BYKdb

Dataset for cluster orphancd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

187 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      MDIDPFADDDKEYRSTGAEEPVVS------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      MKKEIDPFDDTLAEGDAHDEGARVS-----------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A1T4WWY4      MNSKTQPSGKDSKLD---------------------------------------------
A0A3D3LEQ6      MNPRQSSNSQKGKLD---------------------------------------------
A0A3D3NW23      MNPRQSSKSQKGKLD---------------------------------------------
A0A2E0R252      MNEVDPPQNGYGNEAPASN-----------------------------------------
A0A3E1EF48      -----------------MA-----------------------------------------
A0A2A2PVG8      ---MSRSYAPDSDANETGQ-----------------------------------------
A0A2E0R421      -MIDHHQQPLEENLHSNPQ-----------------------------------------
A0A2E5EJ69      MDFPESHDLGQQTQVEK-------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      MSKPVQAQTRSTAHRSAARVPDQAQAGGNLA-----------------------------
A0A290QD69      MSKSTKS---SSGKRGSSEQPQTKPAGGG-------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      MAETFSKKPVPAAGAWPPQSSSPFGEPPPFAGGSLP------------------------
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      MTHSNLPVPASEYPLAGPMDQDANLLP---------------------------------
A0A3C1VFY9      --------MKEDSALTAPDRHAWGRKF---------------------------------
A0A522AC27      --------MNEPTPTPTHDRSSWAARF---------------------------------
A0A2A2R174      MDQYSQTQVGDTSSDHG-------------------------------------------
A0A1H2DTI1      MEPIPPSAPGTPGGFPPPQAPSSPMTAAMSQAGGRVPGTF--------------------
A0A1V5L462      MQDDFLESSGREGGHTDLGETL--------------------------------------
A0A2A2R3V9      ----MSSITPPPTLSSWSAAF---------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      MILSVWRSESLPSDPNNFSSSYDLDESSGSLDWGERL-----------------------
B5JIS2          MAHSETKKSLRPHASAGYGASGSRNSNTEDTLAGV-------------------------
A0A1H2GQN6      ------------------------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ----------MSLPTSQLPAGTSAINRV--------------------------------
A0A4P5YK43      ---MASSHASLELPPPNQGTSLVDRINI--------------------------------
A0A2A2RPW6      MQTTEDVTQQSPIGGLS-------------------------------------------
B4D1I7          MDAHPAATPARDQDAASWWYLI--------------------------------------
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ------------------------------------------------------------
A0A3B9GA54      ------------------------------------------------------------
A0A520LEH8      ------------------------------------------------------------
A0A6B2M0T8      MSNQQYESNPNSSQRNSGNSISS-------------------------------------
A0A2D7B7R6      ------------------------------------------------------------
B1ZT68          MPTSKKPAADRRNP--QANTGF--------------------------------------
W0J7C2          MTTTDTTAGNRPSPGRPRAASI--------------------------------------
A0A2E5K4P7      --------MDSEPPEDSSNSSYRGYRYY--------------------------------
A0A0R2XPB1      MDDLFQDENNTKTVDYTELF----------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      MDDLFQDEQNTKTVDYTELF----------------------------------------
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6EBU2      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6EY06      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6ME53      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A538NUU0      ----MNAPLERPGAAPWSTAF---------------------------------------
