-
A0A3D4HHL8      KNLVMGVVAGVFMGVGILFIISILDSRIISVEDVENRFDQPLMGIIP--FQKYD------
A0A366HV03      KLAILAAVLGLGLAIGVPLGLEQLNDKITSLAALEKLTGLKGLGIVP--TSSSTFLESVT
A0A6G6K911      KLLILAVVLGLGLAIGVPLGLEQLNDKITSLAALEKLTGLKGLGIVP--TANSTFLEGVT
A0A5R8KAF2      KLLMISLMLAIGGAIGAPTLVNLMHTGVETLQQLENVTGLTAVGVIP--RTTKEVLEDIA
A0A7C4LRZ6      KIILTGLLAGLGLGLMIIYLLDRLDDRLELAEDIEAELDQPVLGQLP--LIGRRDFRKSN
A0A2V2SDN0      RNLALAFAMALVLGAGLLWVLSKLDDRFVSSTELAEDLPEKVIGQVM--DIQLVKPEGE-
A0A1V6GL40      KGAVNGALLGLALGLGLLLVLDRLDDRVGSFTELQDLFDENVLGQVP--REKLVASKRQ-
A0A2V5X6Z6      RNMAIALVGSLLLGFGLLYCIGLFRDDFASLAELTHQLSEEVVGQIP--AISIKKPKRR-
A0A2V5VGZ7      RNMAIALVGSLLLGFGLLYCIGLFRDDFASLAELTHQLSEEVVGQIP--AISIKKPKRR-
A0A2V5U130      RNMAIALIGSLLLGFGLLYCIGLFQDDFASLAELTNQLCEEVVGQIP--AISIKKPRRQ-
A0A2V6C237      RNMAIALVGSLLLGFGLLYCIGLFQDDFASLAELTNQLCEEVVGQIP--AISIKKSKGR-
A0A3R8L982      SITQTSVALGLLVFFGVAFGLNLIDDRIKSAWDVEHFIGANLLGIIP--SLGDIKDHDRY
A0A6N6QBS9      QIVLSGVGVGFILGVVALLLLHKLDDRLDNPERIEEALGEPILGQLP--EVDKKHYKEGY
A0A2E7HPU9      TTLGAGTILGSVLGFALAFLLANLDNKFHTVSQVELMSGLPILATIQ--HIDL-------
A0A388PR45      VNALAGLALGFFAGVGLVLLLGTLDDRLKSVRDLEGGLGIPVLGTVP--KVSETAGPDR-
A0A388QR61      FNALAGLLLGLFSGVGLVVLMGMLDDRIKSVKDIEAGLGVQVLGTVP--KVAETTGPDR-
A0A4P5YHI0      FNALAGLLLGLFSGVGLVLLMGMLDDRIKSVKDIEAGLGVQVLGTVP--KVAETTGPDR-
A0A2A2RS01      MNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVP--KVTEAVGPDR-
A0A2A2Y1A7      MNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVP--KVTEAVGPDR-
A0A388PDH9      MNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVP--KVIEAVGPDR-
A0A2G4H1E7      YAALIGFGSGLLFGIVLVFVLGALDERIKSAADIEGSLGLPLIGTIP--QVVRASGPDR-
A0A2G4GZA6      LNALVGMGSGLLFGVVLIVVIGTLDSRIKSAKDVEGSLGLPLIGTIP--RVANVSGPDR-
A0A388P514      FNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKDVEDSLGLPLIGTVP--RVANVSGPDR-
A0A2A2YG59      FNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKDVEDSLGLPLIGTVP--RVANVSGPDR-
A0A2G4F7D5      FNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKDVEDSLGLPLIGTVP--RIANVSGPDR-
D5EML0          QMVAAAIVLGAVFLVGCPLVIELIDGRLTSFQDVEQGSHKALLGDVR--FYGQKKGDAVY
A0A7C4PPJ4      KIILVGLFLGLAAGCGIIYLLDKLDDRLELAEDIEAELELPILGQIP--LLTGKQAKQR-
A0A3C1C1M3      RVLLMALLLGLAVGFGLAILTEILEDRVGGIDDIEIGTGVKILAVLP--HVKTRKRKEI-
A0A2E9EYJ1      LHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP---------KDI-
A0A258AXR6      LHLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVEHYLGVPVLAVVP---------KEV-
A0A3D3NZQ6      LNLALGGILGLMFGFGLAFALEFMDTSIKSLDDVERFLGVPVLAVVP---------KNV-
A0A1T4WVZ9      LNLALGGVLGLMLGVGLAFFLEYMDTSVKSLDDVERFLGVPVLAVVP---------KDV-
A0A4R7SSI6      LNLVLGGVLGLMLGIGLAFFLEYMDTSVKSLDDVEKFLGVPVLAVIP---------KDV-
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      -------LQSHLHP---------------------------------QSNSAESFRTIRA
A0A660Q3A0      -------LLSNIAS---------------------------------NSGVAEAYRNVRS
A0A4Q3AQI1      QPTSYLLDREKSTE----------------------------------TNLIENFRVIRT
A0A6N2CMN7      QAVASNVDR----------------------------------------HVTETFRSIHS
A0A2V5UAD5      -------LLEIDDD----------------------------RHVY-----AESYRNLRS
A0A258AXL1      -------QLPDGKE----------------------------SDAKVTTHANESFRIIRS
A0A2E6T1E0      -------IIERDLQ----------------------------AHLHPQSNSAESFRTVRA
A0A2D5W0Q9      ---------------------------------------------------AEGFRTVRA
A0A1Z9KB52      -PKI---VGDDLDD-----------------------------------SLTESFRSMYG
A0A7C5CZ90      ---L---INEGADS-----------------------------------GYAEAYRIVRT
A0A257LYL4      ----------------------------------------------------------RT
A0A4Q2XXY1      ---L---HKQSGMS-----------------------------------PDAEAYRILRT
A0A2V5U7A0      -------YAPASRAKLLPTRMGQTQLDDISTRGKDLIVAHNPLSI-----YSEAYRTIRT
A0A3D4CZT6      ------------------TDVG-------VLHKQSGMSP-----------DAEAYRILRT
A0A4V1S9Q4      ------------------KDVG-------VLHKQSGMSP-----------DAEAYRILRT
A0A355VK99      ------------------QMSK-------KESRNTKLFIQDEHSV-----IAECFHILRN
A0A2V6N5E0      -------------------KEK-------TKGKVDLLQPDDARHV-----FAESYRNIRS
A0A2V6NH44      -------------------KEK-------VKGRMALLQPDDPRHI-----FAESYRNIRS
A0A432FDF6      ------------------QNVG-------SLLDEGDESP-----------HAEAYRVLRT
A0A522ACN3      ------------------QNVG-------YLFEEGSESP-----------HAEAYRVLRT
A0A353DCA1      ------------------KDVG-------VLHKQSGMSP-----------DAEAYRILRT
A0A3C1AXQ2      ------------------KDVA-------VLHRASGFNP-----------DAEAYRILRT
A0A3D0IZR7      -------------------------------KGAKFLTSDDPNSR-----FAEGYRILCA
A0A520LRZ3      ------------------QAVG-------VLHRQSGLSP-----------DAEAYRILRT
A0A356FSV4      ----------------QIKKLD-------STTKAQAVASNVDRH------VTETFRSIHS
A0A3D3DET9      ----------------REKLVA-------SKRQPSLILPEDTRHS-----FVEAYRNLRS
A0A355SVK9      ----------------QIKKLD-------AHSKAQAVASNVDRH------VTETFRTIHS
A0A2E5D7I3      -------SESXSXAKTXEGEGA-------PREMVSLARDVVFRDGLHSSLYAESYRILRA
A0A2V5NYE2      ----------------QERAPA-------RRAEIKLIEPEDSRHS-----FLEAYRNLRS
A0A2V6FIP7      LQAH---LHPQSNA-------------------------------------AEGFRTIRA
A0A353DI77      MESIRDLPVSMKHI----------------------CPTLAVPGWKTDFVHSEMFRVLRA
A0A1V6GCZ3      -QNVGLLVDEGTES-----------------------------------PHAEAYRVLRT
A0A3C1UJT2      SRLV---MIESPNS-----------------------------------TCSEAFRSLRV
A0A2S7U0Z3      QSI----LSHDPHS-----------------------------------ANAESIRNLRA
A0A5E6MKA7      PADLPMALATHVSP---------------------------------DSAISNSFRQIRT
A0A6B3L936      WRSI---SSSDPNT-----------------------------------VHAESIRNLRA
A0A2N8IR72      -------FIQDEHS-----------------------------------VIAECFHILRN
A0A2N8IV96      -KNVPILHSSDVMG-----------------------------------PDAEAYRILRT
R7E1V8          -KNVPILHSSDVMG-----------------------------------PDAEAYRILRT
A0A2E0R252      GSLA---LDAEDEQ----------------------------------SQSAEAIRTLRA
A0A3E1EF48      ELVL---LSRKD------------------------------------PHASEAIRTLRT
A0A2A2PVG8      AESL---ELARDAQ----------------------------------SKPAESIRTLRT
A0A2E0R421      EGVL---VLNCKDT----------------------------------PLQAEAIRTLRA
A0A2E5EJ69      -RLF---VTKAPNS-----------------------------------SCAEAFRTLRA
A0A2G4I5Z5      -RLF---ISDDPQS-----------------------------------LCAEAFRSMRA
A0A4P5QQV6      APLL-----PDDER----------------------------------HTFVESMRSLRS
A0A1T4WWY4      -APT---VGANVPN-----------------------------------ALLENFRLIRS
A0A3D3LEQ6      -SQT---VGSKVPN-----------------------------------ALLENFRLIRS
A0A3D3NW23      -SQT---VGSKVPN-----------------------------------ALLENFRLIRS
A0A2E7ALI1      -------SHKKKEKEDSGAEAS-------SEKALNFSQDVVFRDGLYSSLYAESYRILRA
A0A178IDB9      -PNV---FRLHKDD-----------------------------------ALAEAYRGIFS
A0A290QD69      -PNV---FRLGKDE-----------------------------------ALSEAYRGVFS
A0A2E7VDS1      -PLI---VGNELDD-----------------------------------GLMESFRSMFS
A0A7C8D3W3      -RIL---ISNLEKH----------------------------------NVFSESLRGVRS
A0A178IFJ2      -NHL---VLQDRDP-----------------------------------DAGEVVRGLYA
A0A357FSP9      -AQA---VASNIDR-----------------------------------HVTEAFRSIHS
A0A2A2R174      -RLF---ISDDPQS-----------------------------------LCAEAFRSMRA
A0A1H2DTI1      -RRL---IQPGDDR----------------------------------HTYSESFRNLRS
A0A1H1MGC9      -AQI---VANNQDK-----------------------------------QVVESFLTLHS
A0A1V5L462      -------LRKEADD-----------------------------------VFAESFRALRS
A0A3D3LGD3      -GFN---------------------------------------------PDAEAYRILRT
A0A350ARX4      -DLL---QVNDSRH-----------------------------------RFAEACRTLRS
B5JIS2          -PHV---VRDNLDL-----------------------------------AKVESFMAVVA
A0A6N6ZC77      -ELL---QPADDRH-----------------------------------MFAEACRTLRS
A0A7C5H7K5      GEII---TLNDDRQ-----------------------------------AFIEAYRTVRS
A0A538NJ59      LPLL---EIDDDRH-----------------------------------VYAESYRNLRS
A0A2A2R3V9      PSLL---VQDDRRH-----------------------------------VYAESFRNVRS
A0A3C1VFY9      LPLL---QPDDLRH-----------------------------------PFVESYRNLRS
A0A2V2SMX4      LPLI---TQNGSPH-----------------------------------SFVEAYRNLRS
A0A522AC27      LGLI---HAEDPRH-----------------------------------QFVEAYRNLRS
A0A6M1RFD0      LPLL---RPDDDRH-----------------------------------AFAEAYRNVRS
A0A7C3HXH0      LPLL---RPDDDRH-----------------------------------AFAEAYRNVRS
A0A1H2GQN6      -----------KDT-----------------------------------PHAESYRILRA
A0A512M3Y3      -LAINEHGLANADV-----------------------------------NIGETFRIIRS
A0A4P5R5J1      -------LASNDPR----------------------------------HALLESFRTLRS
A0A4P5YK43      -PLLANRLEPNS-------------------------------------LFAESIRGVRS
A0A2A2RPW6      -RLF---ITDDPQS-----------------------------------LCAEAFRTLRA
B1ZT68          -AHV---YRLHKDD-----------------------------------GLTESYRGIYS
W0J7C2          -ARI---FLSHASH-----------------------------------DLSEAYRGIFS
B4D1I7          -PAI---LMPEDER----------------------------------HAFAEAFRSLRS
A0A353F286      -GMS---------------------------------------------PDAEAYRILRT
A0A354FSA6      -GMS---------------------------------------------PDAEAYRILRT
A0A3B9GA54      -GMS---------------------------------------------PDAEAYRILRT
A0A520LEH8      -GMS---------------------------------------------PDAEAYRILRT
A0A6B2M0T8      -RLV---LDQMDPQ------------------------------------ASELFRQIHS
A0A2D7B7R6      RLVM---IESPNST------------------------------------CSEAFRSLRV
A0A2E5K4P7      -ARI---IESAKDN-----------------------------------HVKEAFRSIFS
A0A2V6F9Q9      -------LQAEDPR----------------------------------HIFAESYRNIRS
A0A2V6NZZ3      -------LQPDDPR----------------------------------HIFAESYRNIRS
A0A2V6EBU2      -------LQPDDPR----------------------------------HIFAESYRNIRS
A0A2V6EY06      -------LQPDDPR----------------------------------HIFAESYRNIRS
A0A2V6ME53      -------LQPDDPR----------------------------------HIFAESYRNIRS
A0A538NUU0      -------LQPDDPR----------------------------------HIFAESYRNIRS
A0A2V6NIJ1      -------LQPDDPR----------------------------------HIFAESYRNIRS
A0A2V6C292      -------LQPDDPR----------------------------------HIFAESYRNIRS
A0A2V6D2X0      -------LQPDDPR----------------------------------HIFAESYRNIRS
A0A2V5ZUK1      -------LQPDDQR----------------------------------HVFAESYRNIRS
A0A2V5XFN9      -------LQPDDAR----------------------------------HVFAESYRNIRS
A0A2V6EZC8      -------LQPDDAR----------------------------------HVFAESYRNIRS
A0A2V6I7Z5      -------LQPDDAR----------------------------------HVFAESYRNIRS
A0A3B9LCP2      -------LQPDDAR----------------------------------HVFAESYRNIRS
A0A3C0R669      -------LQPDDAR----------------------------------HVFAESYRNIRS
A0A2V6EID2      -------LQPDDAR----------------------------------HIFAESYRNVRS
A0A2V6MHB0      -------LQPDDAR----------------------------------HIFAESYRNVRS
A0A2W5YWL9      -------LQADDPR----------------------------------HTFAESYRNVRS
A0A2V5NH62      -------LQPDDAR----------------------------------HVFAESYRNVRS
A0A2W6A620      -------LQPDDAR----------------------------------HVFAESYRNIRS
A0A2V5PIJ4      -------LQQDDAR----------------------------------HVLSESFRNVRS
A0A2V6K2G8      -------LQPDDMR----------------------------------HVFAESYRNIRS
A0A2V5W206      -------LQPDDAR----------------------------------HVFAESYRNIRS
A0A2V6MW77      -------LQPDDAR----------------------------------HVFAESYRNIRS
A0A6N4WVA3      -SVL---LRKNDDR----------------------------------YVFAEACRNLRT
A0A0R2XPB1      -SVL---LRKNDDR----------------------------------YVFAEACRNLRT
A0A348NQP1      -SVL---LRKNDDR----------------------------------YVFAEACRNLRT
A0A357FV58      -SVL---LRKNDDR----------------------------------YVFAEACRNLRT
A0A2G4GZN8      -ALL---ARQDKDR-----------------------------------IATEAVRSIYS
A0A348NPT1      -AQA---VASNIDR-----------------------------------HVTEAFRSIHS
A0A2E1KV60      -SHI---VASSSDR-----------------------------------HVIENFRSMLS
A0A2D7F4D9      -SHI---VTSTTNR-----------------------------------HVTENFRSMLS
A0A3R7RBR8      -SHI---VTSTTNR-----------------------------------HVTENFRSMLS
A0A2E0NH28      -AQA---VASNVDR-----------------------------------HVTETFRSIHS
A0A350AS32      -AQA---VASNVDR-----------------------------------HVTETFRSIHS
A0A368BGT4      -AQA---VASNVDS-----------------------------------HVTETFRSIHS
A0A6N6PLV8      -TVL---MKTTGDS-----------------------------------PDAEAYRILRA
A0A2E0V4K6      -------AAEKSNKERQGEGAS-------RDEEHLWDSGIVFRPGLQSSLYAESYRILRA
A0A290QE54      -YSL---VLKNREA-----------------------------------PGVESFLSVYS
A0A1H1SWX2      -HSL---VNSNRTS-----------------------------------PGSEAFLSVYS
A0A1D8AZK8      -HSL---VNSNKTS-----------------------------------PGSEAFLSVYS
A0A4Q1C9I5      -HSL---VNSNKAS-----------------------------------PGSEAFLSVYS
A0A2E6NAH3      -AQA---VASNVDR-----------------------------------HVTETFRSIHS
A0A2A5VZA5      -AQA---VAANVDR-----------------------------------HVTETFRSIHS
A0A424R295      -AQA---VAANVDR-----------------------------------HVTETFRSIHS
B4CZV9          TAVA---SDDTTKH-----------------------------------GLVENFRVIRT
A0A1G3ZL71      TLAI---LSKATPG-------------------------------------VESFLSVYS
A0A556QP09      KLVL---DNKNTSG-------------------------------------VEPFLGVYS
A0A2T6DX88      SLVR---RSEEAPG-------------------------------------TESFLSIYS
A0A2T6CWI7      TLML---TEKQVQG-------------------------------------AESFLSVYS
A0A3E1E5C8      SLLL---KGPQTPG-------------------------------------AEAFLSVYS
B1ZZ74          SLLL---SGKQAPG-------------------------------------VEAFLSVYS
A0A3B9FM17      -PLI---VGNDLDD-----------------------------------GLTEAFRSMYS
A0A0E3YV65      -PHL---LTRAADQ-----------------------------------DAAETIRNLYG
W0J900          -NHL---VLQDTDP-----------------------------------DAGEIIQTLYS
R7E4L8          -PLV---VTNGRS------------------------------------FMEECFHILRN
A0A4Q3BVY2      RSPA---QGASVPN-----------------------------------YLLECFRVIRA
A0A4P6PCA7      ---IAKSGIVDSFG-----------------------------------PMVEVFVGING
A0A2T6DSN5      -PNV---FRLGKDD-----------------------------------SLSEAYRGVFS
A0A317ZIW7      -MVL---LRKSDER----------------------------------YIFAEACRNLRT
A0A7C4PPT4      -PVAG----GHLDR-----------------------------------QIVENFRVIRT
A0A7C4QZX4      -PSID--LKGNPDR-----------------------------------QLTENFRVIRT
A0A2D7WMI4      -PLI---VGNDLDD-----------------------------------GLGESFRSMFS
A0A2D6VHX5      -PKI---VGDDLDD-----------------------------------SLTESFRSMYG
A0A2D8I214      -PLI---VGNDLDD-----------------------------------GLTESFRSMFS
A0A1Z8VL41      -PLI---VGNDLDD-----------------------------------GLTESFRSMYS
A0A2E6TNA4      -PLI---VGNDLDD-----------------------------------GLTESFRSMYS
A0A1Z8RG47      -PLI---VGNDLDD-----------------------------------GLTESFRSMYS
A0A1Z8RJJ5      -PLI---VGNDLDD-----------------------------------GLTESFRSMYS
A0A2D7V631      -PLI---VGNDLDD-----------------------------------GLTESFRSMYS
A0A354RA24      -PLI---VGNDLDD-----------------------------------GLTESFRSMYS
A0A2E9RV62      -PLI---VGNELDD-----------------------------------GLTEAFRSMYS
A0A2E4AY96      -PLI---VGNDLDD-----------------------------------GLAESFRSMFS
A0A3B9B9P4      -PLI---VGNDLDD-----------------------------------GLAESFRSMFS
A0A2D5Y6N6      -PLI---VGNDLDD-----------------------------------GLTESFRSMFS
A0A2E7HSS8      -PLI---VGNDLDD-----------------------------------GLTESFRSMYS
A0A2D8VCK3      -PLI---VGNDLDD-----------------------------------GLTEAFRSMYS
A0A350QVY4      -PLI---VGNDLDD-----------------------------------GLTEAFRSMYS
A0A2E4ZYR7      -PLI---VGNELDD-----------------------------------SLMESFRSMFS
A0A2E6TCV1      -PLI---VGNELDD-----------------------------------SLMESFRSMFS
A0A3D4HHL8      -GDILNPIKADDDR----------------------------------IIFAEACRNLRS
A0A366HV03      RGIE---SDPRKPN-----------------------------------HVLECYRVLRA
A0A6G6K911      RGIE---TDPRKPN-----------------------------------HVLECYRVLRA
A0A5R8KAF2      RSPS---IGAKSPN-----------------------------------HLLESFRLIRS
A0A7C4LRZ6      -LII---TQMDEHS-----------------------------------MFAESVRVVRS
A0A2V2SDN0      -------LRREALA-------------------------------AQRFEFLESFRNIRS
A0A1V6GL40      -PSL---ILPEDTR----------------------------------HSFVEAYRNLRS
A0A2V5X6Z6      -LGV---EALEKQR----------------------------------FEFLEAFRSIRS
A0A2V5VGZ7      -LGV---EALEKQR----------------------------------FEFLEAFRSIRS
A0A2V5U130      -LGV---EALEKQR----------------------------------FEFLEAFRSIRS
A0A2V6C237      -LCV---EGLEKQR----------------------------------FEFLEAFRSIRS
A0A3R8L982      KLFAVGPNAADESGGGNNNSEG-------APDRRRDPERDPHTNDGQGEHATEAFLSIFS
A0A6N6QBS9      -LLL---HRMKSHT-----------------------------------MFAESLRGIRS
A0A2E7HPU9      -KVL---AQLKDEKEKQLKVSD-------PPGIELWDSRLIFRPALLQTLYTEAYRILRA
A0A388PR45      -ALL---ARQDKDR-----------------------------------QATEAVRAIYS
A0A388QR61      -ALL---ARQDKDR-----------------------------------LATESVRAIYS
A0A4P5YHI0      -ALL---ARQDKDR-----------------------------------LATESVRAIYS
A0A2A2RS01      -ALL---ARQDKDK-----------------------------------VATEAVRAIYS
A0A2A2Y1A7      -ALL---ARQDKDK-----------------------------------VATEAVRAIYS
A0A388PDH9      -ALL---ARQDKDK-----------------------------------VATEAVRSIYS
A0A2G4H1E7      -ALL---ARQESDR-----------------------------------IATEAIRSIYS
A0A2G4GZA6      -ALL---ARQDKDR-----------------------------------IATEAVRSIYS
A0A388P514      -ALL---ARQDKDR-----------------------------------IATEAVRSIYS
A0A2A2YG59      -ALL---ARQDKDR-----------------------------------IATEAVRSIYS
A0A2G4F7D5      -ALL---ARQDKDR-----------------------------------IATEAVRSIYS
D5EML0          QAVL---QKDADL--------------------------------------LESFRSIYS
A0A7C4PPJ4      -ILI---TQMEEHS-----------------------------------MFAESIRVVRS
A0A3C1C1M3      -ATT---SLTHQFG-----------------------------------ELAEAFAGLRS
A0A2E9EYJ1      -NVL---XXEXGLS-----------------------------------PDAEAYRILRT
A0A258AXR6      -GVL---HRSSGFN-----------------------------------PDAEAYRILRT
A0A3D3NZQ6      -GIL---HRATGFN-----------------------------------PDAEAYRILRT
A0A1T4WVZ9      -AVL---HRTSGFN-----------------------------------PDAEAYRILRT
A0A4R7SSI6      -AVL---HRASGFN-----------------------------------PDAEAYRILRT
A0A4P6PD26      ------------------------------------------------------MVSCAS
A0A1Z8SVB5      -----------------------------------------------MYGKIQMNSNVRG
A0A2V5W3Y0      ---------------------------------------------------AESYRNVRS
                                                                            

A0A432FAS4      AISL----SQRAGDLQVMAVTSTIPAEGKSLVASNHAIVMAQTGAKTLLVDFDLRRPSVH
A0A660Q3A0      ALIF----SGAEEYTKALVVTSAVPLEGKTTTCLNVGISLGQAGSRVLLVDADLRRGTMH
A0A4Q3AQI1      NL-LSM--GALTKAPHVIMVTSALPREGKTVVSSNLSISFAQTGARTLLMDTDLRRGRLH
A0A6N2CMN7      A--LRL--NDESKNARIILTTSTVPSEGKSFISSNLSLTFANHGEKTLLLDADLRLPNVA
A0A2V5UAD5      AL-LYQ--GTDGQRPRVLLVTSAVPNEGKSTVAANLARILALGGSRVLLVDGDLRKGALH
A0A258AXL1      SL-PFY--ALPDNPKQVIMVTSARPNDGKTTVAAHLAKSFSDSGERVLLIDADLRRGTLH
A0A2E6T1E0      AI-ALS--QRAGD-LHLMAVTSTVPSEGKSLVASNHAIVMAQTGVKTLLVDFDLRRPSVH
A0A2D5W0Q9      AV-SLV---HKSDKFKVLSMTSTIPSEGKSLVASNLAIVTAQTGVKTLLIDADLRRPSMH
A0A1Z9KB52      KI-Q-M--NSHATGSKSILVTSAIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLH
A0A7C5CZ90      NL-L-F--SRKDERFNTICVVSAGAGEGKSTTVINLAVTFALAGDRVLLVDSDFRRPSLH
A0A257LYL4      NI-E-F--NRKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDGDLRRPRLH
A0A4Q2XXY1      NI-E-F--NRKSADANAITVVSGGAGEGKSTTLVNLAYICAQGGYNTLMIDGDLRRPKLH
A0A2V5U7A0      AL--LL--SQPGGNRKVILLTSPSPGEGKTATTLNLGIALAQDGYRILIIDADLRRGSCH
A0A3D4CZT6      NI--EF--NRNNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVH
A0A4V1S9Q4      NI--EF--NRKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLH
A0A355VK99      NVDSML--PRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDLRKSSLT
A0A2V6N5E0      SI-FFM--PYDGPRPKSFLVTSAVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALR
A0A2V6NH44      SL-LFM--PYQGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARILLIDGDLRRGALR
A0A432FDF6      NI-LFA--GRQSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRVLVVDSDLRRPSMH
A0A522ACN3      NL-LF---SRKDDKLNSIAIVSAGAGEGKSTTVMNLATVFAQADSRVVVVDSDLRRPTLH
A0A353DCA1      NI-EF---NRKNPEDNSITVVSGGAGEGKSTTLVNLAYVCSQGGYTTLMVDADLRRPRLH
A0A3C1AXQ2      NI-EF---NRRNPDANCITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMH
A0A3D0IZR7      KL-N-L--TGARASARTITVLSGGPGEGKSTTTFNLGWVCAQSGMKVLLIDGDIRRPNMH
A0A520LRZ3      NI-E-F--NRKTADANSMTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLH
A0A356FSV4      AI-R-L--NEESKNAKVFLTTSTVPSEGKSFVSSNLALTFANNGDKTLLLDGDLRLPNIA
A0A3D3DET9      SL-LYM--TEAGNRPKTILVTSSVPNDGKSITAANLAITMANAGSRVLLVDADLRKGTLH
A0A355SVK9      SL-R-L--NEESKNAKILVTTSTVPGEGKSFVSSNLALTFANHGERTLLLDADLRLPNVA
A0A2E5D7I3      AV-M-L--LGDEKKRKISAFSXALPGEGKTTTSVNYALALASQGKKTLLMDMDLRKPKVH
A0A2V5NYE2      SL-LYM--VKASERPRTLLVTSSEPNEGKSLTSANLAITMANSGSRVLLVDADLRKGVLH
A0A2V6FIP7      AI-A-L--APKSDQYHLLAITSTIPAEGKSLVASNLAIVTAQTGLKTLLVDADLRRPSVH
A0A353DI77      SI-SLL---GDTNQRKITMITSSVPGEGKTFCAANLALAYAKQGTRTLLVDFDLRKPAVH
A0A1V6GCZ3      NL-L-F--SRKDDKLNTIAIVSAGAGEGKSTTVFNLAAVFAQSGQRTIIVDSDLRRPTLH
A0A3C1UJT2      NI-ESM---TRKKSHKVVLFTSSIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVG
A0A2S7U0Z3      SV-ILL---GKHDNNKVLLVTSAIPGEGKTTVAAELAAAFAMNKERTLLVDLDLRRPALS
A0A5E6MKA7      LL-H-Y--SIPDGRPQVMMFTSSQMGEGKSSTCVNTATVLGQQGT-VLLIDADLRRPSLH
A0A6B3L936      SI-TLL---GRKENNKVLVVTSAMPGEGKTTTAAELAELFALEGERTVLIDFDLRKPRVH
A0A2N8IR72      NV-DSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLT
A0A2N8IV96      NI-E-F--NKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLH
R7E1V8          NI-E-F--NKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLH
A0A2E0R252      GL-TFL---GTSEERRTFLITSAVPGEGKSWVASNLALSFASQGDRTLLIDGDLRKPVQS
A0A3E1EF48      GL-TLL---GDSEERRIFVVTSSLPGEGKSWISANLACGFAQQGERTVLIDADLRKGVLH
A0A2A2PVG8      GL-TFL---GTAEERCTFLIASSVPGEGKSWVASNLAHSFALQGDRTLLIDADMRRPVQG
A0A2E0R421      GL-TFL---GTPESKRTFLITSSVPNEGKSWVASNLALAFAKQNERTLLIDGDLRRPRIH
A0A2E5EJ69      SI-SLL---GREEERRVILFTSAVPSEGKTFCSVNYAIANASQGKKTLIMDFDLRRPSVG
A0A2G4I5Z5      SL-GLL---GRDEDRKVVFFTSAVPSEGKSFCCVNYAVCYAQQGRRTLIIDFDLRKPTLA
A0A4P5QQV6      SI-FFL--PVEGPPPRTFLVTSAVPNEGKSTVALNFAITMAMFDVRVLLVDGDLRRGELH
A0A1T4WWY4      SI-LLN--GSPKGDGRVIMLTSARPSEGKTTVSSNVAWAFSSLGEKTLLIDCDLRRGRVH
A0A3D3LEQ6      SI-LLN--RSPMGEARVIMLTSARPGEGKTTVSANVAWAFSSMGEKTLLIDCDLRRGRVH
A0A3D3NW23      SI-LLN--RSPMGEARVIMLTSARPGEGKTTVSANVAWAFSSMGEKTLLIDCDLRRGRVH
A0A2E7ALI1      AV-MLL---GDEKERKITAFSSALPGEGKTTTSINYALATASQGKKTLLLDMDLRKPKVH
A0A178IDB9      EI-E-I--RSPVPFPKRILITSSVPGEGKSLTASNMAAVFAAHGRRTLLVDCDFRRPSLR
A0A290QD69      EV-E-I--RSIVPYPKRILFTSSIPSEGKSLTASNMAAVFAAHGKKTLLVDCDFRRPTLR
A0A2E7VDS1      RI-Q-M--NSTADGPKSILITSAIPSEGKSLLAANLAYSCANHGRRTILLDFDLRRPGLH
A0A7C8D3W3      AI-M-F--DPESKKNQMIAVTSAIPGDGKTTFTVNFAATMASAGHRVLLVDADMRRGNIH
A0A178IFJ2      QL-K-L--SSRLDAPKTLLVTSTIPGEGKSFVASNLATAFAAHGLRTLIIDGDLRRPVQH
A0A357FSP9      AL-K-I--SEESKNAKVIVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVA
A0A2A2R174      SL-GLL---GREEDRKVVFFTSAVPSEGKSFCCVNYAVAYAQQGKRTLIIDFDLRKPTLA
A0A1H2DTI1      AL-MFM--EVDGARPRTILFTSASPDEGKTTVATNFAITLAMLEGRVLLVDADLRRGGLN
A0A1H1MGC9      SL-R-L--KDESKRAQAILVTSTIPGEGKSFTTTNLALTFAAHGEKVVIVDCDLRKPNIH
A0A1V5L462      SI-L-LHRQDSKEPRQVFLVTSCAPAEGKSTVSSNLAVTLAYSGAKTLLIDCDLRRGHLH
A0A3D3LGD3      NI-E-F--NRKNRDANCITVTSGGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMH
A0A350ARX4      TI-LLKQSDAVHTSSQSILITSATPSEGKSTISANLAIALSHLGKRVLLIDADMRRGGVH
B5JIS2          QL-E-L--TSKQEGPKSFVVTSTTTSEGKSTIAANVASGFVQIKRKTIIIDGDLRRPCLH
A0A6N6ZC77      SL-FFM--GADADRPEVILVTSSVPEEGKSTVAMNLAAAIALTSSKVLLVDADLRRGQIA
A0A7C5H7K5      AI-I-Y--QTRNRPIKTILVTSSLPGEGKSVTAANLAIALAMANAKVLLVDADLRKGRLH
A0A538NJ59      AL-LYQ--GTDGQRPRVLLVTSAVPNEGKSTVAANLARILALGGSRVLLVDGDLRKGALH
A0A2A2R3V9      SL-LFM--AIDGTRPKTLLITSAIPNEGKSTFASNLAITMAFAGSRVLLVDADLRRGRIH
A0A3C1VFY9      SL-LYM--AETGTRPHTLLITSAVPNDGKSVTAANLAITLATGGSRVLLVDGDLRKGSLH
A0A2V2SMX4      SL-LYM---GNGSRPRTLLITSSAPGEGKSLTAENLGAILANTGSRVLLVDGDLRKGVLH
A0A522AC27      SL-LYM--NEGGNKRRTLLVTSSVPNDGKSMTAANLAITLAITGSRTLLVDADLRKGLLH
A0A6M1RFD0      SL-LFMPAGNGSEKPRLLLVTSSIPNDGKSMTTANLAITLALGGARVLLVDADLRKGVLH
A0A7C3HXH0      SL-LFMQPTNGDARPSLLLVTSSIPNDGKSLTTANLAITLALGGSRVLLVDADLRKGVIH
A0A1H2GQN6      RI-D-L--QAHSGPGNTLTMISGGPGEGKSTTLFNLAHVCAEAGQSVIILDADLRRPSQH
A0A512M3Y3      SI-PLY--VPGENKCQVIMVTSSRPSEGKTMVSSLLARSFADADQKTLLIDADMRRGRVH
A0A4P5R5J1      SI-IFL--PIEGARPKTILVTSATPGEGKTTIAANLAITFAFSGARTLLVDADLRLGRIA
A0A4P5YK43      AV-M-F--GTQSKKKQVMVITSALPGDGKTTFSVNFASTLANAGLKVLLIDSDLRRGTVS
A0A2A2RPW6      AL-S-L--LGRDEDRKVVLFTSAVPSEGKSFTGANYAVAHAQQGKKTLIIDLDLRKPSLS
B1ZT68          AI-D-I--HSTEPFPKAIISTSSMPGDGKSLTASNLAAAFAAHGRRTLLVDCDLRRPVLH
W0J7C2          EI-E-V--RSPLAFPKALLVTSSVPAEGKSLLCCNLAAVFASHKRRTLLVDCDLRRPTLH
B4D1I7          SI-AFL--PVAGAPPKVILITSAVPNEGKSTVAVNFAITLALAGSRVLLVDGDLRRGELH
A0A353F286      NI-E-F--NRKNPDNNSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLH
A0A354FSA6      NI-E-F--NRKNPDNNSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLH
A0A3B9GA54      NI-E-F--NRKNPENNSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLH
A0A520LEH8      NI-E-F--NRKNPENNSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLH
A0A6B2M0T8      QI-LLK--NKKLQPGHTFVVTSALPKEGKSFFSINLAASFGRHHYKTLLIDCDFRRPSIG
A0A2D7B7R6      NI-ESM---TRKKSHKVVLFTSSIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVG
A0A2E5K4P7      TL-G-V--NDASKDAQVILNTSTIPGEGKSFVSTNLAFTYAESGNRVLLLDCDLRLPNIA
A0A2V6F9Q9      SI-LFM--SYEGPRPKTILVTSAIPNEGKSTVSANLAIALALSGARVLLIDGDLRRGTLR
A0A2V6NZZ3      SL-LFM--PYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALR
A0A2V6EBU2      SL-LFM--PYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALR
A0A2V6EY06      SL-LFM--PYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALR
A0A2V6ME53      SL-LFM--PYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALR
A0A538NUU0      SL-LFM--PYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALR
A0A2V6NIJ1      SI-LFM--PYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALR
A0A2V6C292      SI-LFM--PYAGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLR
A0A2V6D2X0      SI-LFM--PYAGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLR
A0A2V5ZUK1      SI-FFM--PYEGPRPKSFLITSAVPSEGKSTVSSNLAITMALSGAKVLLIDCDLRRGAIR
A0A2V5XFN9      SI-FFM--PYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALC
A0A2V6EZC8      SI-FFM--PYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALC
A0A2V6I7Z5      SI-FFM--PYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALC
A0A3B9LCP2      SI-FFM--PYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALR
A0A3C0R669      SI-FFM--PYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALR
A0A2V6EID2      SI-FFM--PYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALR
A0A2V6MHB0      SI-FFM--PYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALR
A0A2W5YWL9      SI-FFM--PYDGPRPKTLLITSAVPSEGKSTISANLAITMALSGARTLLIDGDLRRGALR
A0A2V5NH62      SI-FFM--PYEGPRPKTMLVTSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALR
A0A2W6A620      SI-FFM--PYEGPRPKTLLITSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALR
A0A2V5PIJ4      SI-FFM--PYEGPRPKTFLVTSAIPNEGKSTVSANLSITMALAGARTLLIDGDLRRGALR
A0A2V6K2G8      SI-FFM--PYEGPRPKSFLVTSAVPSEGKSTVSANLAITMALSGARTLLIDCDLRRGALR
A0A2V5W206      SI-FFM--PYDGPRPKSFLVTSAVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALR
A0A2V6MW77      SI-FFM--PYDGPRPKSFLVTSAVPSEGKSTISANLAITMALSGARTLLIDCDLRRGGLR
A0A6N4WVA3      SV-FFM--GDEHVKPSVFAVTSAVPSEGKSTVAANLAVALSFAHSKVLLVDADLRRGRLH
A0A0R2XPB1      SV-FFM--GDEHVKPSVFAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLH
A0A348NQP1      SV-FFM--GDEHEKPSVFAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLH
A0A357FV58      SV-FFM--GDEHEKPSVFAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLH
A0A2G4GZN8      AL-K-V--NPAVSKTRVFLVTSTRPSEGKTFVATNLALLFAQHSERVLVIDADLRLPNVG
A0A348NPT1      AL-K-I--SEESKNAKVIVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVA
A0A2E1KV60      YL-K-I--SEHSKNSNVFLITSTTPSEGKSFISSNLALSFSAHGEKVLLLDADLRLPNVA
A0A2D7F4D9      YL-K-I--NDQTKNSNVFLLTSTVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVA
A0A3R7RBR8      YL-K-I--NDQTKNSNVFLLTSTVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVA
A0A2E0NH28      AI-R-L--NEESKNAKVFLTTSTVPSEGKSFVSSNLALTFANNGDKTLLLDGDLRLPNIA
A0A350AS32      AL-K-L--NDESKNAKVIVTTSTVPGEGKSFVSSNLALTFANHGEKTLLLDGDLRLPNVA
A0A368BGT4      AL-K-L--NDQSKNAKIILATSTVPGEGKSFVSSNLSLTFANHGEKTLLIDGDLRLPNVA
A0A6N6PLV8      AV-E-F--NKPHRDANTYTLISGGPGEGKSTTMNNLAYICAKGGYNVLVVDADLRRATQH
A0A2E0V4K6      SV-V-L--LGDEKERKVSLFFSALPGEGKTTTSINYALATASQGRKTLLLDMDLRKPRVH
A0A290QE54      SA-K-I--HSKLDYPKSILVTSTIPGEGKTLVSSNLAASFARHGKRTLLIDCDLRRPMVH
A0A1H1SWX2      AV-K-I--QSKLDFPKSILVTSTIPGEGKTMISCNLAGSFARHGKKVLLIDCDMRRPMLH
A0A1D8AZK8      AV-K-I--QSKLDFPKSVLVTSTIPGEGKTMISCNLAASFARHGKRVLIIDCDMRRPMLH
A0A4Q1C9I5      AV-K-I--QSKLDFPKSILVTSTIPGEGKTMISCNLAASFARHGKRVLIIDCDMRRPMLH
A0A2E6NAH3      AL-K-L--SDHSKNAKVILTTSTVPGEGKSFVSSNLSLTFANHGEKTLLLDCDLRLPNVA
A0A2A5VZA5      SL-K-L--NDESKNAKIILATSTVPSEGKSFVSSNMALTFANHGERTLLLDADLRLPNIA
A0A424R295      SL-K-L--NDESKNAKVILATSTVPSEGKSFVSSNMALTFANHGERTLLLDADLRLPNIA
B4CZV9          NI-LSM--GELSKPPHVVMVTSAMPKEGKTVVSSNLAASFALTGAKTLLIDTDLRRGRLH
A0A1G3ZL71      AV-K-I--QSKIDYPKVILVTSTIPGEGKTLVSCNLAGSFARHGRSTLIIDCDMRRPMLH
A0A556QP09      SV-K-I--HSKLDFPKSILVTSTIPGEGKTLISSNLAGSFARHGKSVLLIDCDLRRPMMH
A0A2T6DX88      SV-K-I--HSKLDFPKAILVTSTIPGEGKTLVSCNLAASFARHGKSTLIVDCDLRRPMLH
A0A2T6CWI7      SI-K-I--HSKLDFPKSVLVTSTIPGEGKTLISCNVAGCFARHGKKTLLIDCDLRRPMLH
A0A3E1E5C8      SV-K-I--HSKLDFPKSILITSTIPGEGKTLIACNLAGSFARHGKRTLLIDCDLRRPMLH
B1ZZ74          SV-K-I--HSKLDFPKTVLVTSTIPGEGKTLISCNLAGSFARHGKNTLLIDCDLRRPMLH
A0A3B9FM17      RI-Q-M--NSQTDYPKLILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLH
A0A0E3YV65      QL-K-A--GSRLDLPKILLVTSTLPGEGKSFVASNLAASFASHGIKTLLVDTDFRRPTLH
W0J900          QL-R-L--NSRLDAPKTLIVTSTVPGEGKSFVASNLATAFAAHGMRTLIIDGDLRRPVQH
R7E4L8          NA-ELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLS
A0A4Q3BVY2      NI-I-M-HPNRRNRSQVVLVTSARPQEGKTTQATNLAWAFQSMGEKTLLLDCDLRRGRIH
A0A4P6PCA7      YI-L-S--EKYKEQSRVLMISSAGPGEGKTISSCNLAISLARNGLKTLLIDADLRRPQIG
A0A2T6DSN5      EI-E-I--RSVVPFPKRLLVTSSVPSEGKSLTASNLAAVFAAHGRRTLLVDCDFRRPTLR
A0A317ZIW7      SV-F-F-MGDESWKPSVFAVTSAVPSEGKSTVSANLAVALSFSHSKVLLVDADLRRGRLH
A0A7C4PPT4      NL-L-S-MGAVTHDPQAIVIASAMPEEGKTVVSYNLARSFAQMGEKTLIIDADLRRGRLH
A0A7C4QZX4      NL-L-S-MGAVTRNPQALVVASAMPEEGKTMVSFNLAQSFAQMGEKTLLIDADLRRGRLH
A0A2D7WMI4      KI-Q-M--YSKTDYPKIILVTSAIPSEGKSLISANLAYTCANHGKNTILIDFDLRRPGLH
A0A2D6VHX5      KI-Q-M--NSHVTGSKSILVTSAIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLH
A0A2D8I214      RI-Q-M--NSQTEYPKTILITSAIPSEGKSLISANLAYSCANHGRRTVLVDFDLRRPGLH
A0A1Z8VL41      RI-Q-M--NSNADYPKIILVTSAIPSEGKSLISANLAXSCANHGRKTILIDFDLRRPGLH
A0A2E6TNA4      RI-Q-M--NSNADHPKIILVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLH
A0A1Z8RG47      RI-Q-M--NSNADYPKVLLVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLH
A0A1Z8RJJ5      RI-Q-M--NSNADYPKVLLVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLH
A0A2D7V631      RI-Q-M--NSNSDYPKVLLVTSAIPSEGKSLISANLAYSCANHGRKTILIDFDLRRPGLH
A0A354RA24      RI-Q-M--NSNSDYPKVLLVTSAIPSEGKSLISANLAYSCANHGRKTILIDFDLRRPGLH
A0A2E9RV62      RI-Q-M--NSKTDYPKTILITSAIPSEGKSLLAANLAYSCANHGRKTILVDFDLRRPGLH
A0A2E4AY96      KI-Q-V--NSLVDFPKVILVTSAIPSEGKSLISTNLAFTCANHGKKTILIDFDLRRPGLH
A0A3B9B9P4      KI-Q-V--NSLVDFPKVILVTSAIPSEGKSLISTNLAFTCANHGKKTILIDFDLRRPGLH
A0A2D5Y6N6      RI-Q-M--NSLNDYPKTILVTSAIPSEGKSLISANLAYSCANHGKKTILIDFDLRRPGIH
A0A2E7HSS8      RI-Q-M--NSLSDYPKLILVTSAIPSEGKSLISANLAHSCANHGRKTILIDFDLRRPGLH
A0A2D8VCK3      RI-Q-M--NSQTDYPKLILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLH
A0A350QVY4      RI-Q-M--NSQTDYPKLILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLH
A0A2E4ZYR7      RI-Q-M--NSHVEYPKSMLITSAIPSEGKSLLAANLAYSCANHGRRTILIDFDLRRPGLH
A0A2E6TCV1      RM-Q-M--NSHIDYPKSMLITSAIPSEGKSLLAANLAYSCANHGRRTILIDFDLRRPGLH
A0A3D4HHL8      SV-L-F-GGDENEAHQVVAVTSSVPGEGKSTMAANLAVTLAFAGKKTLLLDADLRRGVLH
A0A366HV03      HL-G-L-QLGNREGAKVVMFTSARPSEGKTVTAANLAWTLQSIGAKTLLVDLDFRKGRVH
A0A6G6K911      HL-G-L-QLGNREGAKVVMFTSARPSEGKTVTAANLAWTLQSIGVKTLLVDLDFRKGRVH
A0A5R8KAF2      HI-L-L-HPNSKGKSQVIMVTSARPSEGKTSQAANLAWAFQSMGSRTLLIDCDLRRGRVH
A0A7C4LRZ6      AV-M-L--GVEGGKKQVQVITSAVPGDGKTTFSVNFAITLAIAGHRVLMVDADMRRGNIH
A0A2V2SDN0      CL-W-F-MHQNGNKPKSLLIGSSVPQEGKSTVALYLAATMAIGGSKVLLIDGDMRRAKLH
A0A1V6GL40      SL-L-Y-MTEAGNRPKTILVTSSVPNDGKSITAANLAITMANAGSRVLLVDADLRKGTLH
A0A2V5X6Z6      SL-L-F-MSNGGTKPKTIVVASSVPEEGKSTVALYLAATLAKGNSRVLLIDADMRRTALH
A0A2V5VGZ7      SL-L-F-MSNGGTKPKTIIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLH
A0A2V5U130      SL-L-F-MSNGGTKPKTIIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLH
A0A2V6C237      SL-L-F-MSNGGTKPKTIIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLH
A0A3R8L982      AV-K-I--HSRLDFPKSILVTSTIPGEGKTLISCNLAGAFARHGRRTLLIDCDLRRPTIH
A0A6N6QBS9      AL-L-L--SPEGTSKRLLAVTSAVPGDGKTTFTANFAITLANSGHKTLLVDADLRRGNIH
A0A2E7HPU9      SV-T-L--LGKEDERKVSLFTSSIPGEGKTTTSSNFAIAAAQQGKKTILVDFDLRKPAVH
A0A388PR45      AM-K-I--NPASAAGRVFLVTSTRPGEGKTFVATNLALAFAQHAERVIVVDADLRLPNVG
A0A388QR61      AM-K-I--NPATAAGRVFLVTSTRPGEGKTFVATNLALTFAQHSERVIVVDADLRLPNVG
A0A4P5YHI0      AM-K-I--NPATAAGRVFLVTSTRPGEGKTFVATNLALTFAQHSERVIVVDADLRLPNVG
A0A2A2RS01      AM-K-V--SPATANSRVFLVTSTRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVG
A0A2A2Y1A7      AM-K-V--SPATANSRVFLVTSTRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVG
A0A388PDH9      AM-K-V--SPATANSRVFLVTSTRPGEGKTFVATNLALSFAQHAERVLVIDADLRLPNVG
A0A2G4H1E7      AL-K-V--NPAVSKARVFLLTSTRPSEGKTFVATNLAMIFAQHSERVLIIDADLRLPNVG
A0A2G4GZA6      AL-K-V--NPAVSKARVFLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVG
A0A388P514      AL-K-V--NPAVSKARVFLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVG
A0A2A2YG59      AL-K-V--NPAVSKARVFLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVG
A0A2G4F7D5      AL-K-V--NPAVSKARVFLVTSTRPSEGKTFIATNLALIFAQHSERVLIIDADLRLPNVG
D5EML0          SI-R-MRADLSAKRKASFVITSSVPNEGKSMVACNLSAVIAKHNYRVLLVDCDLRNPSLH
A0A7C4PPJ4      AI-M-L--GVDSPQKQVQLITSAVPGDGKTTFSVNYAITLALAGNRVLMVDADLRRGNIN
A0A3C1C1M3      VL-D-S--PLYRDHSQIVLVASSLPEEGKTTTSCNLATACALNGQKTLLIDFDLRRPRVG
A0A2E9EYJ1      NX-E-F--NRKNADAXAITLVSGGAGEGKSTTLVXLAYVCAQGGYNTLMIDGDLRRPQLH
A0A258AXR6      NI-E-F--NRKTPDANCLSVVSGGAGEGKSTTMVNLAYVCAQGGYNVLLIDADLRRPSLH
A0A3D3NZQ6      NI-E-F--NRKNRDANCITVTSGGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMH
A0A1T4WVZ9      NI-E-F--NRKNPDANCITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMH
A0A4R7SSI6      NI-E-F--NRRNPDANCITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMH
A0A4P6PD26      NK-PCF--LRGGSHRGAFAVLSSGAGEGKSTTCFNLAFVCAQQGEKVLLIDADLRRPVQH
A0A1Z8SVB5      S--------------RSILVTSAIPSEGKSLISANYAHTCANHGSKTILIDFDLRRPGLH
A0A2V5W3Y0      SI-FFM--PYEGPRPKTMLVTSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALR
                                          :**:      .          :::* *:*     

A0A432FAS4      KAFQLQS---P---R-GLSSYLLGKIDSIEEI-VHHAE-------VPNLDVIC---CGAV
A0A660Q3A0      KFFGVEA---D---R-GLTDILVGRAKP-EAV-IQRTP-------IPNVDFIG---SGPY
A0A4Q3AQI1      RLFGYRK---S---P-GLSNVLLGE-CTLDEA-LRPTV-------SENLTVLS---AGKH
A0A6N2CMN7      RSLQLEN---D---Y-GLLDHIDKG-VSLDEV-IIKDV-------YPNLDVLP---TGGK
A0A2V5UAD5      ELMGMNH---E---P-GLSEMLRCP-EDLEKI-IQTNS-------LPNFFFVS---SGGR
A0A258AXL1      KAFNLGN---K---NLGLMEILADR-VKWNDA-VRSSG-------VENLDFIS---RGND
A0A2E6T1E0      KAFQLQS---P---R-GLSSYLLGK-VDSIDAIVHQTE-------VPNLDVIC---CGAV
A0A2D5W0Q9      KAFQMQS-------PIGLSAYLTGQITDPSEI-TQTTE-------VPNLDLIC---CGAV
A0A1Z9KB52      NFCDESN---D---E-GVMTILNTP-NATEEE-VTDKLKKVLCSIHPNLFLLP---SGGK
A0A7C5CZ90      KLLGVSN---K---I-GLTDLLFRE-KKLDD--------VIVHTKLETLDFIP---SGRI
A0A257LYL4      TFFDINN---S---V-GLTNYLTTE-LMLED--------VILQTPVDNLYFMP---SGIL
A0A4Q2XXY1      TFFDINN---S---V-GLTNYLTTA-LQLED--------VILQTPVENLYFMP---SGIL
A0A2V5U7A0      SRIGLRN---H---R-GLSNVLGGE-MPIEQL-IQPTS-------IAGLSLVT---RGVC
A0A3D4CZT6      TFFDINN---S---V-GLSNYLTTD-LMLEDV-ILQTP-------VDNLYFLP---SGIL
A0A4V1S9Q4      TFFDINN---S---V-GLTNYLTTE-LMLEDV-ILQTP-------VDNLYFMP---SGIL
A0A355VK99      RRLGGSG---R---K-GLTSILLRQ-NPDTAG-VIRPV-------GEDTRGMDVLYTGPT
A0A2V6N5E0      ETFGISS---K---I-GFSEVLKQE-VNWREV-VVPTA-------YETLFVLP---RGKT
A0A2V6NH44      EQFGSDS---R---L-GFSEVLQQE-VPWQEV-VMPTT-------YPSLFLLT---RGKA
A0A432FDF6      RFFKLSN---K---I-GLTNYLLGQ-ATIEEV-IQTTE-------LPSLHFIP---SGKL
A0A522ACN3      KMLGVSN---S---L-GLTNYLLKQ-NKLEEV-IQHSN-------VANLDFLP---SGKL
A0A353DCA1      SFFDINN---S---V-GLTNYLTTD-LALEDV-ILQTP-------VDNLYFLP---SGIL
A0A3C1AXQ2      TLFDVSN---S---V-GLTNFLTTN-VQLEEV-VVRTP-------VENLYFLP---SGML
A0A3D0IZR7      NALQIEN---T---L-GLGEYLAGQ-ASLDEL-IQSTA-------IPNLEILT---AGSL
A0A520LRZ3      TFFNINN---S---V-GLTNYLTTD-LALEDV-ILQTA-------YENLFFMP---SGIL
A0A356FSV4      RSLQVSN---D---N-GLIDYIDHD-VDINAV-IVNEV-------YPHLDVLP---AGGK
A0A3D3DET9      RLFGVSP---E---P-GLSDVLAKG-TAWETT-VSATK-------IANLHILP---AGTF
A0A355SVK9      KSLQLEN---D---Y-GLLNHVDKG-VSLDEL-IIKEV-------YPNLDVLP---TGGK
A0A2E5D7I3      RQFNLRR---GDLET-GMSEVLSNQ-CDASEA-V--TK-------TPGIERLDAIFAGGK
A0A2V5NYE2      TLFGLPS---G---P-GLSEALSQG-LNWSEA-VQATR-------TPNLFLLP---RGAI
A0A2V6FIP7      KVFRLQS---P---V-GLSSYLMEKVSRVDEF-IHTTE-------VPHLDVVC---CGAV
A0A353DI77      KIFNEERA--A---RPGIVNVLNGTAAANQAI-TVYPG-------LDTLSVIY---SGPK
A0A1V6GCZ3      KMLRVTN---A---I-GLTNYLLRQ-NTLEEV-IQTTS-------LPTLDFLS---SGKL
A0A3C1UJT2      PEFKLGE---E---YVGVSDLLQSE-----DK-LGQFPDLAIYEATEKLFVLH---GGSH
A0A2S7U0Z3      GTFPDLD---G---GPGIVEVLAGQ-ASIQDV-FSDTE-------IENLTVVC---SGAK
A0A5E6MKA7      KTLGLRP---H---P-GLSELLTNQ-APLEQA-VQATA-------LPNVWAIG---AGRT
A0A6B3L936      ELYPKLK---G---QPGTVDVLIGH-AQFDDV-VAPTR-------VEGLFVVP---SGKK
A0A2N8IR72      RRLGGSG---R---K-GLTSILLQQTTDTTGI-IRPLG-----ENSRGMDILY---TGPM
A0A2N8IV96      RYYELDN---E---V-GLTSYLLED-YPLEEV-IFQTP-------IENLYVMP---AGPT
R7E1V8          RYYELDN---E---V-GLTSYLLED-YPLEEV-IFQTP-------IENLYVMP---AGPT
A0A2E0R252      QVFDYDK---E---HPGLSDHLSLN-RPLKEV-VMKTR------ESENLFIMP---AGSR
A0A3E1EF48      STFNLSR---E---APGVTNLLSRT-SSLAEV-IHQT-------EIENLWFVP---GGGK
A0A2A2PVG8      EVFGYGR---E---PKGLADVLSLG-TPLKEV-ILRSE------VSEDLFLIP---AGSW
A0A2E0R421      KIFGFDR---D---EAGLSDHLSLR-TPLNKV-VKPTD------KSGKLYVLL---AGSP
A0A2E5EJ69      DTFHIDR---K---TPGVTDLLLAN-KTLDEV-ALKTD-------FENLTLIP---AGST
A0A2G4I5Z5      ESFGVEG---E---HFGVSDVLLGK-VPLDQC-VQKTR-------FDNLFLLT---AGTM
A0A4P5QQV6      HALDLPN---G---A-GFGDVLNGD-CALQSA-VQQTR-------VPGLSLLS---RGST
A0A1T4WWY4      EVIGASN---A---V-GMTDLLTGR-ASLSEC-VQKVE-------AENLWAIT---RGMV
A0A3D3LEQ6      NVAGVPN---L---P-GLTRLLTGQ-ATLEEC-LVKSP-------AENLWLLP---RGQV
A0A3D3NW23      NVAGVPN---L---P-GLTRLLTGQ-ATLEEC-LVKSP-------AENLWLLP---RGQV
A0A2E7ALI1      RQFNLRRSELE---K-GMSEVLSNQ-CTPEEA-LTKTP------GIETLDAIF---AGGK
A0A178IDB9      RYFGTAP---G---T-GLLSWLRAHPDDGADT-PLDLATLGIATVENNLHLLP---AGHA
A0A290QD69      RYFGTQS---G---V-GLLPWLRENGSNAA-A-QVETQKMGIVTIAPGLDLLP---AGDA
A0A2E7VDS1      KFCGVSN---D---K-GLLTLINEIHGEHGTE-PERNA---LTEIYPNLYVLP---SGGK
A0A7C8D3W3      NYFETDR---S---P-GLSELLNGE-LHWADV-INSTP-------IETLETIN---TGRL
A0A178IFJ2      RLADAPN---T---H-GLLRWLDKG-GKSGGP-LANDPDLDLLRPAPNLFVLR---AGGT
A0A357FSP9      RSLQLEN---D---F-GMLDHIEKE-VALDEV-IMKAV-------YPNLDVLP---SGGK
A0A2A2R174      ESFGIKE---D---HFGVSDVLLNK-AQLEQA-VQTTR-------FDNLFLLT---AGTT
A0A1H2DTI1      RLLDIDA---P---L-GFTDVLLHG-ADWRKA-VVPSK-------HKNLSVMV---CGKY
A0A1H1MGC9      KSFRLEN---L---K-GVIDVCAGT-QTVDQV-LCRNV-------HPNLDVIP---AGGR
A0A1V5L462      NKFGIDR---D---P-GLAELLEHPEMDVQDV-ILVGDQE-----LGNLSVIS---AGRP
A0A3D3LGD3      THFDAGN---T---T-GLTNFLTTN-VRMEDV-VVRTA-------VENLYFLP---SGLL
A0A350ARX4      HLFSLSA---E---N-GLSDLLSCE-SDFDGY-VQQTQ-------HAKLDLIA---NGRS
B5JIS2          QFNRIKK---S---G-GLIRWAEEG-YPMDDI-YGEDSPLGIQKLKGGAYLLP---AGGV
A0A6N6ZC77      PTLHAAR---A---P-GLAEVLQQQ-VALDAA-IQPTE-------IENLSFLA---SGAY
A0A7C5H7K5      DWIGVEP---T---P-GLSHVLNGP-EQWDTT-IVATP-------YQNLWFMP---RGES
A0A538NJ59      ELMGMNR---E---P-GLSEMLRCP-EDLEKI-IQTNS-------LPNFFFVS---SGGR
A0A2A2R3V9      DAFSVSN---Q---R-GLSDVLSNQ-MNWRDA-IQESA-------AYHFHIIP---RGPT
A0A3C1VFY9      SRFKIQA---D---T-GLSESLAQG-MDWHKA-VKETT-------VGNLFLLP---RGAS
A0A2V2SMX4      SRFGLDA---M---P-GLTEVLADG-KPVRDV-IRETT-------IPNLWLLP---RGST
A0A522AC27      ARFGLKP---E---T-GLSEVLLAK-KDWRNC-ICKTG-------VANLDLLP---RGGT
A0A6M1RFD0      RRFGVEN---S---S-GFSEVLQQK-TDWREV-VRPTS-------VPNLWVVP---SGTP