A0A2V6NIJ1      ----MNPPPVRPAAAPWSTAF---------------------------------------
A0A2V6C292      ----MNPPPERPAAAPWSTAF---------------------------------------
A0A2V6D2X0      ----MNPPPERPAAAPWSTAF---------------------------------------
A0A2V5ZUK1      --MQVAATRLQNLSTSWSAAF---------------------------------------
A0A2V5XFN9      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A2V6EZC8      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A2V6I7Z5      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A3B9LCP2      ---MQASAAERSTPASWSTAF---------------------------------------
A0A3C0R669      ---MQASAAERSTPASWSTAF---------------------------------------
A0A2V6EID2      -MQAPIPAVERSTPAAWSNTL---------------------------------------
A0A2V6MHB0      -MQAPIPAVERSTPAAWSNTL---------------------------------------
A0A2W5YWL9      ----MNALAERTNPGSWSTAF---------------------------------------
A0A2V5NH62      MPAPAPATTDRPVSAPWSTAF---------------------------------------
A0A2W6A620      --MPAPAATDRPASAPWSTAF---------------------------------------
A0A2V5PIJ4      ---MGNAAPDHPVSPIWTTKF---------------------------------------
A0A2V6K2G8      ---MQPSTAVKNLSTSWSAAF---------------------------------------
A0A2V5W206      ---MQATTAGKNLSTSWSTVF---------------------------------------
A0A2V6MW77      ---MQVATVGKNLSTSWSAAF---------------------------------------
A0A2G4GZN8      MPTPDPSSDNRPPEPSREGNPGYGSYGQGYGQGYGQGYGQGYGAYGAGNY-------RGG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      ------MKNDYS-DNNMGNDNSYGNYGNYAPGN---QY-NQYNSYRYGGGGNYGNYGNYG
A0A2D7F4D9      ------MKNDYTGDQSNMNSNHYGGYSNNYGNP---QY-YNHGSYRYGGN------SGSG
A0A3R7RBR8      ------MKNDYTGDQSNMNSNHYGGYSNNYGNP---QY-YNHGSYRYGGN------SGSG
A0A2E0NH28      ------MKNDYVRGGPDPNTS-----------G---RYGYSSGNYGYNGS----------
A0A350AS32      ------MKNDYVRGAPDPNSGGYG--------G---GYGYG-GGYGYG-G----------
A0A368BGT4      ------MKNDYVRGAPDPNSGGYGSGGYGYGSG---GYGYGNGGYGYGNG----------
A0A2E0V4K6      MSARRLAGAGRELPDEDEVLEFPGR-----------------------------------
A0A2E6NAH3      -------MKNDYIRGAPDPNSGGYGGSGYGYGG------------GNYGYGGSNYGYGGG
A0A2A5VZA5      -------MKNDYIKGGGDPNSGGYG-YGYGYSG------------GS--------GYSYG
A0A424R295      -------MKNDYIKGGGDPNSGGYG-YGYGYSG------------GS--------GYSYG
B4CZV9          -----MIPGTKKPAFT--------------------------------------------
A0A290QE54      -------MSDSPLNPSNASQSG-------DQLV------------E--------------
A0A1H1SWX2      -----MSAPDAPLPTAPARAPGPSLHGNDQQVV------------E--------------
A0A4Q1C9I5      -----MSSPDFS-PHSASVKHGASLHGNEPHVS------------E--------------
A0A3B9FM17      ------------------------------------------------------------
A0A1G3ZL71      -----MPSPLAIPAAPAKPSASTRAPQGGEEHL------------VE-------------
A0A556QP09      ------MSSVQKPSSATKVSGR-------DEEI------------IE-------------
A0A2T6DX88      -----MNDLQAKHP--SLHTAQ-------GEVL------------NE-------------
A0A2T6CWI7      -----MADANAKPPPPPPVDHD-------DETV------------SE-------------
A0A3E1E5C8      -----MPDHTARPF--PPAHDK-------EEPA------------VE-------------
B1ZZ74          -----MSLAEAKPAVQPGGARD-------EETL------------VE-------------
R7E4L8          -----MPVSVIQPEDND-------------------------------------------
A0A4Q3BVY2      -----MSNSSDKPKFD--------------------------------------------
A0A4P6PCA7      -----MFSGNEPPPVYGASHTPPPVDPANPYGA------------AHQPAPFNLKGGG--
A0A0E3YV65      ------------------------------------------------------------