A0A7C3HXH0      RRFKLEN---T---A-GFSEVLQQK-AKWNDV-VRPTS-------IPNLWVIT---SGSP
A0A1H2GQN6      TILDIAS---G---P-GLADHLIRG-VPIADL-IRETA-------IPNLHIIP---AGED
A0A512M3Y3      RVFDMEP---G---I-GLSGFLAGEVSQLTDA-VIKTD-------SPKLEVLS---RGKN
A0A4P5R5J1      KAFKIES---E---L-GLSDVLRQR-THWREV-IVPSS-------TPNLSILP---RGKT
A0A4P5YK43      NYFNQPR---T---P-GFSEVLAGD-RPWQQS-VRETP-------IPTLHLLT---TGQL
A0A2A2RPW6      ETFGVSS---N---QIGATDVMLGR-EPFEKG-VQTTR-------FENLFLMT---AGKM
B1ZT68          RYFGVDL---S---N-GWIRALATSAAGGQPP-PLPTT---IA-FSENLDLLP---SGGV
W0J7C2          RLFGVKP---D---T-GWVDWLETDPA--QRP-TLPVG---IVPVADHLDLLP---AGRS
B4D1I7          RSFGLTN---D---A-GFGDVLSGR-KSLDDA-IQLTL-------VPGLMLLS---RGRG
A0A353F286      TFFDINN---S---V-GLTNYLTTD-LALEDV-ILQTP-------VDNLYFMP---SGIL
A0A354FSA6      TFFDINN---S---V-GLTNYLTTD-LALEDV-ILQTP-------VDNLYFMP---SGIL
A0A3B9GA54      TFFDINN---S---V-GLTNYLTTD-VALEDV-ILQTP-------VDNLYFMP---SGIL
A0A520LEH8      TFFDINN---S---V-GLTNYLTTD-LALEDV-ILQTP-------VDNLYFMP---SGIL
A0A6B2M0T8      ERM-------E---E-DLVKLLEQREDPEKPL-VLSEG----------LHILP---FENS
A0A2D7B7R6      PEFKLGE---E---YVGVSDLLQSE-----DK-LGQFPDLAIYEATEKLFVLH---GGSH
A0A2E5K4P7      KSLQLEL---T---T-GLLDYVQGT-ATLEEV-IVPGV-------FTNLDILP---AGGR
A0A2V6F9Q9      EQFNSNS---R---L-GFSEVLRQE-VPWSEV-VMPTA-------YHSLSLLT---RGKP
A0A2V6NZZ3      EQFGSNS---R---V-GFAEVLQQE-VPWQEV-VMPTA-------YPSLLLVT---RGKT
A0A2V6EBU2      EQFGSNS---R---I-GFAEVLQQE-VPWQEV-VMPTA-------YPSLLLVT---RGKT
A0A2V6EY06      EQFGSNS---R---I-GFAEVLQQE-VPWQEV-VMPTA-------YPSLLLVT---RGKT
A0A2V6ME53      EQFGSNS---R---V-GFAEVLQQE-VPWQEV-VMPTT-------YPSLFLVT---RGKT
A0A538NUU0      EQFGSNS---R---V-GFAEVLQQE-VPWQEV-VMPTT-------YPSLFLVT---RGKT
A0A2V6NIJ1      EQFGSNS---R---V-GFAEILQQE-VPWQEV-VMPTV-------YPSLFLLT---RGKA
A0A2V6C292      EQFGSNS---R---V-GFSEVLQQE-VPWQEV-VMPTA-------YPSLFLLM---RGKA
A0A2V6D2X0      EQFGSNS---R---V-GFSEVLQQE-VPWQEV-VMPTA-------YPSLFLLM---RGKA
A0A2V5ZUK1      EAFGIDS---K---I-GFSEVLKGE-VNWREV-VVPTA-------YETLFVLP---RGKT
A0A2V5XFN9      EAFGITS---K---I-GFSEVLKQE-VNWREV-VVPTA-------VPTLFVLP---RGKP
A0A2V6EZC8      EAFGITS---K---I-GFSEVLKQE-VNWREV-VVPTA-------VPTLFVLP---RGKP
A0A2V6I7Z5      EAFGITS---K---I-GFSEVLKQE-VNWREV-VVPTA-------VPTLFVLP---RGKP
A0A3B9LCP2      EAFGISS---E---I-GFSEVLKQE-VNWQEV-VVPTF-------YPSLFVLP---RGKI
A0A3C0R669      EAFGISS---K---I-GFSEVLKQE-VNWQEV-VVPTF-------YPSLFVLP---RGKI
A0A2V6EID2      EAFGISS---K---L-GLSEVLKQE-VNWQEV-VVPTS-------YPSLFILP---RGKS
A0A2V6MHB0      EAFGISS---K---L-GLSEVLKQE-VNWQEV-VVPTS-------YPSLFILP---RGKS
A0A2W5YWL9      EQFGVSS---R---I-GFAEALKQE-VNWREV-VVPTS-------CSNLSLLP---RGKT
A0A2V5NH62      EAFGISS---K---I-GFSEVLKQE-VNWQEV-VVPTT-------YENLFVLP---RGKT
A0A2W6A620      ESFGVSS---K---I-GFSEVLKQE-VNWQEV-VVPTS-------YPNLYLMP---RGKT
A0A2V5PIJ4      DAFGVSS---K---I-GFSEVLQQE-VNWRQV-VVPTS-------YPNLFLMP---RGKT
A0A2V6K2G8      EAFGITS---K---I-GFSEVLKQE-VNWREV-VVPTA-------VSTLFVLP---RGKT
A0A2V5W206      ETFGISS---K---I-GFSEVLKQE-VNWREV-VVPTA-------YETLFVLP---RGKT
A0A2V6MW77      EAFGISS---K---I-GFSEVLKQE-VNWREV-VVPTA-------YETLFVLP---RGKT
A0A6N4WVA3      HLLKLNR---E---N-GFSDILDGR-LTLDTA-LQSSR-------YEHLDFVS---IGGY
A0A0R2XPB1      HLMQLNR---E---N-GFSDILEGS-LTLDSA-VQSSS-------YEHLDFVS---IGGY
A0A348NQP1      HLMQLNR---E---N-GFSDILDGN-LTLDNA-VQSTS-------YKHLDFVS---IGGY
A0A357FV58      HLMQLNR---E---N-GFSDILDGN-LTLDNA-VQSTS-------YKHLDFVS---IGGY
A0A2G4GZN8      PSLGFTG---D---G-GLSKWFNAE-MTLDDA-IVRDV-------APGLDVLP---VGLS
A0A348NPT1      RSLQLEN---D---F-GMLDHIEKE-VALDEV-IMKAV-------YPNLDVLP---SGGK
A0A2E1KV60      KSLQLEN---D---S-GVIDFINGD-DSISNF-IVKDV-------YPNFDVLP---SGGK
A0A2D7F4D9      KSLQLEN---E---S-GVLDYIQGE-GTFDSY-IAKEV-------YPNLDILA---SGGK
A0A3R7RBR8      KSLQLEN---E---S-GVLDYIQGE-GTFDSY-IAKEV-------YPNLDILA---SGGK
A0A2E0NH28      RSLQVSN---D---N-GLIDYIDHD-VDINAV-IVNEV-------YPHLDVLP---AGGK
A0A350AS32      RSLQLEN---D---F-GLLDHVDKD-VAIDEV-IIKEV-------YPNLDVLP---SGGK
A0A368BGT4      RSLQLKN---D---L-GLLDHVEKG-VSLEDI-IIKDV-------CPNLDVLP---TGGK
A0A6N6PLV8      KLFGVSN---E---F-GLTDYLVGR-AEIDEI-IKTTK-------IDNLSFIP---AGEL
A0A2E0V4K6      RQLGRRRSEQG---K-GMAEILARQ-CPPEEA-VCQDVGH------GNLDAVF---AGGK
A0A290QE54      RHFNQPN---D---N-GLITWFEHG-ASLDGD-LTENQHLGITRLSENFSLLC---SGGR
A0A1H1SWX2      RHFKLTN---E---A-GLIAWFEAG-AKIPAD-PFTDASLGFTKVDENLFLLR---SGGR
A0A1D8AZK8      RHFKLTN---E---V-GLIAWFEAG-AKIPAD-PFTDAALGLAKVDENLYLLR---SGGR
A0A4Q1C9I5      RHFQLPN---E---A-GLLAWFEAG-AKIPED-PFTDASLGLTKAEENLFLLR---SGGR
A0A2E6NAH3      RSLQIEN---D---L-GMLDYVENG-VSLDEV-IVKEV-------YPNLDVLS---TGGK
A0A2A5VZA5      SSLQLPN---E---F-GLLDHIEQG-SRLDDM-IVSEV-------YPNLDVLP---SGGK
A0A424R295      SSLQLPN---E---F-GLLDHIEQG-SRLDDM-IVSEV-------YPNLDVLP---SGGK
B4CZV9          RLFGYRK---E---P-GLSNVLLGE-CTLEDA-FRPSG-------QENLTVLS---AGRH
A0A1G3ZL71      RHFKMEN---D---A-GLLAWAEAG-ASLDGD-LTTDPKLGLARIADNLMLLR---SGGR
A0A556QP09      RHFELAN---E---A-GLITWYEKG-ASLDGD-LTINPSLGITSIGENLSLLS---SGGR
A0A2T6DX88      RRFGKEN---E---A-GLLTWFEKG-GKVEGD-LANDPTLGIVKLEDNLSLLR---SGGR
A0A2T6CWI7      RHFKQEN---K---N-GLITWFESG-AMLDSN-LTTHPSLGIVPVAENLWLLC---SGGR
A0A3E1E5C8      RNFKQEN---L---H-GLITWFEGG-AKLDGD-LSTDPSLGIIKLADNLSLLC---SGGR
B1ZZ74          RHYKQQN---N---A-GLITWFEAG-SPLDGE-LASTPALGIIKISENLSLLC---SGGR
A0A3B9FM17      KFCNLEN---S---K-GLLSLVNDV-GKPGQD-VQNCISESLTEVHPNLFLLP---SGGK
A0A0E3YV65      RYYGQSN---D---A-GLLRWLDTK-SKTEPA-LLRDPALGITAFGPSLHLLR---SGGT
W0J900          RLAGAPN---T---H-GLLRWLDKG-GRSDGP-LAGDPDLGLLRPAPNLFVLR---AGGI
R7E4L8          AFYGGKN---A---R-GLVHLLMNPQVSPDSV-LQSGKRF------PGFDLVT---AGPV
A0A4Q3BVY2      GVVDIDK---A---P-GMTRLLLGE-CTLEQA-IHSMG-------QGGFDVIP---RGPV
A0A4P6PCA7      NIFEIPA---E---HPSLLEWLSSGSSELERS-ELVSR-----NVIEHLDVIT---SRPL
A0A2T6DSN5      RYFGATA---G---V-GLLPWLREN-AHRPDV-QIDAHKMGIMNIGPAFDLLP---AGDA
A0A317ZIW7      KLMNLDF---D---G-GLTDVLEGR-KEMEEV-IQRST-------YDNLDFVS---IGGH
A0A7C4PPT4      RIFGQRS---A---P-GLSNILMQH-ADWRDV-IRPTD-------HENLFLMA---CGKH
A0A7C4QZX4      RVFNQRS---A---P-GLSNILMQG-LDWREV-VRTTD-------KENLLLLT---CGKH
A0A2D7WMI4      KFAGLDN---E---S-GIITLVNE-MSQNPNF-IDSGLKKHLKNIHPNLNMLT---SGGK
A0A2D6VHX5      NFCDESN---D---E-GVMTILNT-PNATEEE-VTDKLKKVLCSIHPNLFLLP---SGGK
A0A2D8I214      KFCGIEN---K---T-GLVSLVN--VASSKEN-LKNSINDSVQEIHPNLYILP---SGGK
A0A1Z8VL41      KFCSITN---D---N-GLLTLINE-AKNGVEN-LRELTDKTLHPIHDNLYILP---SGGK
A0A2E6TNA4      KFCSISN---D---K-GLLTLINE-AKNGVEN-LHELADKTLHPIHDNLYILP---SGGK
A0A1Z8RG47      NLCNITN---E---K-GIVTLVNE-VVKGSKD-IDTHIQESLHETHPNLHVLP---SGGK
A0A1Z8RJJ5      NLCNITN---E---K-GIVTLVNE-VVKGSKD-IDTHIQESLHETHPNLHVLP---SGGK
A0A2D7V631      NFCNITN---E---K-GIVSLVNE-VVKGSSD-IDEQIKSCLHEIHPNLHVLP---SGGK
A0A354RA24      NFCNITN---E---K-GIVSLVNE-VVKGSSD-IDEQIKSCLHEIHPNLHVLP---SGGK
A0A2E9RV62      KFCGVNN---D---R-GLLTLINETVANPTPN-YNFWDSGTLVEIYPNLLILP---SGGK
A0A2E4AY96      KFVGLEN---E---G-GLIPIINK-SAEQPNY-IKENLDSELHDIHPNLKMLT---SGGK
A0A3B9B9P4      KFVGLEN---E---G-GLIPIINK-SAEQPNY-IKENLDSELHDIHPNLKMLT---SGGK
A0A2D5Y6N6      KFCNITN---E---K-GLLSLINS-EKTDLKE-LQELAQSTVTQIHPNLLVLP---SGGK
A0A2E7HSS8      KFCNMEN---E---R-GLLSLVNE-VSQKGGD-IDQSVTETLTEIHPNLFVLP---SGGK
A0A2D8VCK3      KFCNLEN---S---K-GLLSLVND-VGKPGQD-VQNCISESLTEVHPNLFLLP---SGGK
A0A350QVY4      KFCNLEN---S---K-GLLSLVND-VGKPGQD-VQNCISESLTEVHPNLFLLP---SGGK
A0A2E4ZYR7      KFCGVSN---D---R-GLLTLVNE-I--NGEH-DTEAERNALTEIYPNLYVLP---SGGK
A0A2E6TCV1      KFCGVSN---D---R-GLLTLVNE-I--NGEH-GTEAERNALTEIYPNLYVLP---SGGK
A0A3D4HHL8      NAFNVPN---D---K-GLSDVIRER-ISFDDA-IQRPG-I------ENLDFVA---HGTT
A0A366HV03      NLFGVDR---Y---P-GFCQALTGE-LVLEDV-VRHTH-L------ANFHYCT---RGNT
A0A6G6K911      NLFGVNR---S---P-GFCQALTGE-LALEDV-IQHTH-L------TNFHFCT---RGNT
A0A5R8KAF2      QVLDVAN---D---I-GITQLLLNR-FPVQEA-VLKTS-N------PLLDVIP---RGPI
A0A7C4LRZ6      NYFDLTR---E---N-GLSELLNGE-AHWLDV-VKQTS-V------PTLKLIS---TGRL
A0A2V2SDN0      RHFGVAS---S---P-GLAEILNQE-TYPNYG-IVTTA-L------ENLSFLP---AGAP
A0A1V6GL40      RLFGVSP---E---P-GLSDVLAKG-TAWETT-VSATK-I------ANLHILP---AGTF
A0A2V5X6Z6      KFFGAAS---S---P-GLAEVLNEE-ISFAEA-IVPTG-L------ENLALLP---AGEA
A0A2V5VGZ7      TFFGTAS---S---P-GLAEILNEE-ISFKEA-IVPTG-L------ENLALLP---AGEA
A0A2V5U130      TFFGTAP---R---P-GLAEILNEE-ISFAEA-IVPTG-L------ENLALLP---AGEA
A0A2V6C237      TFFGTAS---S---P-GLAEILNEE-ISFKEA-IVPTG-L------ENLALLP---AGEA
A0A3R8L982      RHFGIEN---N---A-GLLAWFEAG-APFDDL-LPENPHLGVIKIGENFDLLR---SGGR
A0A6N6QBS9      GYFEQPL---E---R-GLSEVLEGT-LGLSDA-IRETP-I------KNLSLMV---AGAR
A0A2E7HPU9      KAFGLKRRDLP---T-GLTEVLTGK-ATLAEA-IQEQAGQ------ENFSIIF---AGQK
A0A388PR45      PSLGFAG---D---G-GVSRWFNGE-MTLDEA-IVKDV-A------PGLDVLP---VGLS
A0A388QR61      PSLGFAG---D---G-GVSRWYNGE-MTLDEA-IVKDV-A------PGLDVLP---VGMS
A0A4P5YHI0      PSLGFAG---D---G-GVSRWYNGE-MTLDEA-IVKDV-A------PGLDVLP---VGMS
A0A2A2RS01      PSLGFSG---D---G-GVSRWFNGE-MTLDEA-IVRDV-A------PGLDVLP---VGMS
A0A2A2Y1A7      PSLGFSG---D---G-GVSRWFNGE-MTLDEA-IVRDV-A------PGLDVLP---VGMS
A0A388PDH9      PSLGFSG---D---G-GVSRWFNGE-MTLDEA-IVRDV-A------PGLDVLP---VGMS
A0A2G4H1E7      PTLGFTG---D---A-GLSKWFNGE-IPLDDA-IIREV-A------PGLDVLP---VGLS
A0A2G4GZA6      PSLGFTG---D---G-GLSKWFNAE-MSLDEA-IVHDV-S------PGLDVLP---VGLS
A0A388P514      PSLGFTG---D---G-GLSKWFNGE-MSIEEA-IVHDV-S------PGLDVLP---VGLS
A0A2A2YG59      PSLGFTG---D---G-GLSKWFNGE-MSIDEA-IVHDV-S------PGLDVLP---VGLS
A0A2G4F7D5      PSLGFTG---D---G-GLSKWFNGE-MSIDEA-IVHDV-A------SGLDVLP---VGLS
D5EML0          RAHGVED---D---A-GLCPWFDSGSTDMEDL-LGNES-L------GILKLSP---SLSL
A0A7C4PPJ4      GFFNLER---D---Q-GLAEVLAGE-VHWLDV-IKDTS-V------SHLKLLT---TGKL
A0A3C1C1M3      NIFPRPE---A---VCGLLEYLDSDQMKPEEI-VYASE-C------RNLSVIS---SRVV
A0A2E9EYJ1      TFFNINN---S---V-GLTNYLTTD-LXLEDV-ILQTA-Y------ENLYFMP---SGIL
A0A258AXR6      THFDVSH---A---T-GLTNFLTTD-IRLEDV-VLRTQ-V------ENLFFLP---SGLL
A0A3D3NZQ6      THFDAGN---T---T-GLTNFLTTN-VRMEDV-VVRTA-V------ENLYFLP---SGLL
A0A1T4WVZ9      TLFDVSN---A---V-GLTNYLTTN-VTLEEV-VVRTP-V------ENLYFLP---SGML
A0A4R7SSI6      TLFDVSN---A---V-GLTNYLTTN-VQLEEV-VVRTP-V------ENLYFLP---SGML
A0A4P6PD26      TILGVSN---R---F-GLTNVLLRD-VPVEEA-I-------KATSVPNLHFLP---SGRL
A0A1Z8SVB5      NFCNESN---D---A-GVMTILNTP-NATEEQ-ISEKIEKCLCNIHPNLFLLP---SGGK
A0A2V5W3Y0      EAFGVSS---K---I-GFSEVLKQE-VNWQEV-V-------VPTSYPNLFLLP---RGKT
                                .                                           

A0A432FAS4      -PN-----NPSELAGSQRMKDFIEEIRSKYDKIMFDCPPVSAVSDPLMIAAATDGIIFVS
A0A660Q3A0      -PP-----NPAELLMRPELSAFLDYARRTYDRVMFDCPPVLAVSEAAILCTLVDGVIFVV
A0A4Q3AQI1      -LD-----TGTELLGSPRFTEIMQTLRERFDRIVMDTPPVLGLSDTSVMQSQVDGVLFVI
A0A6N2CMN7      -SK-----NPTQVLNSAQFEAMFAELRDRYDRIVVDSPPLAAVSDALNLLPLVDGIIYVI
A0A2V5UAD5      -LS-----NPGDLFLNPALSQVLAWARQHFDYVLIDSSPVFAADDTATLAPMVDGTLFVV
A0A258AXL1      -SA-----RGHDLLSSSRFKEFLDALKHHFDRIIVDTPPLLGLADSLLISKAVDGLIFVI
A0A2E6T1E0      -PN-----NPSELSGSQRMRDFVEEVRTKYQKIVFDCPPVSAVSDPLIIAAATDGIIFVN
A0A2D5W0Q9      -PN-----NPSELVGSKRMGELLDSLRDRYDRIFVDCPPVSAVSDPLMVGARTDGMVFVS
A0A1Z9KB52      -TR-----AATEIIEKKEFELLLTCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVT
A0A7C5CZ90      -ST-----SALGLLNSNQMKSLISELKRRYDYVFFDSPPIIGVSDAAILASEVDMTIQVI
A0A257LYL4      -PA-----DAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVV
A0A4Q2XXY1      -PA-----DAAGILNSRRMSELIADVKNRFDLVLIDSPPILGVSDASVLASEVDLTMIVI
A0A2V5U7A0      -PP-----NPSELLGTRKMKELVMDLRESYDFILLDTPPAIAVSDPAILSSVADGIILVF
A0A3D4CZT6      -PA-----DAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVV
A0A4V1S9Q4      -PA-----DAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVV
A0A355VK99      -VP-----NPVTLLSHPLLGQILSILKKQYDAVIIDAPPYGILADTAILASLSDITLYTV
A0A2V6N5E0      -LS-----QPSEHLLRESTEALLKEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVV
A0A2V6NH44      -LP-----QPSEHLLRDSTDQFLKEIYHQYDYIIIDSSPVLAADDTTSLAPKIDATLLVV
A0A432FDF6      -PS-----SSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVV
A0A522ACN3      -PS-----SSLGILSSNQMKDLISGLKQRYDYVFLDSPPIMGVSDASILASEVDITLQVI
A0A353DCA1      -PA-----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVV
A0A3C1AXQ2      -PA-----DSAGVLNSQRMSELIADAKSRFDLVLIDSPPILGVSDASVLANEADLTLIVV
A0A3D0IZR7      -GP-----EELGGFSRSRLATLMEACRPNYDVILVDSPPVLGISDASVISQEVDVSLLLI
A0A520LRZ3      -PS-----DAAGILNSRRMSELIADVKSRFDLVLVDSPPILGVSDASVLASEVDLTIIVI
A0A356FSV4      -SK-----NPTQILNSAKYSSLLGSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVI
A0A3D3DET9      -TA-----RSSELFISEATQRFLRDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVL
A0A355SVK9      -SK-----NPTQVLNSAKFEAMLADLRERYDRIVIDSPPLGAVSDALNLLPLVDGVIYVV
A0A2E5D7I3      -AP-----NPGELLREEAISKLFAWAREHYDHIVIDSAPILPVPDTRIIFPLVDNPCLVI
A0A2V5NYE2      -TH-----KSSEFFIGEVTERFLRDAAAKYDYVMIDTAPVMAADDVTSLAPHLDGVLFVI
A0A2V6FIP7      -PS-----SPSELAGSKRMRQFLEEVRNRYDRVILDCPPVSAVSDPLIIASLSDGVAFVT
A0A353DI77      -SP-----NPGELLEPGRLRDLVEMFSSNFDHIVIDSAPLLPVPDTRILAPLVDNLALVI
A0A1V6GCZ3      -PS-----SSLGILSSTQMKDLIGELKQRYDFVFFDSPPIMGVSDASILASEVDMTIQVI
A0A3C1UJT2      -IS-----NPSEHISGSAIEELILKARQNFDRIVIDSAPLGPIGDTLSVARLADMLCLVV
A0A2S7U0Z3      -AP-----NPSELLNEGEFNSLLEDLIPEFDRIILDSAPVLPVADSRLLAKHAHAVILVV
A0A5E6MKA7      -PC-----HPADLLGAAAMAYLCQWARSHFGYVLLDCPPLTGMPDAAVVGTLADGAVLVI
A0A6B3L936      -PP-----NPLGLLQPDEIMELVDEASKEFDRVIIDSPPVLPVSDTRLVAQHAHKVILVV
A0A2N8IR72      -VP-----NPVTLLSHPLLGHILGILKKQYDAVIIDAPPYGILADTAILASLSDITLYAV
A0A2N8IV96      -PF-----DPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVV
R7E1V8          -PF-----DPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVV
A0A2E0R252      -SA-----NPSELLAGKGLKGAIGALEEYFDRIIIDSAPLVPVSDSLPLAKLAESVVLVC
A0A3E1EF48      -SA-----NPAELLGGRHLGTFLADLCRDFDRVVIDTAPLVPVSDTLPIAKRAQSVIMVY
A0A2A2PVG8      -SA-----NPAELLSGKSLRPLLEKLSEYFDRIVIDSAPLVPVSDSIPIAKLVQSVVLVV
A0A2E0R421      -SA-----SPSELLASKALPALVDKLGKYFDRIIIDSAPIVSVSDTYPLAKIAQSVVLVC
A0A2E5EJ69      -VP-----NPSELIASDHVKKLIDDVVGKYDQVVIDNAPVTAVSDTLLILEYVQTICMVT
A0A2G4I5Z5      -VP-----NPAELLSGQWTAKLIQEASAKFDHVVLDNAPINAVSDALLIVKEAQTVCLVA
A0A4P5QQV6      -VQ-----NPGELFLSTDTDRFLRAADAQYDYVIMDSAPVTAADDTSSLAPKVHATLFVF
A0A1T4WWY4      -VP-----GTTELLNSGVFAAILEELKKKYDRIILDTPPVLGLSETAFLQHHADGVAIVV
A0A3D3LEQ6      -IA-----GTTELLNTEVFSQLLDTLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVV
A0A3D3NW23      -IA-----GTTELLNTEVFSQLLDSLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVV
A0A2E7ALI1      -AP-----NPGELLREGMIEKLFDWAREHYDHVVIDTAPVLAVPDTRIIXPLVSNPXLVV
A0A178IDB9      -IK-----NPTEIIDQIAHSELFNKLSKSYEVIIIDTPPAAVFPDALLLSRFCAELVYVC
A0A290QD69      -IK-----NPTEVIDQLAHCDLFNKLSKIYDLVIIDTPPAAVFPDALLLSRFCTEMIYVC
A0A2E7VDS1      -TR-----AATEMLARPDFDILLSNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLCVI
A0A7C8D3W3      -PN-----NPGELLVSPITQQFLDEARNHYEYIIIDSPPVTAIDDTFSFVKIVDAFTFIV
A0A178IFJ2      -SR-----RISELLDNEKLKGLFEQARREFDILVIDTPPAGIFPDAFDLVPFASELVYVV
A0A357FSP9      -SK-----NPTQVLNSAKFEAMLADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVI
A0A2A2R174      -VP-----NPAELLSGQWTSKLIKEASAKFDHVVLDNAPINAVSDALMIVKEAQTVCLVA
A0A1H2DTI1      -TS-----QGAELFLSPITDGILREMYNEFDYIIFDTSPVMAADDATSLAPKIDGTIFVL
A0A1H1MGC9      -AK-----NPTQILNSKNFELMLSELRKRYDRIFIDTPPLAAVSDALIILPLLDGSLFTI
A0A1V5L462      -QE-----NPGDLFLNERMDAILEACRKQYDFVILDTAPILAVDDTIGLLRRADDVIFVV
A0A3D3LGD3      -PA-----DSAGILNSQRMSDLIEDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVV
A0A350ARX4      -LL-----NSGELLLSERMDNLLEWARERYTYVIVDAPPILAVNDTIGLSNKTDSMMFVV
B5JIS2          -FP-----LPSKLLVSTKIDALLRKLEETFEVIIVDTPPVGLYPDALIFAKSVGETLLVA
A0A6N6ZC77      -PQ-----RPGELLLSRRMDEILTQAREAYDYVVIDSAPILATDDTTSLAQRVDVALFVV
A0A7C5H7K5      -VL-----NASELFLSDRCDSFLQQASEQFEFVVFDSVPVLVSDDAGSLGPKIDGVIFVV
A0A538NJ59      -LS-----NPGDLFLNPALSQVLAWARQQFDYVLIDSSPVFAADDTATLAPMVDGTLFVV
A0A2A2R3V9      -PP-----NPGELFLSSLVPSIFQEMRDEYDYVVVDSAPILATDDTASLAPKLDGTIFLM
A0A3C1VFY9      -TQ-----HSSELFLGPVMGKFLQETIKEYDYVLIDTAPVMAADDVTSLAPRVDGVIFVV
A0A2V2SMX4      -TH-----HSSELFISQAAADFLKNAAMQYDYVIMDTAPVMAADDVASLAPNMDSTIFLV
A0A522AC27      -TQ-----RSSELFVHQDTKDFLKAAAAEYDCVVVDTAPVMAADDVTSLAPLIDGTIFVI
A0A6M1RFD0      -TQ-----NSSELFLQPVTRRVLEEMAAAYDYVVLDTPPVMAADDVTTLAPLAHGVIFVV
A0A7C3HXH0      -TQ-----KSSELFLQPLTRTVLQEMAAQYDYVVLDTPPVMAADDVTTLAPLTHGVIFVI
A0A1H2GQN6      -AH-----DAISRFDNQVLREIIVELKEKYQVIFIDSPPALGVSDASVIAHEVDKVVMVI
A0A512M3Y3      -SA-----PRFEILSAARFVNTINDLRKQYDRIIIDTPPLLGLADSIMVSKCVDGAIFVI
A0A4P5R5J1      -LP-----HPAEHFLGKVTDQLLQEVYAEFDYIIFDSPPVMAADDVLSLSPKIDGTIFVV
A0A4P5YK43      -IA-----NPGELLMGEVAHKVISEARQFYDHVIIDCPPITAIDDTFCLIPITDGLLFVV
A0A2A2RPW6      -VP-----NPAELLAGPWAKQLIEEASKRYDKVVLDNAPVNAVSDTLLICKEAQTICLVM
B1ZT68          -AK-----NPTETLERFVTSGMLKRLLERYDLVILDTPPVAVFPDALLLSRYCKELIFVC
W0J7C2          -LG-----RPTELLDQLSRRETLQPLLDNYDLILFDTPPAAVFPDALMLARCCHEMIYVC
B4D1I7          -VP-----NPGELYLGRSADEFLKTVHAEFDYVVLDSSPVMAADDTTSLAPKADAAVFVF
A0A353F286      -PA-----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVV
A0A354FSA6      -PA-----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVV
A0A3B9GA54      -PA-----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVV
A0A520LEH8      -PA-----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVV
A0A6B2M0T8      -TV-----EATELIESPAFRQSIEKFQEQYDIIIIDTAPAGLFPDAGLIGNYAQNFIFLT
A0A2D7B7R6      -IS-----NPSEHISGSAIEELILKARQNFDRIVIDSAPLGPIGDTLSVARLADMLCLVV
A0A2E5K4P7      -SR-----TPMTIFNNEYFPFLMNEIRQYYDKIIIDSPPLAAVSDALNIVPFVDGILFVV
A0A2V6F9Q9      -LT-----QPSEHLLRDSTDQFLKEIYHQYDYIIIDSSPVLAADDTTSLAPKVDATLLVV
A0A2V6NZZ3      -LA-----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVV
A0A2V6EBU2      -LA-----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVV
A0A2V6EY06      -LA-----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVV
A0A2V6ME53      -LP-----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVV
A0A538NUU0      -LP-----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVV
A0A2V6NIJ1      -LT-----QPSEHLLRDSTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVV
A0A2V6C292      -LA-----QPSEHLLRESTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVV
A0A2V6D2X0      -LA-----QPSEHLLRESTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVV
A0A2V5ZUK1      -LG-----QPSERLLHETTDVLLREIYQHYDYVIIDSSPVLAADDTTSLAPKIDATLFVV
A0A2V5XFN9      -LS-----QPSEHLLRESTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVV
A0A2V6EZC8      -LS-----QPSEHLLRASTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVV
A0A2V6I7Z5      -LS-----QPSEHLLRESTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVV
A0A3B9LCP2      -SA-----QPSEHLLRDSTDAILKEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFVV
A0A3C0R669      -SA-----QPSEHLLRDSTDAILKEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFVV
A0A2V6EID2      -LS-----QPSEHLLRDSTDVLLKEMYKHYEYILIDSSPVLAADDTASLAPKIDATLFVV
A0A2V6MHB0      -LS-----QPSEHLLRDSTDVLLKEMYKHYEYILIDSSPVLAADDTASLAPKIDATLFVV
A0A2W5YWL9      -VA-----QPSEHLLRDSTDQMLKDMYQQYDYILIDSSPVLAADDTTSLAPKIDATLFVV
A0A2V5NH62      -LG-----QPSEHLLRDSTDALLRDMYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFVV
A0A2W6A620      -LG-----QPSEHLLRESTDQLLKEMYNHYDYILIDSSPVLAADDSTSLAPKIDATLFVV
A0A2V5PIJ4      -IG-----QPSEFLLRESTDALLREINTFFDYIIIDSAPVLAADDATSLAPKIDATLFVV
A0A2V6K2G8      -LG-----QPSEHLLRESTEALLKEIYQDYDYVIIDSSPVLAADDTTSLAPKIDATLFVV
A0A2V5W206      -LS-----QPSEHLLRESTEALLKEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVV
A0A2V6MW77      -LS-----QPSEQLLRDSTEALLKELYQHYDYVIIDSSPVLAADDTTSIAPKIDATIFVV
A0A6N4WVA3      -PD-----HPAELLMSENMDAFIREARERYDFVIFDTAPILATDDTSGFAGKVDAVLFTI
A0A0R2XPB1      -PD-----HPAELLMSKYMDQFIRDARAQYDFVIFDTAPILATDDTCGFAAKMDAVLFTI
A0A348NQP1      -PD-----HPAELLMSEYMDQFISEARERYDFVIFDTAPILATDDTSGFAAKVDAVLFTI
A0A357FV58      -PD-----HPAELLMSEYMDQFISEARERYDFVIFDTAPILATDDTSGFAAKVDAVLFTI
A0A2G4GZN8      -CK-----NPTQVINNPKFLAMIEELRGRYDRIFIDSPPIGAVSDALHILPKTDGVIYVV
A0A348NPT1      -SK-----NPTQVLNSAKFEAMLADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVI
A0A2E1KV60      -SK-----NPTAVLSDEKYQSMMLELRDRYDKIIVDSPPLAAVSDALNVVPYIDAVLFVI
A0A2D7F4D9      -AK-----NPTAILNDSKFESMLLQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVI
A0A3R7RBR8      -AK-----NPTAILNDSKFESMLLQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVI
A0A2E0NH28      -SK-----NPTQILNSAKYSSLLGSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVI
A0A350AS32      -SK-----NPTQVLNSAKFEAMFADLRDRYDRIVVDSPPLAAVSDALNLLPLADGVLYVI
A0A368BGT4      -SK-----NPTQVLNSAQFEEMLAVLRDRYDRIVIDSPPLAAVSDALNLLPLVDGVIYII
A0A6N6PLV8      -PG-----DSEGILNSQRMTDLIAKVKGQYDLVFFDSPPILGLSDGAVLASEVDVTIMVV
A0A2E0V4K6      -VR-----NPGELLKPGAIRELLQWAREHYDHVVIDTAPVLAVPDTRIILPQADNRCLVI
A0A290QE54      -SK-----TPTEILENPAFGQLLARLKKHFDLIIVDSPPMGAVTDSLLIAERTDEVVYVC
A0A1H1SWX2      -SK-----SPTELLETAVFGQFIEAMKQHFDLIVVDSPPMGAVTDSLLIAERTDEVIYVC
A0A1D8AZK8      -SK-----SPTELLENPVFGQFIEAMKQHFDLIVVDSPPMGAVTDSLLISERTDEIIYVC
A0A4Q1C9I5      -SK-----SPTEFLENPIFGQFIEAMKQHFDLIVVDSPPMGAVTDSLLISERTDEVIYVC
A0A2E6NAH3      -SK-----NPTQVLNSAQFEAMFSDLRNRYDRIVVDSPPLAAVSDALNLLPMVDGILYVI
A0A2A5VZA5      -SK-----NPTQVLVSAQFEAMLADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVI
A0A424R295      -SK-----NPTQVLVSAQFEAMLADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVI
B4CZV9          -LD-----HGTELLGSAQFSELLNSLRGRFDRIVIDTPPVLGLSETSIMQSLVDGVLFVI
A0A1G3ZL71      -SK-----VPTELLEKPEFGELILQLKKRFDLIVIDSPPLGAVTDSLLIAEQTDEVIYVC
A0A556QP09      -SK-----SPTQLLESPIFGQLLEKLKKHYDLIVVDSPPLGAVTDSLLIAERVDEVIYVC
A0A2T6DX88      -SK-----IPTELLEDPRFGQLIAKLKNQYDLVVVDSPPMGAVTDAMLVAERTDEVVYVC
A0A2T6CWI7      -SK-----SPTELLENPVFGQLLERLKKEFDLVIVDSPPLGAVTDSVLIAERVDEIVYVC
A0A3E1E5C8      -AK-----SPTELLENPAFGQLLEKLKKDYDLVVVDSPPLGAVTDSLLIAERTDEVIYVC
B1ZZ74          -SK-----SPTEFLENPVFGQLLERLKREYDLVIIDSPPLGAVTDSMLIAERTDEIIYVC
A0A3B9FM17      -TR-----AATEMLEQNDFSTVIDLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVT
A0A0E3YV65      -TR-----RSTEILDSAAFRDLLDFLHKQYDAVIIDTPPAGVFSDAMVLAEQAGELVFVV
W0J900          -SR-----RISELLESKKLKALIEQAQREFDILLIDTPPAGIFPDALSLAPFANELIYVV
R7E4L8          -PP-----NPVALLTQGRLEELLRYWRARYDRIILDGCPYEAVADASLMARHADLVLYVI
A0A4Q3BVY2      -IA-----GTTELLCQDVFSNMLEHFRKTYDRIVIDAPPVLGLSESSSLQKVVDGTVLVV
A0A4P6PCA7      KNV-----NPAEMLGRKELAELIKWARDEYDRVIIDTPPIGPVGDGVILASYVDSVIVVS
A0A2T6DSN5      -IK-----NPTEVIDQIASCDLFNKLSKHYDIIVIDTPPSAVFPDALLLSRFCSEMVYVC
A0A317ZIW7      -PD-----HPAELLMSDSMEQFIKHAREHYDFIVFDTAPILATDDTTSFAPFVDAVLFTV
A0A7C4PPT4      -LE-----GATELVGSPVFEKLLAELRQEFRRIIIDTPPVLGLSETAMLQRLVDGVVLVV
A0A7C4QZX4      -LD-----GATELVGSPIFEKILQEFRQEFKRIVIDTPPVLGLSETAMMQKHVDGVVLVV
A0A2D7WMI4      -TR-----SVTELIERKEFGILLDKLKAESDVIVVDSPPIGLFPDALAFSKIADDIIFVT
A0A2D6VHX5      -TR-----AATEIIEKKEFELLLTCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVT
A0A2D8I214      -TR-----AATEMLEQKEFDIVHNELKEMFDVIIVDSPPIGLFPDSLAIARKVDDVLFVT
A0A1Z8VL41      -TR-----AATEILESAEFEMVTNHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVT
A0A2E6TNA4      -TR-----AATEILESTEFEMVTNHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVT
A0A1Z8RG47      -TR-----AATEMLERAEFDLVMNKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVT
A0A1Z8RJJ5      -TR-----AATEMLERTEFDLVMNKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVT
A0A2D7V631      -TR-----AATEMLERSEFDYVMNKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVT
A0A354RA24      -TR-----AATEMLERSEFDYVMNKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVT
A0A2E9RV62      -TR-----AATEMLEKPEFDKMLFSLRQNAEIIIIDSPPIGLFPDSLAMARKVDEVIFVT
A0A2E4AY96      -TR-----SVTELIEKNQFHELLGKLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVT
A0A3B9B9P4      -TR-----SVTELIEKNQFHELLGKLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVT
A0A2D5Y6N6      -TR-----AATELLESNSFDRIHKILRTIADVIIIDSPPIGLFPDSLAMARKVEEVLFVT
A0A2E7HSS8      -TR-----AATEMLEHNDFSVVIDSLKRHAEVIIIDSPPIGLFPDSLAIARKVDEVLFVT
A0A2D8VCK3      -TR-----AATEMLEQNDFSTVIDLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVT
A0A350QVY4      -TR-----AATEMLEQNDFSTVIDLLRTNAEVVIIDSPPIGLFPDSLAIARKVDEVLFVT
A0A2E4ZYR7      -TR-----AATEMLERPDFDILLNNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLFVT
A0A2E6TCV1      -TR-----AATEMLERPDFDHLLNNLKKLCDILIIDSPPLALFPDSMAMARKVDEVLFVT
A0A3D4HHL8      -TK-----RPGELLSGVYFATMLEGLRKRYDFIVFDLPPVLATDDTPGFVQKVDGVLFVV
A0A366HV03      -SA-----GSAELLCRLSLEENVAIWRQQYDWIILDTPPVLGLSETTNLQRVADAVVLVV
A0A6G6K911      -SA-----GSAELLCRLGLEESINIWRQQYDWIILDTPPVLGLSETTNLQRVADAVVLVV
A0A5R8KAF2      -IT-----GTTELLCQKGFVDLVERFRGEYDQIVIDTPPVLGLSETAALRIVVDGVIMVV
A0A7C4LRZ6      -PP-----NPGELLIGPITKELIEQARKEFDYIVFDCPPLTAIDDTFALLNLSDGVLFVV
A0A2V2SDN0      -TL-----EPGELVLRSQFSSLLSDVYSRFDYIIIDSPPVLAADDAATLAPKVDGVLFVV
A0A1V6GL40      -TA-----RSSELFISEATQRFLRDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVL
A0A2V5X6Z6      -RQ-----NPGELALSPVWLSFLAEAKSQFDYVLVDTPPVLAADDAATLAPKVDGVLFVV
A0A2V5VGZ7      -NR-----NPGELVLSQVWPGFLAEAKPQFDYILVDTPPVLATDDAGSLAPKVDGVLFVV
A0A2V5U130      -NR-----NPGELVLSQVWPGFLAEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVV
A0A2V6C237      -NR-----NPGELVLSPVWPGFLAEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVV
A0A3R8L982      -SR-----TPTEFLESAAFTQLLTKLKKHYDLVIVDSPPLGAVSDSLLIAERTDEVLYVC
A0A6N6QBS9      -PG-----NPSELLIGAATKDLIMELRRQFDYVVFDCPPLTAIDDTFSIAAFLDGLFFVV
A0A2E7HPU9      -AP-----NPGELLTTEGVVAVLKELKQEFDVIVIDSAPLLAVPDTRLLVPEVDNFCLVV
A0A388PR45      -CR-----NPTQVINHPRFGEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKVDGVVYVV
A0A388QR61      -CR-----NPTQVINNPKFAEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKADGVVYVV
A0A4P5YHI0      -CR-----NPTQVINNPKFAEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKADGVVYVV
A0A2A2RS01      -CR-----NPTQVINNPKFLAMLDEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVV
A0A2A2Y1A7      -CR-----NPTQVINNPKFLAMLDEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVV
A0A388PDH9      -CR-----NPTQVINNPKFLAMLDEMKTRYDRVFIDSPPIGAVSDALHLVPKVDGVIYVV
A0A2G4H1E7      -CK-----NPTQVINHPKFLAMIDGFRERYDRIFIDSPPLGAVSDSLHLLPKVDGVIYIV
A0A2G4GZA6      -CK-----NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKVDGVLYVV
A0A388P514      -CK-----NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVV
A0A2A2YG59      -CK-----NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVV
A0A2G4F7D5      -CK-----NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVV
D5EML0          LRAGGGCEHPTELLGDLRVSALFSKLKDLYDIVVFDTPPIGLFSDATIVADSADSCVMVA
A0A7C4PPJ4      -PG-----NPGELLIGPITAQFIAEARKHFDFVVFDCPPLTAIDDTFALASHADGMLFVV
A0A3C1C1M3      GRS-----RPAELVGGAKVAALLAWARAHFDRIVLDVPPLGIVSDALSLAHLSDCVLVMA
A0A2E9EYJ1      -PA-----DAAGILNSRRMSELIAXVKSRFDLVFIDSPPILGVSDASVISSXVDLTIIVI
A0A258AXR6      -PA-----DSAGLLNSQRMVDLIAEVKSRFDLVLIDSPPILGVSDASVLANLADMTMIVV
A0A3D3NZQ6      -PA-----DSAGILNSQRMSDLIEDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVV
A0A1T4WVZ9      -PA-----DSAGVLNSQRMTELIEDAKSRFDIVLIDAPPILGVSDASVLANEADLTIIVV
A0A4R7SSI6      -PA-----DSAGVLNSQRMSELIADAKSRFDLVLIDSPPILGVSDASVLANEADLTLIVV
A0A4P6PD26      -PR-----TSLGVLDPKRIGELISSLKSKYDVVLIDTPPLVGISDSSIIAKETDGAIIVV
A0A1Z8SVB5      -TR-----AATEIIEKKEFELLLAAXKKMADVVIFDSPPAGLFPDSIALARKTDEVLFVT
A0A2V5W3Y0      -LG-----QPSEHLLRDSTDALLADLYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFVV
                                                :..*  *     :   .           