W0J900          -----MAEIPFTKTGPDTGPLHPRPSAPRSEPP------------FEGGSLP--------
A0A2T6DSN5      -----MAKASKTTPSKRNEAQSPTKGFN--------------------------------
A0A2V2SMX4      -----MNQPGAIETVSTTQHQHAWRARF--------------------------------
A0A317ZIW7      --------MSDLFNDDNQAGKVDYAEIL--------------------------------
A0A2D7WMI4      ----------MDENEIGSLSQNPPNQKV--------------------------------
A0A2D6VHX5      ----------MDLEENSNYGDYSPKSKK--------------------------------
A0A2D8I214      --------MEEEIENLNSQGSVRSKSKT--------------------------------
A0A1Z8VL41      --------MDDNFEDIDRPLSTKPKGRI--------------------------------
A0A2E6TNA4      --------MDDNLEDIDRSLSTKPKGRV--------------------------------
A0A1Z8RG47      --------MDDEIDTTEIHSGGRSKSNI--------------------------------
A0A1Z8RJJ5      --------MDDEIDTTEIHSGGRSKSNI--------------------------------
A0A2D7V631      --------MDDDIDSISVNAGGKPKSRI--------------------------------
A0A354RA24      --------MDDDIDSISVNAGGKPKSRI--------------------------------
A0A2E9RV62      -------MDSYSNPDPSQEIIQPASRSR--------------------------------
A0A2E4AY96      --------MDQEHPESFKN---QGDTIK--------------------------------
A0A3B9B9P4      --------MDQEHPESFKN---QGDTIK--------------------------------
A0A2D5Y6N6      --------MDDNFNKMTGDGGASPTGSK--------------------------------
A0A2E7HSS8      --------MEEDFDNFSTP-PQPKGKPK--------------------------------
A0A2D8VCK3      --------MEEDFDNFSSS-PVQKGKSK--------------------------------
A0A350QVY4      --------MEEDFDNFSSP-PVQKGKSK--------------------------------
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      -----MNESLEELDGTSSHVPSGAPGPK--------------------------------
A0A3D4HHL8      -----MTAPPTKSPRYDDVEPKIEWSELI-------------------------------
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A5R8KAF2      ---------MDTTKKKFDFAAAVGNALSYAQHG------------RL-------------
A0A2V2SDN0      -----MENQNHNEPAKANNQLTTPALDLMAPPD------------HF-------------
A0A1V6GL40      ---------MNDQP------VQSFHDRPNTAAR------------LH-------------
A0A2V5X6Z6      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A2V5VGZ7      -----MNDNNHNQPNTPAVDLFAPANRFVSASR------------LY-------------
A0A2V5U130      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A2V6C237      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A3R8L982      --------MPDTTNNRPPPSAKLH------------------------------------
A0A2E7HPU9      -----MRRKKYYEHDEELDLLDEEDGLG-------------------------------G
A0A388PR45      ------MDTPSPKPGQPPEDPSRG-PRGYGSYG------------SY----GGY-----A
A0A388QR61      ------MDAPAPKPGQPQDDAQRG-PRGYGSYG------------NY----GNYGGPA-G
A0A4P5YHI0      ------MDAPAPKPGQPQDDAQRG-PRGYGSYG------------NY----GNYGGPA-G
A0A2A2RS01      -----MAEKTQKPEDDQDDSAARG--RGYGSYG------------NYGNYGGNYGGNYGG
A0A2A2Y1A7      -----MAEKTQKPEDDQDDSAARG--RGYGSYG------------NYGNYGGNYGGNYGG
A0A388PDH9      -----MAETPQKPEDNQDDSASRA--RGYGSYG------------NY----GNYGGAYGG
A0A2G4H1E7      ------MANPEPSSDNRPPEPARGGNRGYGSYG------------SY----GQYGQGY-G
A0A2G4GZA6      ------MPNPDPLSDNRPPEPARGGNRGYGSYG------------SY----GNYGAAN-G
A0A388P514      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
A0A2A2YG59      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
A0A2G4F7D5      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
D5EML0          --------------------------------M------------GK----DDFTIEANA
A0A3C1C1M3      -----MTQPNFPPSNLPPASGQPPGAPIYYGGG------------DP----YSGGMPMDS
A0A2E9EYJ1      ---------------------------------------------------------MAK
A0A258AXR6      --------------------------------------------------------MNES
A0A3D3NZQ6      --------------------------------------------------------MSEA
A0A1T4WVZ9      --------------------------------------------------------MRET
A0A4R7SSI6      --------------------------------------------------------MRDT
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ----------------------NRIGISNVRQALSRWWIMLIFGVLGYFAALYYM-SINP
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      ----------------------NRSAAGLLRVALERWWLILIFMVLGYVGALYYL-SVKE
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A1T4WWY4      ----------------------GSSIIRTVLAYEDYWRLMIILVLIGLLGGTCYF-IYAR
A0A3D3LEQ6      ----------------------SSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYAR
A0A3D3NW23      ----------------------SSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYAR
A0A2E0R252      ----------------------GKGIKDYVRWFLRRFWIFLITCLGGYFLGLYVA-SLTP
A0A3E1EF48      ----------------------TKTFADYLNWLKRYAWIAVLTTITGTFYGFYLF-TITP
A0A2A2PVG8      ----------------------SRGLQDYLRWFLRRFWIFLIAVVGGYFLGLYLY-SVTP
A0A2E0R421      ----------------------ARGLQDYVRWFIHRFWILPITIVSGILIGHYVY-THTP
A0A2E5EJ69      ----------------------EFSLRDSVDVVLDHAWLIILIFAACFGGAYYYL-KTAT
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------MLLRKYWWVVAFGVALGTGIAAWLV-ASQK
A0A2E7ALI1      --------------------PPASYLPDWITGFLNRG-----------------------
A0A178IDB9      ----------------------HFSPRNLLNMFLERWWIGLIAGAAIATVFILAQ-PKLA
A0A290QD69      -----------------------FSPKSLLNMFLERWWIGLIVAAAVAAAFVLSQ-PKPE
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      ----------------------RLDIRQILLCIRERWIVAVSLAILVCVLLGVWL-LNQP
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      ----------------------SFRIQRFFTFLLKYWWVPVLTLALSLGGAIWYF-FWEP
A0A3C1VFY9      ----------------------FSRVQRYRNLLLRRWWVLVVCLVLALGIEAVHI-QFTP
A0A522AC27      ----------------------HSRVYRYKRLLKQRWWIPFSCVFIALVIQGALS-WFAP
A0A2A2R174      ----------------------MSLNRELWQVLVEKAWLIACIMAAAAAIGVWVG-VRSP
A0A1H2DTI1      ----------------------MSRLHRYKLLVKKFWWILLFCTAVGIAIQAYKI-AHEV
A0A1V5L462      ----------------------RSLSHRARLLLQSYWWILLLCLSIGLLVQAVRV-KSMR
A0A2A2R3V9      ----------------------FTKLHRYRALVKRRWYVPLLTLSVGLCIQAYRF-AQIQ
A0A3D3LGD3      --------------------------------------------------------MKIE
A0A350ARX4      ----------------------QRIYFESKRLLAIWWWIVLLAVAIGIGWQAYRE-LNRE
B5JIS2          ----------------------VTQIRSFFAIIRSRWLSGVVSALVVGSAFAYLF-LNDK
A0A1H2GQN6      --------------MSVSESIDLPHFNDYWRVIRARFGIILTLFILTFGTGYFVSAFVLQ
A0A512M3Y3      ------------MQKGKKLIITFQDVFLFLTRFVKHWKIASLLFSLGLAASLLYY-TYGR
A0A4P5R5J1      ----------------------RVQGIRYVYLLKKRWWVLVLLLSLGLCIGAWTA-MQQP
A0A4P5YK43      ----------------------SIHFRRYFKIISRRWWIPFLLVLVGTGIALYVA-LTTP
A0A2A2RPW6      ----------------------SVALRDFWQALLDKAWLVVCIMLAAAALGVWHG-ARSP
B4D1I7          ----------------------HTKIYRYRALLRKYWWMVLFTTCAGMAIGAWML-AHQQ
A0A353F286      ---------------------------------------------------------MIP
A0A354FSA6      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A3B9GA54      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A520LEH8      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A6B2M0T8      ----------------------EKSWLDYLFVIREHWMLALLVALSVSGFYAYKK-LQTV