A0A432FAS4      KFNKVRREHARKTVQRIQDAGIYIAGICINDLD-------------FEGKDSYYYSYY--
A0A660Q3A0      WAGQTSRKLSQLAVQTLRERGANILGCVLNNLD-------------FSRIGYYYYSTY--
A0A4Q3AQI1      WSAHTPIRTMKAAVEMLQTNGANFYGFVLNRLD-------------LNATTNYYQYYY--
A0A6N2CMN7      KFNTVKRKTAVVNVRRLWESNTPVFGAILNNIS-------------GSLSSYYYSSYS--
A0A2V5UAD5      RNRFSRPRPAREALELLFQRQAKVLGLVFNRAD-------------ASARSHYY------
A0A258AXL1      RADQTTQRDVATASEILHQSGAQVYGFVLNCVN-------------LRRLENNYYYGH--
A0A2E6T1E0      KFNKIRREHARKTVQRIQDAGINIVGVCINDLD-------------FEGKDSYYYSYY--
A0A2D5W0Q9      KFNKIRREHARKTVQRIQDAGIYILGTVINDID-------------FEGKDSYYYSYY--
A0A1Z9KB52      RYGKVSRQVVKRLIGDLKATGANILGVILNDLP-------------SKKATGY-YYSG-Y
A0A7C5CZ90      QYRRYPQPMYLRAKQIIEKVGGNLVGIVLNNIN-------------IAQDESYYYYSG-Y
A0A257LYL4      QHRKLPRNMLMRVKQAVENVGGHVIGVVLNNVD-------------VRSDSQYQYYTS-Y
A0A4Q2XXY1      QHRKLPRTMLMRVKQAIENVGGNLLGVVLNNVD-------------VRSDSQYQYYTS-Y
A0A2V5U7A0      HARKTTVHSARQVKERFDAVRGPILGVILNGIN-------------VEDPDYAYYRHY--
A0A3D4CZT6      QHRKLPRNMLVRVKQAVENVGGHVIGVVLNNVD-------------VRSDSQYQYYTS--
A0A4V1S9Q4      QHRKLPRNMLLRVKQAVENVGGNVIGVVLNNVD-------------VRSDSQYQYYTS--
A0A355VK99      RSGKIDKRYLTQIQQLADQGKLPNMAYIINGVN-------------FKSASYSYYGYG--
A0A2V6N5E0      RLSYTSARLTKKALELLYGRQVNIPGVILNFVD-------------TSLPEY--YYYQ--
A0A2V6NH44      RLSHTSARLTKKALESLYSRQVNVPGIILNYVD-------------TSLPEY--YYYQ--
A0A432FDF6      QYRKYPQLMTQRAKDMVTKVGGELVGVVLNNIN-------------ISQDSYYYYYSG--
A0A522ACN3      QYRRYPQPMNIRAKQLIEKVGGNLVGIVLNNIN-------------MSQDESYYYYSG--
A0A353DCA1      QHRKLPRNMLLRVKQAVENVGGQVIGVVLNNVD-------------VRSDSQYQYYTS--
A0A3C1AXQ2      QHRKLPRHMLMRVKQTVENVGGTVLGVVLNNVD-------------LRSDSQYQYYTS--
A0A3D0IZR7      QHRRYPRNVSQRAKRVIEDVGGKLFGVILNNVN-------------IKTDDNYYYYAG--
A0A520LRZ3      QHRKLPRGMLIRVKQAIENVGGKALGVVLNNVD-------------VRSDNQYQYYTS--
A0A356FSV4      KFNTVKRKTAVMNVRRLWESNTPVFGSVLNNV--------------STALSSY-YYSH--
A0A3D3DET9      RAAFTSARVARASLESLYQRQVRLLGLVFNAVR-------------PSSED-Y-YYYR--
A0A355SVK9      KFNTVKRKTAMVNARRMAESNTPVFGAILNNI--------------SSTLSSY-YYYS--
A0A2E5D7I3      RANVVPKPAVFRALDVMEEDGSRIVGVVLNGYR-------------ETRRLXG-YNYS--
A0A2V5NYE2      RAERTSARVGRAALELLYHRQVSVLGLVFNGVR-------------PSSVDYY-YYYK--
A0A2V6FIP7      KFNKIRRDHASRTIQRIQDAGIHILGVVLNDID-------------FEGKDSYYYNYY--
A0A353DI77      RAEHTPVKSIQRAFDMLEDDGVFSSGVILNDFT------------ENRLQGGKYGYGY--
A0A1V6GCZ3      QYRRYPQPMNIRAKQLIEKVGGNLVGIVLNNIN------------MSQDESYYYYSGY--
A0A3C1UJT2      RSGKTTSKVVLRIIDYLHRHGHTPSGIVLNFLR-------------NNNNKGSYYYYY--
A0A2S7U0Z3      RTRKTPIGAMIRACDLLKASGAKLGGVVVNGMK---------------RTGGSNYLGY--
A0A5E6MKA7      RDGYVDRSEARRVVETLLGVNTRILGAVLNRVQ--------------TSARSYYAYHY--
A0A6B3L936      RALKTPVGAVLRAKDLLLGAKLDLAGVVVNALK--------------ARHSGSGYFGY--
A0A2N8IR72      RSGKIDKRYLLQIQQLADQGKLPNMAYIINGVN--------------FKSASYSYYGY--
A0A2N8IV96      QPRKLPLKALLRQKQVIESVGGNLAGVVMNNVD-------------ITSDHQYQYYTT--
R7E1V8          QPRKLPLKALLRQKQVIESVGGNLAGVVMNNVD-------------ITSDHQYQYYTT--
A0A2E0R252      RVGKTPRGAIKRAIRVLEANHSAPVGVVANGLP----------RTRTKGAYGYYYSYY--
A0A3E1EF48      RMGKTPRKALFRGLKTLRSNHAEPVGIVANLLP----------RVAGRGAYGYYYGYH--
A0A2A2PVG8      RMGSTPKGAIKRAIRVLSDNGSHPVGIVANGLP----------QTRTAGAHGYYYSYS--
A0A2E0R421      RMSMTSRSSIMRALRILKVNQSDPVGIVANGLP----------VAKTKTGHDYYYSYP--
A0A2E5EJ69      RAAKTSYRLIGRALELVRRSGKNVSGLVLNFVP-------------EKRRAGYNYYYY--
A0A2G4I5Z5      NAGKTSYRVVLRALEMLRRAGAKPSGVVLNFLP-------------QSAGSGYYYYYS--
A0A4P5QQV6      RFATSSMRISQKALDTLRERQVNVLGLVCNDVD--------------ESLQDYYYYRY--
A0A1T4WWY4      RCGKTLRKDVEDAVQSLQKLGAHFYGFILNGVD------------FSKRVNHYYYYYY--
A0A3D3LEQ6      RSASTPRSDVTAAFQQLEKLGGHFFGFVLNRVD------------FSKRSNHYDYYYY--
A0A3D3NW23      RSASTPRSDVTAAFQQLEKLGGHFFGFVLNRVD------------FSKRSNHYDYYYY--
A0A2E7ALI1      RANVVPKPAVFRALEMLEEDGSRVVGIILNGYRESRRLXGXXYSYGSYRYGKYGYSQY--
A0A178IDB9      RFRTVRRKLIKKTLSKFTESGISILGVVLNRMP-------------HASIMNYGYDGY--
A0A290QD69      RFKTVRKAVIRKALEKFQESGITILGVVLNCMP-------------HASVMNYGYDGY--
A0A2E7VDS1      RYGKVSRKVVKNLLAKVDETGANVLGVVLNDLP-------------EKKTPGYYYAGY--
A0A7C8D3W3      KAGETPMRFAKNAINEIIRRGAYISGIVVNGIK--------------PDNPSYYYTYY--
A0A178IFJ2      RFNHVSRPQVHRVTERFRSTGLEMPGIVLNMMP-------------SGRGSAAYYSGY--
A0A357FSP9      KFNTVKRKTAVVNVRRLWESNTPIFGAILNNIS--------------STLASYYYSSY--
A0A2A2R174      NARKTSYRAVLRALEMLRRAGAKPSGVVLNFLP-------------QSAGSGYYYYYS--
A0A1H2DTI1      RASMTSARAARNALDQLYHRQVNVLGLVLNSVN-------------ALLPDYYYYYRY--
A0A1H1MGC9      FFNRVRRKAAQFSARKLLEVNVPCFGAVLNGLN--------------LAVSGYYYAQY--
A0A1V5L462      KSGQTNFRQVKISLERLSVTKTKVWGFVMNYVK-------------AGGNDYYYYGRY--
A0A3D3LGD3      QHRRLPRQTLMRVKQTVENVGGTVLGVVLNNVD-------------LRADSQYQYYTN--
A0A350ARX4      RASQTSTRQVQSSLERLSSRTSKIMGLVFNCAP-------------ATGVDYYYNYRH--
B5JIS2          RESKAPISQIRQVIGDIDSTGAPVLGLVLNDYS-------------------FGSLNPRL
A0A6N6ZC77      RTNYTQTRQIKNSLERLRLRGAKIGGFVLNYVN-------------VKGSDYYYYKKY--
A0A7C5H7K5      RSGTTSARLAKAALDQLNVRGAKVLGLVLNALR--------------PTMGGYHYY----
A0A538NJ59      RNRFSRPRPAREALELLFQRQAKVLGLVFNRAD-------------ASARSHYY------
A0A2A2R3V9      RTSYTSARLSRNAMDLLYQRQVNILGLVMNFVD-------------TNLPEYYYY-QY--
A0A3C1VFY9      RAEFTSARVVRASLDMLYQRKARVLGLVFNAVR-------------MSVGGYYNYYRY--
A0A2V2SMX4      RAEHTSARVARAALDILYQRRVKVMGLVFNAVR-------------PTTAD-YYYSKY--
A0A522AC27      RAGETSGRVARAALELLYQRNVPVLGLVFNAVQ-------------TGSGDYYYYYRY--
A0A6M1RFD0      RAQHTSARVARAALDLLYQRNVKVLGLVFNAVN-------------PRTGEYYYYSRY--
A0A7C3HXH0      RAQHTSARVARAALDLLYQRNVHVLGLVFNAVN-------------PRTGEYYYYSRY--
A0A1H2GQN6      QHRRYPREISIRTKKAIEEVQGNLVGVALNSVA-------------TNSDEGYYYYGA--
A0A512M3Y3      RAEQTTQRDIATAMEVLVGTRTPIYGFVLNGVD-------------LSRMENYYYYSS--
A0A4P5R5J1      RFSTSSARRSRTAINLLVQRQANLLGIVCNDVR--------------LAESEYGYGNY--
A0A4P5YK43      KSGQTSMRFAKSALGALRHRGAEILGVVLNGIT--------------SDNPHYYYNNY--
A0A2A2RPW6      HSRRTPVRVVSRALEMLRRAGGKPSGVVLNFLP-------------GSAGAGYYYYYS--
B1ZT68          KYGSVRLNSVRKTLARVHETGIKVLGLVINQMP-------------ESRFRASGYEGY--
W0J7C2          RYRTVRPAIIRKVIDRFHGTGISLLGVVLNRLP-------------QSKARSYGYHGY--
B4D1I7          RFTSSSTRASRKALELLRERQTNVIGIVCNDVS--------------EAMQDYYYYRY--
A0A353F286      QHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD-------------VRSDSQYQYYTS--
A0A354FSA6      QHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD-------------VRSDSQYQYYTS--
A0A3B9GA54      QHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD-------------VRSDSQYQYYTS--
A0A520LEH8      QHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD-------------VRSDSQYQYYTS--
A0A6B2M0T8      QLNKHRKATLKAILGRLSQSKAEILGVVVNKVS----------RSKSRNLGTYKYVDY--
A0A2D7B7R6      RSGKTTSKVVLRIIDYLHRHGHTPSGIVLNFLR-------------NNNNKGSYYYYY--
A0A2E5K4P7      KYNTVKRNTASLTVRKLAEAGKPIFGVILNNMA--------------SKSAEYYYSEY--
A0A2V6F9Q9      RLSHTSARLTKKALELLYSRQVNVPGIILNFVD--------------TSLPEYYYYQY--
A0A2V6NZZ3      RLSYTSARLTKKALELLYNRQVGVPGVILNCVD--------------TSLPEYYYYQY--
A0A2V6EBU2      RLSYTSARLTKKALELLYNRQVGVPGVILNCVD--------------TSLPEYYYYQY--
A0A2V6EY06      RLSYTSARLTKKALELLYNRQVGVPGVILNCVD--------------TSLPEYYYYQY--
A0A2V6ME53      RLSYTSARLTKKALELLYNRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A538NUU0      RLSYTSARLTKKALELLYNRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A2V6NIJ1      RLSYTSARLTKKALELLYSRQVNVPGIILNYVD--------------TSLPEYYYYQY--
A0A2V6C292      RLSYTSARLTKKAFELLYSRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A2V6D2X0      RLSYTSARLTKKAFELLYSRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A2V5ZUK1      RLAYTSARLTKKALELLYSRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A2V5XFN9      RLSYTSARLTKKALELLYGRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A2V6EZC8      RLSYTSARLTKKALELLYGRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A2V6I7Z5      RLSYTSARLTKKALELLYGRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A3B9LCP2      RLSHTSARLARKGLELLYDRQVNVPGIILNFVD--------------TSLPEYYYYQY--
A0A3C0R669      RLSHTSARLARKGLELLYDRQVNVPGIILNFVD--------------TSLPEYYYYQY--
A0A2V6EID2      RLSYTSARLIRKGLELLYGRQVNVPGIILNFVD--------------TSLPEYYYYQY--
A0A2V6MHB0      RLSYTSARLIRKGLELLYGRQVNVPGIILNFVD--------------TSLPEYYYYQY--
A0A2W5YWL9      RLGYTSARLTRKALELLYSRQVNVAGVILNYVD--------------TSLPEYYYYQY--
A0A2V5NH62      RLSYTSARLTRKSLELLYNRQVNVPGVILNYVD--------------TSLPEYYYYQY--
A0A2W6A620      RLSYTSARLTRKSLELLYNRQVNVPGVILNYVD--------------TSLPEYYYYQY--
A0A2V5PIJ4      RLSHTSARLTRKSLELLYNRQVNVPGVILNQVD--------------TSLSEYYYYQY--
A0A2V6K2G8      RLSYTSARLTKKALELLYNRQVNVPGVILNFVD--------------TSLPEYYYYQY--
A0A2V5W206      RLSYTSARLTKKALELLYGRQVNIPGVILNFVD--------------TSLPEYYYYQY--
A0A2V6MW77      RLSYTSARLTKKALELLYGRQVNIPGVILNFVD--------------TSLPEYYYYQY--
A0A6N4WVA3      RCAYTQVRQIKPAMARLRERNIDVSGLILNYVD--------------AMQPGYYYYKY--
A0A0R2XPB1      RCAHTQVRQIKPAMARLRERKIDISGLILNYVD--------------TTQPGYYYYKY--
A0A348NQP1      RCAHTQVRQIKPAMARLRERNIEISGLILNFVD--------------TTQPGYYYYKY--
A0A357FV58      RCAHTQVRQIKPAMARLRERNIEISGLILNFVD--------------TTQPGYYYYKY--
A0A2G4GZN8      RYNVVNARNAVSCISRLRDAHAPILGVVLNSMS--------------IRMASAYTDTY--
A0A348NPT1      KFNTVKRKTAVVNVRRLWESNTPIFGAILNNIS--------------STLASYYYSSY--
A0A2E1KV60      KYDSVKKSLVNSCVRRLWESKKPVLGAILNNVS--------------SGLSSYYYSQY--
A0A2D7F4D9      KYDSVKKSLANSCIRRLWESKTPLLGAVLNNVS--------------LGLSHYYYSQY--
A0A3R7RBR8      KYDSVKKSLANSCIRRLWESKTPLLGAVLNNVS--------------LGLSHYYYSQY--
A0A2E0NH28      KFNTVKRKTAVMNVRRLWESNTPVFGSVLNNVS--------------TALSSYYYSHY--
A0A350AS32      KFNTVKRKTAVVNVRRLWESNTPVFGAILNNIT--------------STLSSYYYSHY--
A0A368BGT4      KFNTVKRKTAVLNVRRLWESNTPVFGAILNNIT--------------SSLSSYYYSNY--
A0A6N6PLV8      QHRRFPRAMLQRVKQAVLGVGGRLIGVVLNNVD-------------AKHDDGYS---Y--
A0A2E0V4K6      RANVVPKPAVFRAIDLLEEDGVKLAGVVMNGYRESRRLLGYNYSYGAYRTGRYGYRQY--
A0A290QE54      RFNKAYRKHIKLYIRALHNGKNDILGIVLNGLS-------------TRRIEYYSNYRY--
A0A1H1SWX2      RFNRAYRKHIRLYIKQLKESKNELLGIVLNGLS-------------PRRIEYYSNYRY--
A0A1D8AZK8      RFNRAYRKHIRLYIKQLRESKNELLGIVLNGLS-------------PRRIEYYSNYRY--
A0A4Q1C9I5      RFNRAYRKHIRLYIKQLRESKNELLGVVLNGLS-------------PRRIEYYSNYRY--
A0A2E6NAH3      KFNTVKRKTAVINVRRLWESNTPVYGAILNNIT--------------SVLSSYYYSNY--
A0A2A5VZA5      KFNTVKRKTAVANVRRLWESNTPVFGAILNNIT--------------TSLSSYYYSQY--
A0A424R295      KFNTVKRKTAVANVRRLWESNTPVFGAILNNIT--------------TSLSSYYYSQY--
B4CZV9          WTGQTPVRCVKSAIETLRANRANFYGFVLNRLD-------------LNATQNYYQYYY--
A0A1G3ZL71      RFNRALRKHIKVFVRTLREGKNAFLGIVLNGLT-------------ARRIAYYTNYRY--
A0A556QP09      RFNRAFRKHIRLYIKALRSGKNEILGVVLNGLS-------------PRRIEYYSNYRY--
A0A2T6DX88      RFNHAARKHIRLYIRALQSGKNEILGIVMNGMS-------------TRRIEYYSNYRY--
A0A2T6CWI7      RFNRAYRKHIRLYMRTLRQGKNEVLGIVLNGLS-------------PRRIEYYSNYRY--
A0A3E1E5C8      RFNCAAKKHVRLYMKTLRNGKNEVLGVVLNGLS-------------PRRIEYYSNYRY--
B1ZZ74          RFNRAYRKHIRLYMKALRDAKNEVLGVVLNGLS-------------PRRIEYYSNYRY--
A0A3B9FM17      RYGKVSRKIVKTLIESINDTGANLLGVVLNDLP-------------QKKTPGYYYSGY--
A0A0E3YV65      RYNYTSRPGVRRLIETFKRSQIDLAGIVLNRMP-------------AGTHSDAYYSSY--
W0J900          RFNYVSRPQVHRVTERLRSTGLELPGIVLNMMP-------------SGRGSSGYYSGY--
R7E4L8          RCGMIEKQYV-PVIQGLADKGEFRSGAVILNAE------------------NFKNSRF--
A0A4Q3BVY2      RAEVTGRKDVLDALALLRRSQAHFFGFVLNAVD-------------LSKLGNYYNYYY--
A0A4P6PCA7      RVGKTKMRGLKTMLSRLLEVDALVLGCIANDVP-------------------YSLAGKFS
A0A2T6DSN5      RFKTVRKALIKKTLHKFAESGIHVLGVVLNCVP-------------SSSVRNYGYDGY--
A0A317ZIW7      RCSYTHLRQIKPAIARLKERSTNVDGIILNYVD--------------TAQPGY----Y--
A0A7C4PPT4      WCGRTPARYVKSAVEILQANHANFYGFVLNRLD-------------LSVTSNY----YNY
A0A7C4QZX4      WCGRTPANYVKSAVETLQANHANLYGFVLNRLD-------------LSVTSNY----YNY
A0A2D7WMI4      RYGKVARRVAKNLLYSIEESGTNILGVVLNDLP-------------QKRSTGYYYSGY--
A0A2D6VHX5      RYGKVSRQVVKRLIGDLKATGANILGVILNDLP-------------SKKATGYYYSGY--
A0A2D8I214      RYGKVSRKIAKNLVENLEETGVNVLGVVLNDLP-------------QKKAPGYYYSGY--
A0A1Z8VL41      RYGKVSRKVAKNLIENIEETGANILGVVLNDLP-------------QKKTPGYYYSGY--
A0A2E6TNA4      RYGKVSRKVAKNLIENIEETGANILGVVLNDLP-------------QKKTPGYYYSGY--
A0A1Z8RG47      RYGKVSRKVAKSLLENIEETGANVLGVVLNDLP-------------QKKTPGYYYSGY--
A0A1Z8RJJ5      RYGKVSRKVAKSLLENIEETGANVLGVVLNDLP-------------QKKTPGYYYSGY--
A0A2D7V631      RYGKVSRKVAKSLLENIEETGANVLGVVLNDLP-------------QKKTPGYYYSGY--
A0A354RA24      RYGKVSRKVAKSLLENIEETGANVLGVVLNDLP-------------QKKTPGYYYSGY--
A0A2E9RV62      RYGKVARKVAKNLIESLEETGANMLGVVLNDLP-------------EKKTPGYYYSGY--
A0A2E4AY96      RYGKVARRAAKGLLSNLEESGSNILGVVLNDLP-------------SKKSTGYYYSGYYG
A0A3B9B9P4      RYGKVARRAAKGLLSNLEESGSNILGVVLNDLP-------------SKKSTGYYYSGYYG
A0A2D5Y6N6      RYGKVSRKIAKSLLENLDETGAKILGVVLNDLP-------------QKKAPGYYYSGY--
A0A2E7HSS8      RYGKVSRKVVKSLIASIKETGANLLGVVLNDLP-------------QKKTPGYYYSGY--
A0A2D8VCK3      RYGKVSRKIVKTLIESINDTGANLLGVVLNDLP-------------QKKTPGYYYSGY--
A0A350QVY4      RYGKVSRKIVKTLIESINDTGANLLGVVLNDLP-------------QKKTPGYYYSGY--
A0A2E4ZYR7      RYGKVARKVVKNLLMRMDETGANTLGVVLNDLP-------------EKKTPGYYYAGY--
A0A2E6TCV1      RYGKVARKVVKNLLTRVDETGANILGVVLNDLP-------------EKKTPGYYYAGY--
A0A3D4HHL8      RSNTTRVKQAKSAFHILMFRRAKILGIVLNAFD--------------VRGPGY----Y--
A0A366HV03      KAEKTHGRDVTEAVEQLMRAGAPMAGFVLNNID-------------MSKVSNYYYYYY--
A0A6G6K911      KAEKTHGRDVTEAIEQLMRAGAPMAGFVLNNID-------------MSKVSNYYYYYY--
A0A5R8KAF2      RAEKTTRRDVSDAVALLRKTDAHFFGMVLNDLD-------------LNKAKNYYN--Y--
A0A7C4LRZ6      RAGQTSMRFARNAIAAVHQRGARLFGVVLNGIT---------------ADNPYYY--Y--
A0A2V2SDN0      RGSHTSARMVREGLDTLRQRRARVLGVIFNRAV----------------SSSFEYH-H--
A0A1V6GL40      RAAFTSARVARASLESLYQRQVRLLGLVFN-AV----------------RPSSEDY-Y--
A0A2V5X6Z6      RGSFTSARMARGALDALRQRRVHVLGLIFNRAA----------------SSPCERQ-Y--
A0A2V5VGZ7      RGSFTSARMARGALDALRQRHVRVLGLIFNRTV----------------SSPYEHD-Y--
A0A2V5U130      RGSFTSARMARGALDALRQRHVHVLGLIFNRAA----------------SSPYGHD-Y--
A0A2V6C237      RGSFTSARMARGALDALRQRHVRVLGLIFNRTV----------------SSPYEHD-Y--
A0A3R8L982      RFNRALRKHIKLYIKALRAGKNEILGVVLNGLT-------------ARRIEYYSNYRY--
A0A6N6QBS9      RAGKTSMRFAKMGINTVQQRGAPILGLIVNGVP---------------IDNPYYYY-T--
A0A2E7HPU9      RAEHTPKGAVAKCLDMLRDDDNEPAGIVVND---------------YQERGGFARK-Y--
A0A388PR45      RFNVVSARNAAACLARLRDAGAPMLCAVLNQMS-------------VRLASVYTDT-Y--
A0A388QR61      RFNVVSARNAAACIGRLREAGVPMLCAVLNQMS-------------VRMASVYTDT-Y--
A0A4P5YHI0      RFNVVSARNAAACIGRLREAGVPMLCAVLNQMS-------------VRMASVYTDT-Y--
A0A2A2RS01      RFNLVHMRNAGSCLGRLAETGVPILGAVLNRMS-------------IRMASVYTDS-Y--
A0A2A2Y1A7      RFNLVHMRNAGSCLGRLAETGVPILGAVLNRMS-------------IRMASVYTDS-Y--
A0A388PDH9      RFNLVHMRNAGACLARLAETGVPILGAVLNRMS-------------IRMASVYTDS-Y--
A0A2G4H1E7      RYNAVNLRHATSCLARLREAQAPLLGVILNAMS-------------LRMASAYTDS-Y--
A0A2G4GZA6      RYNTVNLRNATSCLARLREAQAPLLGVVLNAMS-------------LRMASAYTDT-Y--
A0A388P514      RYNTVNLRNATSCLARLREAQAPLLGVVLNAMS-------------LRMASAYTDT-Y--
A0A2A2YG59      RYNTVNLRNATSCLARLREAQAPLLGVVLNAMS-------------LRMASAYTDT-Y--
A0A2G4F7D5      RYNTVNLRNATSCLARLREAQAPLLGVVLNAMS-------------LRMASAYTDT-Y--
D5EML0          RQFAVKRTKFQHSVNQMERSTAPVVGVVFNGIKDVNAAVGFGRNGVSHYGYGY-EK-D--
A0A7C4PPJ4      RAGKTSMRFARNALNAVQQRGARLFGIVLNGIT---------------ADNPY-YY-Y--
A0A3C1C1M3      RPATSRKRAVRHTIQRFQAAGMANLAVVMNDVE--------------HSKFTY-HS-Y--
A0A2E9EYJ1      QHRKLPRGMLXRVKQAIQNVGGTAXGVVLNNVD-------------VRSDNXY-QY-Y--
A0A258AXR6      QHRKLPRHMLMRVKQGVENVGGKVVGVVLNNVD-------------LRSDAQY-QY-Y--
A0A3D3NZQ6      QHRRLPRQTLMRVKQTVENVGGTVLGVVLNNVD-------------LRADSQY-QY-Y--
A0A1T4WVZ9      QHRKLPRHMLLRVKQTIENVGGTVLGVVLNNVD-------------LRSDSQY-QY-Y--
A0A4R7SSI6      QHRKLPRHMLLRVKQTVENVGGTVLGVVLNNVD-------------LRSDSQY-QY-Y--
A0A4P6PD26      QYRKYPRDMLVKAKAMIETLGVNVVGAVLNNIN-------------VMRDDYYYYY----
A0A1Z8SVB5      RYGKVSRHVVKRLIGDLKITGANILGVILNDLP-------------SKKATGYYYSGY--
A0A2V5W3Y0      WLSYTSARLVRKSLELLYNRQVNVPGIILNYVD-------------TSLPEYYYYQ----
                                                                            

A0A432FAS4      ----YYQNRYYASH---------------------YKSDKPGGKDEETNSKKPEKESSAA
A0A660Q3A0      ----Y---GYYDYD---------------------YRY--------------PSGETGSA
A0A4Q3AQI1      -------YSNDYYY---------------------HTQLENA------------------
A0A6N2CMN7      -------DKAYQNY---------------------YIQHEEELEEELAAKVEPAGSKS--
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ----YYSRYYEPTY---------------------YNNPKEGGEAA--------------
A0A2E6T1E0      ----YYQNRYYASH---------------------YKSDKSDSEHGKEEEFDSKKTKKKA
A0A2D5W0Q9      ----YYQNRYYASY---------------------YSNEKKLGSKKGEGAKDGELVQGGK
A0A1Z9KB52      YGYGYYRYKYYSKY---------------------YSPTEDT------------------
A0A7C5CZ90      YHDYYY-------Y---------------------YSRHDEEE--------SKEPSSEKS
A0A257LYL4      YT-----------Y---------------------YAPAESQSAAQLGPVAPQGSAVAPA
A0A4Q2XXY1      YT-----------Y---------------------YSPTNIEK-ARPRPAASASTPATAG
A0A2V5U7A0      ----------YGSD---------------------YGTVAAAENGNGGEHADVEVLMAHD
A0A3D4CZT6      ----------YYTY---------------------YAPSADSDPVPTVGATASATSGSAL
A0A4V1S9Q4      ----------YYTY---------------------YAPAESQIGPPVAAATSSSPAKPQA
A0A355VK99      ----------YGYQ---------------------YGYGAKDPQQTARKRD---------
A0A2V6N5E0      ----------YSEY---------------------YSTPTSVPDGEAVAPVRRQRPKPIE
A0A2V6NH44      ----------YSEY---------------------YNRPVAPPESAAAV---QHRTGQAQ
A0A432FDF6      ----------YYYD---------------------YYYKSREK--------EESADEAQD
A0A522ACN3      ----------YYHD---------------------YYSKNEDS--------MTEGEHKGD
A0A353DCA1      ----------YYTY---------------------YAPSSLEETGTPQQMTAAPASSKTE
A0A3C1AXQ2      ----------YYTY---------------------YSPDNM----------AAPADKKPE
A0A3D0IZR7      ----------YSTQ-------------------YGYKKRAPRAAQRSKATATVAAVEIPA
A0A520LRZ3      ----------YYTY---------------------YSPSNIDPNQKISSDKPKAPQSEES
A0A356FSV4      ----------YSDK---------------SYQDY-YINNEDDFEDQLVESTASGDEDTSE
A0A3D3DET9      ----------YKDY---------------------YRPYPSGGTKAAESVRTEQT-----
A0A355SVK9      ----------YSDK---------------SYSDY-YVHHDVESEQDLGKGALKPELQGKS
A0A2E5D7I3      ----------YGSY---------------RYGKYGYSQYGYGGYGSYGSYGSDDXED---
A0A2V5NYE2      ----------YKDY---------------------YKAYPTSPSQSAATASPKREQAHRA
A0A2V6FIP7      ----YYQNRYYSSH---------------------YNPRPDKPLKDKSEEVKKAG-----
A0A353DI77      ----------GYGH---------------------YGDDT--------------------
A0A1V6GCZ3      ----------YHDY---------------------YYRSEEQEPVVKEGAESGGKDKLDI
A0A3C1UJT2      ------SSDKDKTY-----------------SKSGYQKKQVTNSPMEVGASAEDEPVKS-
A0A2S7U0Z3      --------KGHGEY--------------GGEEYGYYGGDK--------------------
A0A5E6MKA7      ----------------------------------AYRLPEEQKREQSLKAPSQPS-----
A0A6B3L936      ---RDYGEYGHDSY---------------------YGQED--------------------
A0A2N8IR72      --------GYGYQY--------------------GYGTKEPQQTSRKQNK----------
A0A2N8IV96      ----------YYSY---------------------YSADGASSGENADASSMKKVERSGK
R7E1V8          ----------YYSY---------------------YSADGGSSGENADASSMKKAERSGK
A0A2E0R252      ------GGGNYANY-----------------------SDAK-------------------
A0A3E1EF48      ------GGGAIDGY---------------------VSNDSK-------------------
A0A2A2PVG8      ------SGGSYSGY---------------------SSNEK--------------------
A0A2E0R421      ------GSGSYGSG---------------------NNSDTEKIKTTRVRVPLFQNILNLG
A0A2E5EJ69      ---------TDKKY---------------------YGYGEDKR-----------------
A0A2G4I5Z5      ----------GNKY---------------------YGQKGVYGASTPRS-----------
A0A4P5QQV6      -----------SEY---------------------YGSQKKDAGKKQAARA---------
A0A1T4WWY4      ----------SASY---------------------YDANW----------DVKPAKKET-
A0A3D3LEQ6      ----------SSNY---------------------YDSNW-EEEKEEREADERPGRKKRR
A0A3D3NW23      ----------SSNY---------------------YDSNWEEEEKEDREADERPGRKKRR
A0A2E7ALI1      ------GYGGYGSY-------------------GSYGSDDDED-----------------
A0A178IDB9      -------GAYGSDY---------------------YKAYQEEEAAAVK------------
A0A290QD69      -------GAYKADY---------------------YKSYQGEKAESK-------------
A0A2E7VDS1      YGYGYFRYKYYNKY---------------------YGENEPQEHGKAKAG----------
A0A7C8D3W3      ----------YHAY---------------------YNKDLTEMPEEEPGDGPMKAPARTM
A0A178IFJ2      ---GYYGSKHYSSY---------------------YKEGQLAARSG--------------
A0A357FSP9      ------SDKAYQDY---------------------YISQDVELEDELAGSVEPEMEPRA-
A0A2A2R174      ----------GNKY---------------------YGQKGVYGATSSKG-----------
A0A1H2DTI1      -----------YEY---------------------YRPKDEVIEGAPGTPRRGKDGSKL-
A0A1H1MGC9      ------YDKSYKDY---------------------YVTMAKQDPGTVER-----------
A0A1V5L462      -----------KSY--------------------RYQHKESGDSGNEEIRKKTGRLSPKE
A0A3D3LGD3      ----------YYTY---------------------YSPDNRPAAEGGKPKKRRKAAGETA
A0A350ARX4      ----------YDSY---------------------HQQPDAKQKRERS------------
B5JIS2          AYGGKGKYKYHNNI---------------------KKHAKGAGRVKSKSMVGKLMAEDVE
A0A6N6ZC77      -----------NDY---------------------YAPPSSGAGS---------------
A0A7C5H7K5      -------YRKYRDY---------------------FQTAATKS-----------------
A0A538NJ59      ------------------------------------------------------------
A0A2A2R3V9      -----------KEY---------------------YNRGAKAS-----------------
A0A3C1VFY9      -----------QDY---------------------YSTHPGK------------------
A0A2V2SMX4      -----------SEY---------------------YRTYPGKG-----------------
A0A522AC27      -----------KDY---------------------YKPYPAKPA----------------
A0A6M1RFD0      -----------KDY---------------------YHRSSRAKA----------------
A0A7C3HXH0      -----------KDY---------------------YHRPSRARA----------------
A0A1H2GQN6      ----------YADY---------------------YNNPKNRKKKKKGSSLQPRPAPPLP
A0A512M3Y3      ---------YYPKY---------------------YDPSYVLQHADA-------------
A0A4P5R5J1      -----------------------------------YQYSAYRENADSEPLEPLPR-----
A0A4P5YK43      ----------YHAY---------------------YGKQAQHAATAPTPIPAAVHRATPP
A0A2A2RPW6      ----------GNKY---------------------YGSKGVYGASSSKG-----------
B1ZT68          -------GAYGQDY---------------------YQAYAKTSAAQ--------------
W0J7C2          -------GTQSAAY---------------------YKAYEEQTPA---------------
B4D1I7          -----------PDY---------------------YATAKSDQAGV--------------
A0A353F286      ----------YYTY---------------------YSPSNMEENQKPQAMTARKSSKSEP
A0A354FSA6      ----------YYTY---------------------YSPSNMEENQKPQAMTARKSSKSEP
A0A3B9GA54      ----------YYTY---------------------YSPSNMEENQKPQAMTARKSSKSEP
A0A520LEH8      ----------YYTY---------------------YSPSNMEENQKPQAMTARKSSKSEP
A0A6B2M0T8      --------GKYKSY---------------------YPQKSEKTR----------------
A0A2D7B7R6      ---SSDKDKTYSKS--------------------GYQKKQVTNSPMEVGASAEDEPVKS-
A0A2E5K4P7      ------YTGQYKKY---------------------YTSQGAPEVSLGETSNSHPKPARKM
A0A2V6F9Q9      -----------SEY---------------------YNRSVAVLESEATAQRQPTR-----
A0A2V6NZZ3      -----------SEY---------------------YNRPVAPSESEA------IA-QRSS
A0A2V6EBU2      -----------SEY---------------------YNRPVAPSESEA------IA-QRSS
A0A2V6EY06      -----------SEY---------------------YNRPVAPSESEA------IA-QRSS
A0A2V6ME53      -----------SEY---------------------YNRPIAPPESEA------TA-QHSS
A0A538NUU0      -----------SEY---------------------YNRPIAPPESEA------TA-QHSS
A0A2V6NIJ1      -----------SEY---------------------YNRPVASSESEA------TT-QHHP
A0A2V6C292      -----------SEY---------------------YNRPVTSSASDA------IA-Q-HS
A0A2V6D2X0      -----------S------------------------------------------------
A0A2V5ZUK1      -----------SEY---------------------YSTPS-VPETDAQPVAPPVR-RQRP
A0A2V5XFN9      -----------SEY---------------------YSTPA-APDGEA---VTSVG-REHP
A0A2V6EZC8      -----------SEY---------------------YSTPA-APDGEA---VTPVG-REHP
A0A2V6I7Z5      -----------SEY---------------------YSTPA-APDGEA---VTPVG-REHP
A0A3B9LCP2      -----------SEY---------------------YNAPASAPEGET---VAAPH-REQA
A0A3C0R669      -----------SEY---------------------YNAPASAPEGET---VAAPH-REQA
A0A2V6EID2      -----------AEY---------------------YNPPASVTDDEA---LTAPP-PREP
A0A2V6MHB0      -----------AEY---------------------YNPPASVTDDEA---LTAPP-PREP
A0A2W5YWL9      -----------SEY---------------------YNTPAEPAE------------RPAT
A0A2V5NH62      -----------SEY---------------------YNTPVPVEEHDD---VAAAHRHHQP
A0A2W6A620      -----------SEY---------------------YNTPVPVEEHDE---VAATTLHPQP
A0A2V5PIJ4      -----------AEY---------------------YNTPEPVDERAA---PAALH-HREP
A0A2V6K2G8      -----------SEY---------------------YSTPT-VPDAET---VTPVR-RERP
A0A2V5W206      -----------SEY---------------------YSTPTSVPDGEA---VAPVR-RQRP
A0A2V6MW77      -----------SEY---------------------YSTPTSVPDGEA---VAPVR-RQRS
A0A6N4WVA3      -----------SEY---------------------YTDSKSGSSSSSKATST--------
A0A0R2XPB1      -----------SEY---------------------YTDPKNGVQSTSQQTTASS------
A0A348NQP1      -----------SEY---------------------YTDPKNSEQSLSQQTTA--------
A0A357FV58      -----------SEY---------------------YTDPKNSEQSLSQQTTA--------
A0A2G4GZN8      -----DS--SYRKY---------------------YVDEPR-------------------
A0A348NPT1      -----SD-KAYQDY---------------------YISQDV-------------------
A0A2E1KV60      -----SS-EKYSQY---------------------YLQDSYL-DLNESNATKSLDSSTAN
A0A2D7F4D9      -----SANKKYSAY---------------------YMQESYLGNMDESEAEES-------
A0A3R7RBR8      -----SANKKYSAY---------------------YMQESYLGNMDESEAEES-------
A0A2E0NH28      -----SD-KSYQDY---------------------YIN------------NED-------
A0A350AS32      -----SD-KAYQDY---------------------YIH------------NDE-------
A0A368BGT4      -----SD-KAYKNY---------------------YTNRGEELDQGEELVQGE-------
A0A6N6PLV8      -------YNSYNEY---------------------YGARREAPARIETAAPQLARPRPAS
A0A2E0V4K6      ------GYGGYGSY-------------------GAYGSDDEED-----------------
A0A290QE54      -------YRSYKKY---------------------YGTQT--------------------
A0A1H1SWX2      -------YRSYKKY---------------------YGSQS--------------------
A0A1D8AZK8      -------YRSYKKY---------------------YGSQS--------------------
A0A4Q1C9I5      -------YRSYKKY---------------------YGSQS--------------------
A0A2E6NAH3      ------SDKAYQDY---------------------YINQEEELEEELVGDIETELESKS-
A0A2A5VZA5      ------TDKAYQDY---------------------YIGQEDEMEDELAASTEPEEKVES-
A0A424R295      ------TDKAYQDY---------------------YIGQEDEMEDELAASTEPEEKVES-
B4CZV9          ---------YSHDY---------------------YYQHAIEST----------------
A0A1G3ZL71      -------YRSYKKY---------------------YGTQG--------------------
A0A556QP09      -------YRSYKKY---------------------YGTQD--------------------
A0A2T6DX88      -------YRSYKKY---------------------YGTQA--------------------
A0A2T6CWI7      -------YRSYKKY---------------------YGAQT--------------------
A0A3E1E5C8      -------YRSYKKY---------------------YGTQS--------------------
B1ZZ74          -------YRSYKKY---------------------YGSQS--------------------
A0A3B9FM17      YGYGYFRYKYYNKY---------------------YGKSDAEEKRKKKQAVS--------
A0A0E3YV65      ---GHYGSKYAADY---------------------IREEKA-------------------
W0J900          ---GYYGSRYYASY---------------------YKEEQLAGQSG--------------
R7E4L8          --------HYYDEY---------------------SETDG--------------------
A0A4Q3BVY2      ---------YSAPY---------------------YDQMESEEEPAAMVQTRS-------
A0A4P6PCA7      GAEGYGYGHSYKSY---------------------VSDTAETAN----------------
A0A2T6DSN5      -------GSYESDY---------------------YKSYQSEKVSS--------------
A0A317ZIW7      -------YYRYSEY---------------------YTSTQKPEDSVKSVGGV--------
A0A7C4PPT4      YNYYYYSYHYYKSY---------------------KTLEANPPAEPNSTPAEKSTS----
A0A7C4QZX4      YNYYYYSYHYYKSY---------------------KALENQPPAPVQG------------
A0A2D7WMI4      YGYGYYRYKYYNKY---------------------YGKNQDS------------------
A0A2D6VHX5      YGYGYYRYKYYSKY---------------------YSPTEDT------------------
A0A2D8I214      YGYGYFRYKYYNKY---------------------YGKEKKSEA----------------
A0A1Z8VL41      YGYGYFRYKYYNKY---------------------YGSEKDTSTKIEV------------
A0A2E6TNA4      YGYGYFRYKYYYKY---------------------YGSEKDTSSKIEA------------
A0A1Z8RG47      YGYGYFRYKYYNKY---------------------YGKEKDEKAPVEKLTS---------
A0A1Z8RJJ5      YGYGYFRYKYYNKY---------------------YGKEKDEKAPVEKLTS---------
A0A2D7V631      YGYGYFRYKYYNKY---------------------YGKDKDEKPPVEKLTT---------
A0A354RA24      YGYGYFRYKYYNKY---------------------YGKDKDEKPPVEKLTT---------
A0A2E9RV62      YGYGYFRYKYYNKY---------------------YGKQGAEKAQ----GKNAKLS----
A0A2E4AY96      YGYGYYRYKYYNKY---------------------YGGSKSNTG----------------
A0A3B9B9P4      YGYGYYRYKYYNKY---------------------YGGSKSNTG----------------
A0A2D5Y6N6      YGYGYFRYKYYNKY---------------------YGRERDDEPSSPTVQGKESVS----
A0A2E7HSS8      YGYGYFRYKYYNKY---------------------YGKSDAEEKR----KSVSS------
A0A2D8VCK3      YGYGYFRYKYYNKY---------------------YGKSDAEEKR----KKKQAVS----
A0A350QVY4      YGYGYFRYKYYNKY---------------------YGKPDAEEKR----KNKQAVS----
A0A2E4ZYR7      YGYGYFRYKYYNKY---------------------YGGRGEDEKA----EKKAQAS----
A0A2E6TCV1      YGYGYFRYKYYNKY---------------------YGGKEGAESE----LPREKAS----
A0A3D4HHL8      -------YHRYGEY---------------------YTRREEPSPKVSKKMQAVSKT----
A0A366HV03      -------SSSY--Y---------------------YQAFEEDDVAGRSAPVSA-------
A0A6G6K911      -------SSSY--Y---------------------YQAFEEDDMPGRSAPASA-------
A0A5R8KAF2      -------YYYSASY---------------------YEDLEGVGAGGKAVV----------
A0A7C4LRZ6      -------NHYYHGY---------------------YNKGKSSASASLSPIALPGSKMAGR
A0A2V2SDN0      -------YQRYKDD---------------------YRWQPNVTTAA--------------
A0A1V6GL40      -------YYRYKDY---------------------YRPYPSGGTKTAESARTGQA-----
A0A2V5X6Z6      -------YQRYRRA---------------------YRWEPQKSGRV-ALAGNLSPNTTDR
A0A2V5VGZ7      -------YQRYRRA---------------------YHWEPKETRCATALAGHSAPDATDG
A0A2V5U130      -------YQRYRRA---------------------YRWEPKETRRATALAGHSAPDATGG
A0A2V6C237      -------YQRYRRA---------------------YHWEPKETRCATALAGHSAPDATDG
A0A3R8L982      -------YRSYKKY---------------------YGPRAA-------------------
A0A6N6QBS9      -------TYYYASY---------------------YHRPLTPDEGSYGSGDGTSGPGGAV
A0A2E7HPU9      -------LYKYGGYGGYGGYGGYGGYGGYGQYGGGYGSGSYGSYGSYGADEEEDD-----
A0A388PR45      -------DPSAGKY---------------------YVGESGAGPKA--------------
A0A388QR61      -------DPTAGKY---------------------YASDAGGPPSP--------------
A0A4P5YHI0      -------DPTAGKY---------------------YASDAGGPPSP--------------
A0A2A2RS01      -------DPANKKY---------------------YIDSEGSDSSG--------------
A0A2A2Y1A7      -------DPANKKY---------------------YIDSEGSDSSG--------------
A0A388PDH9      -------DPANKKY---------------------YIDAQDSDSSS--------------
A0A2G4H1E7      -------DSSYRKY---------------------YVDERGASSSPGPPKS---------
A0A2G4GZA6      -------DSSYRKY---------------------YVDETRSQAGADSTKS---------
A0A388P514      -------DSSYRKY---------------------YVDEPRGQSDAGSAKS---------
A0A2A2YG59      -------DSSYRKY---------------------YVDEPRGQSGAGSEKS---------
A0A2G4F7D5      -------DSSYRKY---------------------YVDEPRGQSGAGSEKS---------
D5EML0          -------PEKYKAY---------------------YRRSRSA------------------
A0A7C4PPJ4      -------NYYYHGY---------------------YRSRDRSASKTTGIPDVKPGKVMPP
A0A3C1C1M3      -------GPYYH-Y---------------------QKHYGAY------------------
A0A2E9EYJ1      -------TSYYT-Y---------------------YAPRNLDPDMESGSIGSPKPG----
A0A258AXR6      -------TSYYT-Y---------------------YSPTNSPNGGTGGKSRRRKIKAETT
A0A3D3NZQ6      -------TNYYT-Y---------------------YSPDNRP-AAEGGKPKKRRK-----
A0A1T4WVZ9      -------TSYYT-Y---------------------YSPNNTA-APAGTRPEKRKKQIPPS
A0A4R7SSI6      -------TSYYT-Y---------------------YSPNNTA-APAGHKPEKRKKQVAPG
A0A4P6PD26      -------HSYYSDY---------------------YHSSQSEVLDESGS-----------
A0A1Z8SVB5      YGYGYYRYKYYSKY---------------------YSPDXA-------------------
A0A2V5W3Y0      ----------YSEY---------------------YNTPLAVEEPDDVAAAHRHHQPRQI
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      V-----------------------------------------------------------
A0A2D5W0Q9      AGKDDEPSKA--------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      PKTEKSGGMEGLETKY--------------------------------------------
A0A257LYL4      PRS--QPAAKGDSELY--------------------------------------------
A0A4Q2XXY1      SRSGGKSSPKDDKDDY--------------------------------------------
A0A2V5U7A0      SFEKDPWPKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARNRFPKNRLH
A0A3D4CZT6      ESKVVANDSEEDEGLTY-------------------------------------------
A0A4V1S9Q4      QSPSRGNDSE-----LY-------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      TT----------------------------------------------------------
A0A2V6NH44      SS----------------------------------------------------------
A0A432FDF6      GKK-----DAKLLAKADIGGEDEKPKY---------------------------------
A0A522ACN3      AKK---------------AKVEIKPKY---------------------------------
A0A353DCA1      EKK--------------SERSSSEDLY---------------------------------
A0A3C1AXQ2      RRKKPTPAGQPSPGAAASSNAPRGDLF---------------------------------
A0A3D0IZR7      ATPAASVDEVVEHPLDTPEASAPKVTFIRPPRGQDRF-----------------------
A0A520LRZ3      KSSSEEVSIEDKF-----------------------------------------------
A0A356FSV4      IARET-------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      KQKY--------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      AKELAATQSHDSEDLY--------------------------------------------
R7E1V8          AKELAATQSHDSEDLY--------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      SKMKDHDFFSKKQKRPRRRNRRRPSRR---------------------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      GSSQSA------------------------------------------------------
A0A3D3NW23      GSSQAA------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      ------------------------------------------------------------
A0A290QD69      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      AAPKKESSIEISIQAAARKKAEETRSPNDFPALAPEPALEADKRKAELFKSRRAAKRRAK
A0A178IFJ2      ------------------------------------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      ------------------------------------------------------------
A0A1H2DTI1      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A1V5L462      K-----------------------------------------------------------
A0A3D3LGD3      PARTPGGDLF--------------------------------------------------
A0A350ARX4      ------------------------------------------------------------
B5JIS2          DDDNLEAVEANGKVAETAKSKLKSTPLKLNNKNSGSKSLIGKLMSEQEKKE---------
A0A6N6ZC77      ------------------------------------------------------------
A0A7C5H7K5      ------------------------------------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A2V2SMX4      ------------------------------------------------------------
A0A522AC27      ------------------------------------------------------------
A0A6M1RFD0      ------------------------------------------------------------
A0A7C3HXH0      ------------------------------------------------------------
A0A1H2GQN6      PGTTPPPTPPSQPDEF--------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      NRPITLAVATAVPPKSAQDFKLRRATQRKANLTLPGATAARPARDVTVTRT---------
A0A2A2RPW6      ------------------------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      KGSSSSDTSNDDLY----------------------------------------------
A0A354FSA6      KGSSSSDTSNDDLY----------------------------------------------
A0A3B9GA54      KSSSVSDTSNDDLY----------------------------------------------
A0A520LEH8      KGSSSSDTSNDDLY----------------------------------------------
A0A6B2M0T8      ------------------------------------------------------------
A0A2D7B7R6      ------------------------------------------------------------
A0A2E5K4P7      NLEQGSEAQA--------------------------------------------------
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      G-----------------------------------------------------------
A0A2V6EBU2      G-----------------------------------------------------------
A0A2V6EY06      G-----------------------------------------------------------
A0A2V6ME53      G-----------------------------------------------------------
A0A538NUU0      G-----------------------------------------------------------
A0A2V6NIJ1      TSQAQSS-----------------------------------------------------
A0A2V6C292      SDQAQSF-----------------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      RPIETQI-----------------------------------------------------
A0A2V5XFN9      KPIETA------------------------------------------------------
A0A2V6EZC8      KPIETA------------------------------------------------------