A0A2D7B7R6      -----------------METGNTNSPQDILRSAKSHYAIVLIIIVACTFTAYMQT-RKMT
B1ZT68          ----------------------RITPRDLLQMFQERWLLGLFLGAIAAGVFVYFQ-PEKV
W0J7C2          ----------------------RRTPRDFLDMFAERWWIGALAGAAAAALIVVFR-PHFE
A0A2E5K4P7      ------GGYGYNYGGYDAEPQEHRSLKDYIIIFRERFWLFLFCFAIIITGVLLYT-LKKP
A0A0R2XPB1      ----------------------QQIVYRAKIVLRRYWWVIPLAITLGVSYKAVES-FVAD
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ----------------------QQIVYRAKIVLRRYWWIIPLAIALGVTYKAVES-FVAD
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6EBU2      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6EY06      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6ME53      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A538NUU0      ----------------------FTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6NIJ1      ----------------------FTRLYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6C292      ----------------------FTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6D2X0      ----------------------FTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V5ZUK1      ----------------------ITRLHRYKSLLLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V5XFN9      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V6EZC8      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V6I7Z5      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A3B9LCP2      ----------------------ITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTP
A0A3C0R669      ----------------------ITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTP
A0A2V6EID2      ----------------------ITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMP
A0A2V6MHB0      ----------------------ITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMP
A0A2W5YWL9      ----------------------ITRIHRYKSLLKRRWWIPLLTICLGLFVQSWLI-FQTP
A0A2V5NH62      ----------------------ITRLHRYKALLQRRWWIPVLTICLGLFVQAWFI-YQTP
A0A2W6A620      ----------------------ITRLHRYKSLLQRRWWIPVLTICLGLFVQSWLS-YQTP
A0A2V5PIJ4      ----------------------VTRFHRYRALLLRRWWILLLTVCMGLFVQAWMV-YQRA
A0A2V6K2G8      ----------------------VTRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V5W206      ----------------------ITRLHRYKSLFLRRWWIPVLTTCLGLFVEAFLI-YQMP
A0A2V6MW77      ----------------------ITRLHRYKALFLRRWWIPVLTTCLGLFVEAFLI-YQMP
A0A2G4GZN8      NYGGGNYGYGNNPGYGKGGAGESNPIQNYLLMLKERYWWILLASLVFLTLSLLNT-YNVV
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      NYGY--GSYGQNADEQG----PQRTFKDYLFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A2D7F4D9      SYGY--GSYGNVSEEQG----PQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A3R7RBR8      SYGY--GSYGNVSEEQG----PQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A2E0NH28      NYGY--GSYGSNSSGYG--TIAQRSISDYFLMLRERVWYLVVAFFIIFSGSILYT-FNKT
A0A350AS32      GYGYG-GGYGAGGGYEGGSSAPQRSFKDYLLMFRERVWYLIVAFFIIFSGSILYT-FNKT
A0A368BGT4      GYGYGTGGYGGYGGGYGGGAGPQRSFKDYFLIFRERIWYLLVSFFIIFSGTIMYT-FNKT
A0A2E0V4K6      ----------------------ARGLPKVFWEMLGKWYFPVMGAILGLFASAYYL-KKTP
A0A2E6NAH3      NYGFGGGYGDGGAGP-------QRSFKDYLLMFRERIWYLIVSLFIIFSGSILYT-FNKT
A0A2A5VZA5      NYGYGGYGGGGEQAP-------QRSIKDYILIFRERIWWLIVSFFIIFSGSLLYT-FNKT
A0A424R295      NYGYGGYGGGGEQAP-------QRSIKDYILIFRERIWWLIVSFFIIFSGXLLYT-FNKT
B4CZV9          ----------------------LHDIFLYVAIASKHARLMVLLICFALTAGLTYY-VFAK
A0A290QE54      ----------------------RRTIRDYLIILRERLWIALPLALLVAVGFGYWK-ARAV