A0A2V6I7Z5      KPIETA------------------------------------------------------
A0A3B9LCP2      KPVETS------------------------------------------------------
A0A3C0R669      KHVQTS------------------------------------------------------
A0A2V6EID2      AKQPS-------------------------------------------------------
A0A2V6MHB0      AKQPS-------------------------------------------------------
A0A2W5YWL9      HQVQPS------------------------------------------------------
A0A2V5NH62      RQIQSS------------------------------------------------------
A0A2W6A620      KQIQSS------------------------------------------------------
A0A2V5PIJ4      KQIQSS------------------------------------------------------
A0A2V6K2G8      KPIETA------------------------------------------------------
A0A2V5W206      KPIETT------------------------------------------------------
A0A2V6MW77      KPMETT------------------------------------------------------
A0A6N4WVA3      ------------------------------------------------------------
A0A0R2XPB1      ------------------------------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ------------------------------------------------------------
A0A2G4GZN8      --------------GATDSDSAKS------------------------------------
A0A348NPT1      ELEDELAGSVEPEMEPRA------------------------------------------
A0A2E1KV60      DQSAGVDTAVAESDTNTDTDKLDS------------------------------------
A0A2D7F4D9      NQAIVADTFTETKTDSDSEDKLDS------------------------------------
A0A3R7RBR8      NQAIVADTFTETKTDSDSEDKLDS------------------------------------
A0A2E0NH28      DFEDQLVESTASGDEDTSEIARET------------------------------------
A0A350AS32      EFEEELAGSVEPTVDSKS------------------------------------------
A0A368BGT4      ELEDELVGDIETELESKS------------------------------------------
A0A6N6PLV8      REDY--------------------------------------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A290QE54      ------------------------------------------------------------
A0A1H1SWX2      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A4Q1C9I5      ------------------------------------------------------------
A0A2E6NAH3      ------------------------------------------------------------
A0A2A5VZA5      ------------------------------------------------------------
A0A424R295      ------------------------------------------------------------
B4CZV9          ------------------------------------------------------------
A0A1G3ZL71      ------------------------------------------------------------
A0A556QP09      ------------------------------------------------------------
A0A2T6DX88      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A3E1E5C8      ------------------------------------------------------------
B1ZZ74          ------------------------------------------------------------
A0A3B9FM17      ------------------------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------------------------------------
R7E4L8          ------------------------------------------------------------
A0A4Q3BVY2      ------------------------------------------------------------
A0A4P6PCA7      ------------------------------------------------------------
A0A2T6DSN5      ------------------------------------------------------------
A0A317ZIW7      ------------------------------------------------------------
A0A7C4PPT4      ------------------------------------------------------------
A0A7C4QZX4      ------------------------------------------------------------
A0A2D7WMI4      ------------------------------------------------------------
A0A2D6VHX5      ------------------------------------------------------------
A0A2D8I214      ------------------------------------------------------------
A0A1Z8VL41      ------------------------------------------------------------
A0A2E6TNA4      ------------------------------------------------------------
A0A1Z8RG47      ------------------------------------------------------------
A0A1Z8RJJ5      ------------------------------------------------------------
A0A2D7V631      ------------------------------------------------------------
A0A354RA24      ------------------------------------------------------------
A0A2E9RV62      ------------------------------------------------------------
A0A2E4AY96      ------------------------------------------------------------
A0A3B9B9P4      ------------------------------------------------------------
A0A2D5Y6N6      ------------------------------------------------------------
A0A2E7HSS8      ------------------------------------------------------------
A0A2D8VCK3      ------------------------------------------------------------
A0A350QVY4      ------------------------------------------------------------
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ------------------------------------------------------------
A0A3D4HHL8      ------------------------------------------------------------
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A5R8KAF2      ------------------------------------------------------------
A0A7C4LRZ6      RQSAVAGGNSRPTGGAG-------------------------------------------
A0A2V2SDN0      ------------------------------------------------------------
A0A1V6GL40      ------------------------------------------------------------
A0A2V5X6Z6      ------------------------------------------------------------
A0A2V5VGZ7      ------------------------------------------------------------
A0A2V5U130      ------------------------------------------------------------
A0A2V6C237      ------------------------------------------------------------
A0A3R8L982      ------------------------------------------------------------
A0A6N6QBS9      AAETVDPVAGKNGPGPRS------------------------------------------
A0A2E7HPU9      ------------------------------------------------------------
A0A388PR45      ------------------------------------------------------------
A0A388QR61      ------------------------------------------------------------
A0A4P5YHI0      ------------------------------------------------------------
A0A2A2RS01      ------------------------------------------------------------
A0A2A2Y1A7      ------------------------------------------------------------
A0A388PDH9      ------------------------------------------------------------
A0A2G4H1E7      ------------------------------------------------------------
A0A2G4GZA6      ------------------------------------------------------------
A0A388P514      ------------------------------------------------------------
A0A2A2YG59      ------------------------------------------------------------
A0A2G4F7D5      ------------------------------------------------------------
D5EML0          ------------------------------------------------------------
A0A7C4PPJ4      PRKTEVSR----------------------------------------------------
A0A3C1C1M3      --AQAVPPSLTPTGK---------------------------------------------
A0A2E9EYJ1      --SKLASXDQNNLSAEDKF-----------------------------------------
A0A258AXR6      ATALGSSQSVSRLDGDDVF-----------------------------------------
A0A3D3NZQ6      --AAGETAPARTPGG-DLF-----------------------------------------
A0A1T4WVZ9      RPGQATVASSSAPRG-DLF-----------------------------------------
A0A4R7SSI6      QVAKAVSAPSNGSRG-DLF-----------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      QSS---------------------------------------------------------
                                                                            

A0A432FAS4      -----------------------------------
A0A660Q3A0      -----------------------------------
A0A4Q3AQI1      -----------------------------------
A0A6N2CMN7      -----------------------------------
A0A2V5UAD5      -----------------------------------
A0A258AXL1      -----------------------------------
A0A2E6T1E0      -----------------------------------
A0A2D5W0Q9      -----------------------------------
A0A1Z9KB52      -----------------------------------
A0A7C5CZ90      -----------------------------------
A0A257LYL4      -----------------------------------
A0A4Q2XXY1      -----------------------------------
A0A2V5U7A0      ELFDRICEEILDDKLKNDFQQSMQEELRVL-----
A0A3D4CZT6      -----------------------------------
A0A4V1S9Q4      -----------------------------------
A0A355VK99      -----------------------------------
A0A2V6N5E0      -----------------------------------
A0A2V6NH44      -----------------------------------
A0A432FDF6      -----------------------------------
A0A522ACN3      -----------------------------------
A0A353DCA1      -----------------------------------
A0A3C1AXQ2      -----------------------------------
A0A3D0IZR7      -----------------------------------
A0A520LRZ3      -----------------------------------
A0A356FSV4      -----------------------------------
A0A3D3DET9      -----------------------------------
A0A355SVK9      -----------------------------------
A0A2E5D7I3      -----------------------------------
A0A2V5NYE2      -----------------------------------
A0A2V6FIP7      -----------------------------------
A0A353DI77      -----------------------------------
A0A1V6GCZ3      -----------------------------------
A0A3C1UJT2      -----------------------------------
A0A2S7U0Z3      -----------------------------------
A0A5E6MKA7      -----------------------------------
A0A6B3L936      -----------------------------------
A0A2N8IR72      -----------------------------------
A0A2N8IV96      -----------------------------------
R7E1V8          -----------------------------------
A0A2E0R252      -----------------------------------
A0A3E1EF48      -----------------------------------
A0A2A2PVG8      -----------------------------------
A0A2E0R421      -----------------------------------
A0A2E5EJ69      -----------------------------------
A0A2G4I5Z5      -----------------------------------
A0A4P5QQV6      -----------------------------------
A0A1T4WWY4      -----------------------------------
A0A3D3LEQ6      -----------------------------------
A0A3D3NW23      -----------------------------------
A0A2E7ALI1      -----------------------------------
A0A178IDB9      -----------------------------------
A0A290QD69      -----------------------------------
A0A2E7VDS1      -----------------------------------
A0A7C8D3W3      FIEISLGSEEHFQSAPLPSPTVFEEREPEMSSKQA
A0A178IFJ2      -----------------------------------
A0A357FSP9      -----------------------------------
A0A2A2R174      -----------------------------------
A0A1H2DTI1      -----------------------------------
A0A1H1MGC9      -----------------------------------
A0A1V5L462      -----------------------------------
A0A3D3LGD3      -----------------------------------
A0A350ARX4      -----------------------------------
B5JIS2          -----------------------------------
A0A6N6ZC77      -----------------------------------
A0A7C5H7K5      -----------------------------------
A0A538NJ59      -----------------------------------
A0A2A2R3V9      -----------------------------------
A0A3C1VFY9      -----------------------------------
A0A2V2SMX4      -----------------------------------
A0A522AC27      -----------------------------------
A0A6M1RFD0      -----------------------------------
A0A7C3HXH0      -----------------------------------
A0A1H2GQN6      -----------------------------------
A0A512M3Y3      -----------------------------------
A0A4P5R5J1      -----------------------------------
A0A4P5YK43      -----------------------------------
A0A2A2RPW6      -----------------------------------
B1ZT68          -----------------------------------
W0J7C2          -----------------------------------
B4D1I7          -----------------------------------
A0A353F286      -----------------------------------
A0A354FSA6      -----------------------------------
A0A3B9GA54      -----------------------------------
A0A520LEH8      -----------------------------------
A0A6B2M0T8      -----------------------------------
A0A2D7B7R6      -----------------------------------
A0A2E5K4P7      -----------------------------------
A0A2V6F9Q9      -----------------------------------
A0A2V6NZZ3      -----------------------------------
A0A2V6EBU2      -----------------------------------
A0A2V6EY06      -----------------------------------
A0A2V6ME53      -----------------------------------
A0A538NUU0      -----------------------------------
A0A2V6NIJ1      -----------------------------------
A0A2V6C292      -----------------------------------
A0A2V6D2X0      -----------------------------------
A0A2V5ZUK1      -----------------------------------
A0A2V5XFN9      -----------------------------------
A0A2V6EZC8      -----------------------------------
A0A2V6I7Z5      -----------------------------------
A0A3B9LCP2      -----------------------------------
A0A3C0R669      -----------------------------------
A0A2V6EID2      -----------------------------------
A0A2V6MHB0      -----------------------------------
A0A2W5YWL9      -----------------------------------
A0A2V5NH62      -----------------------------------
A0A2W6A620      -----------------------------------
A0A2V5PIJ4      -----------------------------------
A0A2V6K2G8      -----------------------------------
A0A2V5W206      -----------------------------------
A0A2V6MW77      -----------------------------------
A0A6N4WVA3      -----------------------------------
A0A0R2XPB1      -----------------------------------
A0A348NQP1      -----------------------------------
A0A357FV58      -----------------------------------
A0A2G4GZN8      -----------------------------------
A0A348NPT1      -----------------------------------
A0A2E1KV60      -----------------------------------
A0A2D7F4D9      -----------------------------------
A0A3R7RBR8      -----------------------------------
A0A2E0NH28      -----------------------------------
A0A350AS32      -----------------------------------
A0A368BGT4      -----------------------------------
A0A6N6PLV8      -----------------------------------
A0A2E0V4K6      -----------------------------------
A0A290QE54      -----------------------------------
A0A1H1SWX2      -----------------------------------
A0A1D8AZK8      -----------------------------------
A0A4Q1C9I5      -----------------------------------
A0A2E6NAH3      -----------------------------------
A0A2A5VZA5      -----------------------------------
A0A424R295      -----------------------------------
B4CZV9          -----------------------------------
A0A1G3ZL71      -----------------------------------
A0A556QP09      -----------------------------------
A0A2T6DX88      -----------------------------------
A0A2T6CWI7      -----------------------------------
A0A3E1E5C8      -----------------------------------
B1ZZ74          -----------------------------------
A0A3B9FM17      -----------------------------------
A0A0E3YV65      -----------------------------------
W0J900          -----------------------------------
R7E4L8          -----------------------------------
A0A4Q3BVY2      -----------------------------------
A0A4P6PCA7      -----------------------------------
A0A2T6DSN5      -----------------------------------
A0A317ZIW7      -----------------------------------
A0A7C4PPT4      -----------------------------------
A0A7C4QZX4      -----------------------------------
A0A2D7WMI4      -----------------------------------
A0A2D6VHX5      -----------------------------------
A0A2D8I214      -----------------------------------
A0A1Z8VL41      -----------------------------------
A0A2E6TNA4      -----------------------------------
A0A1Z8RG47      -----------------------------------
A0A1Z8RJJ5      -----------------------------------
A0A2D7V631      -----------------------------------
A0A354RA24      -----------------------------------
A0A2E9RV62      -----------------------------------
A0A2E4AY96      -----------------------------------
A0A3B9B9P4      -----------------------------------
A0A2D5Y6N6      -----------------------------------
A0A2E7HSS8      -----------------------------------
A0A2D8VCK3      -----------------------------------
A0A350QVY4      -----------------------------------
A0A2E4ZYR7      -----------------------------------
A0A2E6TCV1      -----------------------------------
A0A3D4HHL8      -----------------------------------
A0A366HV03      -----------------------------------
A0A6G6K911      -----------------------------------
A0A5R8KAF2      -----------------------------------
A0A7C4LRZ6      -----------------------------------
A0A2V2SDN0      -----------------------------------
A0A1V6GL40      -----------------------------------
A0A2V5X6Z6      -----------------------------------
A0A2V5VGZ7      -----------------------------------
A0A2V5U130      -----------------------------------
A0A2V6C237      -----------------------------------
A0A3R8L982      -----------------------------------
A0A6N6QBS9      -----------------------------------
A0A2E7HPU9      -----------------------------------
A0A388PR45      -----------------------------------
A0A388QR61      -----------------------------------
A0A4P5YHI0      -----------------------------------
A0A2A2RS01      -----------------------------------
A0A2A2Y1A7      -----------------------------------
A0A388PDH9      -----------------------------------
A0A2G4H1E7      -----------------------------------
A0A2G4GZA6      -----------------------------------
A0A388P514      -----------------------------------
A0A2A2YG59      -----------------------------------
A0A2G4F7D5      -----------------------------------
D5EML0          -----------------------------------
A0A7C4PPJ4      -----------------------------------
A0A3C1C1M3      -----------------------------------
A0A2E9EYJ1      -----------------------------------
A0A258AXR6      -----------------------------------
A0A3D3NZQ6      -----------------------------------
A0A1T4WVZ9      -----------------------------------
A0A4R7SSI6      -----------------------------------
A0A4P6PD26      -----------------------------------
A0A1Z8SVB5      -----------------------------------
A0A2V5W3Y0      -----------------------------------
                                                   

© 1998-2021Legal notice