A0A1H1SWX2      ----------------------KRSLRDYYVILRERLWIALPVALLVALSIGYYQ-AQEI
A0A4Q1C9I5      ----------------------RRTLRDYYIMLRERLWIALPVAVIVALGFGYVK-STET
A0A3B9FM17      ------------------------------------------------------------
A0A1G3ZL71      ----------------------RRTLRDYYVIIRERLWIALPLALLVSLGLGYWK-MRET
A0A556QP09      ----------------------RRTLRDYYIILRERLWIALPLALVISIGMAYYQ-SRAT
A0A2T6DX88      ----------------------RRTARDYLIILRERVWIALPIGILVGVILGYLQ-ARVT
A0A2T6CWI7      ----------------------RRTLRDYYIMLRERLWIALPLALLVAVGYAYKN-LQET
A0A3E1E5C8      ----------------------RRSLRDYYIILREKLWIALPLALLVSLSLGYYE-ASRP
B1ZZ74          ----------------------RRGLRDYYIILRERLWIALPLALLVAVPLGYFR-ARET
R7E4L8          ----------------------IFSFRFIFSTARRYWPWILACALLGGGLAYFIC-ARQG
A0A4Q3BVY2      ----------------------PLRLISQVLSYAKHVRLMLLMLAVGVMAGIIVY-LFTT
A0A4P6PCA7      ----------------------GFKPMRLLFVVLRRWYIPVIFGLIGIAVGILRA-LYAV
A0A0E3YV65      -----------------------MSPREILLSIRERALTSFVLALLICSLLGGWL-LSRP
W0J900          ----------------------RLDIRQILLCIRERWIVSTSLATLVCVLLGVWL-LKQP
A0A2T6DSN5      -----------------------FSPRSLLNMFLERWWIGLIAGALGAVAFVLAQ-PKQD
A0A2V2SMX4      ----------------------FTRLQRLRGLLLAKWWIPALGVALGVGIQASRS-ITEK
A0A317ZIW7      ----------------------HKSIYRTKIVLKRFWWVLPVAVSLGVAYKAIES-FLEA
A0A2D7WMI4      -----------------------KGISDFLLILRDRWMLSLTLALPIALGFTYKS-LQVP
A0A2D6VHX5      ----------------------NKTVSEFLLILRDRWLLAVTLALPFSLAYVYKE-LQVP
A0A2D8I214      -----------------------KSIAEILLVIRDRWLLALSLALPISLGYVYLK-FQDT
A0A1Z8VL41      -----------------------RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVP
A0A2E6TNA4      -----------------------RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVP
A0A1Z8RG47      -----------------------KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSP
A0A1Z8RJJ5      -----------------------KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSP
A0A2D7V631      -----------------------KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGP
A0A354RA24      -----------------------KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGP
A0A2E9RV62      ----------------------LRGVFDYFLIIRDRWLLATALSLPIALGFVYKE-YQQP
A0A2E4AY96      ----------------------VRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVP
A0A3B9B9P4      ----------------------VRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVP
A0A2D5Y6N6      ----------------------IKGIGDFILILRDRWLIALTLSLPXALAYIYVK-SQGI
A0A2E7HSS8      ----------------------IKGVSDFLLIIRDRWLLSLALSLPFALGFVFVK-QQVH
A0A2D8VCK3      ----------------------IKGLSDFLLIVRDRWLLAIALSLPCALLWVFYK-QQEP
A0A350QVY4      ----------------------IKGLSDFLLIIRDRWLLAIALSLPCALFWVFYK-QQEP
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ----------------------LKGVIEYLLIIRDRWLLAIALSLPISLWYVYDR-YQEP
A0A3D4HHL8      ----------------------HVWLFRAKLLLKRFWWVFLITISLGVAFQTYDV-LITP
A0A366HV03      ------------MSAPIKKGAPGVDMLHYAVGYLKYGRMMILLLLLGVLAGVCYY-TYSP
A0A6G6K911      -------------------------MLHYAVGYLKYGRMMILLLLLGVLAGVCYY-VYSP
A0A5R8KAF2      ---------------------------------------MVIMACLGVLAGLCYF-VYTT
A0A2V2SDN0      ----------------VATSRLFVRLHRHQVLLREYWWVLALILLVTVVPALVIT-LATP
A0A1V6GL40      -----------------------ARLSRFRNLLREKWWVLVLGAMAGAIIKIVLL-WNAP
A0A2V5X6Z6      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSL
A0A2V5VGZ7      -----------------------GRLHRWWLLLRRYWWLIVLILVLGLGPAGFLS-FNSP
A0A2V5U130      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGVLS-FNSL
A0A2V6C237      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSL
A0A3R8L982      --------------SGDDDLVERRTLRDYYIIVRERLWIALPLALLAALGYAYYK-SREL
A0A2E7HPU9      GTSR------------------RARTRQLIGDILVRWHWMALGLVLGLLGSFYYL-SKAP
A0A388PR45      GYGAPGYGNYGNYAAGGASGGKGGPFTVYLAMLRERWWWVLLSVLVFVTIAVVYT-STII
A0A388QR61      GYGAGGYGAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIV
A0A4P5YHI0      GYGAGGYGAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIV
A0A2A2RS01      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTM
A0A2A2Y1A7      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTM
A0A388PDH9      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLLGVTIALVLT-YQTM
A0A2G4H1E7      AYGA-GYGSYGGGPRGGAGG--ASPISNYLLMLRERYWWVLLTSLVFLTLSLLNT-YNTV
A0A2G4GZA6      GYGY-GNGNYGAYNRGGAGE--GNPIQNYLLMLRERYWWILLSTLVFLTLSLLNT-YNTV
A0A388P514      GYGY---GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
A0A2A2YG59      GYGY---GNYGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
A0A2G4F7D5      GYGY---GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
D5EML0          STTS------------------VFGLTDLLAVVRKHWMSGAFIGLVVAGLFVASV-LTKE
A0A3C1C1M3      GPLQ------------------SLNPMRLLQIARNHWVILLLA--ILFAGGAAAF-YLSR
A0A2E9EYJ1      QSET------------------KLHALDYWQVAXNRYAVILLTXALVXMTALVIA-YLRP
A0A258AXR6      GTEL------------------QKHAMDTWQVVKNRFGLIALSFLLIFAAAAVLT-YIMP
A0A3D3NZQ6      SPDL------------------QNHALDSWRVIRGRAGLIILSFLLVFGSAAMLT-YIMP
A0A1T4WVZ9      SNEL------------------QQQALDSWQVIRNRFGLIILSFLLVFATAAIIT-YIMP
A0A4R7SSI6      GNEL------------------QQQAIDSWQVIRNRFGLIILSFLLVFATAAIIT-YIMP
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ----------------------------------DLEDLESVGYVDAASEKARPDNLTNE
A0A2S7U0Z3      PSSEAIAVLEVNIQTGQ-----------LLGQDLVQERMTPDIILATEASKLMGPAILSA
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      PETMAMASLKVTTKQQLL----------VGNEVEQDSMVFRDQMLGTIAAELVGLEQLQK
A0A2N8IR72      ----------------------------------------MTDAWNGKAVIVRHSPVLET
A0A2N8IV96      ---------------------------------MVATSNVTANYIPMQYSVLTSAEVLKV
R7E1V8          ---------------------------------MVASSNVTANYIPMQYSVLTSTEVLKV
A0A1T4WWY4      ATYESQALIRANSFLMS-----------SEAAVGNANADRTYRQMRALMDQLNSGYVILE
A0A3D3LEQ6      ATFESTALIRINQFVDA-----------AKAASG-AQRDNNIALMRSLSKQLTSDFYQLE
A0A3D3NW23      ATFESTALIRINQFVDA-----------AKAASG-AQRDNNIALMRSLSKQLTSDFYQLE
A0A2E0R252      VTYQSQATIEIERVKKED----------ADVDEEERIRMGGASEMFSVTEKLRLPNLYTN
A0A3E1EF48      KTYQSWTSIQIARVKQEA----------ADVAEEERIRLGVPAELQATLEKLRMPRIYQN
A0A2A2PVG8      PTYQSSATIEILRVKRDA----------ADIAEEEKIRMTGAAEMLSASERIRLPQIYVE
A0A2E0R421      HTYQSSATIEVLRIKKDD----------ADVDEDEVLRMNGVAEMMSASEKLRMPALYTQ
A0A2E5EJ69      VIYESRATIIVEFAGPTVS---------YDQNSRNDFRLMRFDILNTMAQTVGRREVIDR
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      QIYMSQARMMVSGK--------------INLPEGGSFSEEMTHFMNTQGELMKDEAIRTR
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      PVYRSEVKLLFEPQKDQV----------IGIKEVVDTTTTSNLQLNLHIEQMLSTTFYEY
A0A290QD69      PIYKTEVKLLFENQKDNV----------IGMAGVVETTTNSGMQLQLHIEQMLSRTFYES
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      KVFQASATLLVDRAEKVLGNEM------TKVVDDSVGGSKNDPSFDTHLAQITSREMVQR
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      PTYVSKSRMWETVT--------------LRLPEGAMFSEDMQNFLGTQSELLESGQLRQL
A0A3C1VFY9      PEFISVGQMIVSIK--------------VNIQQGSLYTEELGNFLGTQAALMQGNEVLNR
A0A522AC27      QRFISIGRMIVSIK--------------LSIQETSVYTEELSNFLGTQQALMQSPVVVQR
A0A2A2R174      VVYQSKAVIELDFGEKKVL---------AIDDFEKRDKGGGVDFLNTIANNVRSSAIIKR
A0A1H2DTI1      PNYASTARLMINTK--------------INVTESSVSTTEVGNYMETQIALMTSQKVYTA
A0A1V5L462      DAWESSAQLIIQGN--------------IEIQEADRLREVATNFHDNQLHLMTGQWVSER
A0A2A2R3V9      PTYISSGKLIVSPR--------------MFLPENAVVSDESVNFIGTQLELMQSAEVRSR
A0A3D3LGD3      RLQDKVQ---------------------VFERSSDNFMANSDVVVKNEFESIIKPETLYP
A0A350ARX4      PVYVSYAEMMVSG---------------RFALPDNVYREELSNFFGTQITLMLSDRVQKQ
B5JIS2          PEHTAVSTMLAQSPLDELLH--------SDQQARERKKDAQENFLQNHLSVMKSRRFSVE
A0A1H2GQN6      KQYGGTVDIRVFKQDKD-----------VQVFSQSDRNAFDPIFFESERSTIESKEILYP
A0A512M3Y3      PTYYSRSLVAYDSVNLPIK---------SETSDGSDGRGKWAHISNVLTSALNSRWLVEH
A0A4P5R5J1      PAFRSSGRMMVAGQL-------------RLGDNAAAYSEELMNFFGTQIELMQSAAVLKG
A0A4P5YK43      NKYRAYSTLGFTSRVE------------TGVGGKAQVVELADGFVEHQLVLMKSPRVRNK
A0A2A2RPW6      VVYQSKAVLYFDSGEVNV----------INIQEVEKREKAGIDLLNSIANNLKSSVILSR
B4D1I7          VVYVSTGRIMASGK--------------INLPEGVTYTEEMNLFISTQRELMQDEAVRQR
A0A353F286      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A354FSA6      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A3B9GA54      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A520LEH8      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A6B2M0T8      PLYKSVAILLFELQQDKVIN--------IQQVVDNSLGRSADFILRNHLTDLRSNSFRNR
A0A2D7B7R6      AHYRSTALLVVDTQQF------------VESDADASNDVRDLDILTTLVGRISTTPVLSH
B1ZT68          PLYYSEVSLLFETRKDRV----------LNIQDVVDTGVRSTTELNVHAEQLRSQTFFEY
W0J7C2          PIYRTEVSLLFEARKDRV----------LNIQEVVDTTLQTAAELNTHIEQLRSKTFADY
A0A2E5K4P7      KEYKSVAELRMERFGNTPI---------DTGNEKNQDNIGSHEDFNTWANILKSPTITSM
A0A0R2XPB1      PFYKSTSQMIVSGR--------------IALPENDMYAEERDNFIGTQIELMLSDQVQAR
A0A348NQP1      -----------------------------------MYAEERDNFIGTQIELMLSDQVQAR
A0A357FV58      PFYKSTAQMIVSGR--------------IALPENDMYAEERDNFIGTQIELMLSDQVQAR
A0A2V6F9Q9      ---------------------------------------------------MQSAEVRRG
A0A2V6NZZ3      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6EBU2      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6EY06      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6ME53      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A538NUU0      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6NIJ1      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6C292      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6D2X0      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V5ZUK1      PQYQSTSKMMLAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVKHS
A0A2V5XFN9      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A2V6EZC8      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A2V6I7Z5      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A3B9LCP2      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A3C0R669      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2V6EID2      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2V6MHB0      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2W5YWL9      PSFLSTSKMMLAGK--------------LNVNSSAVYSEDNVNFYGTQIQLMQSTEVRRG
A0A2V5NH62      PSFESRSKMMLAGK--------------LNISQSAVYSEDSVNFYGTQIQLMQSQEVRKS
A0A2W6A620      PLFQSMSKMMLAGK--------------MNISQSAVYSEDSVNFYGTQIQLMQSAEVRRS
A0A2V5PIJ4      PSFLSRSKMMLAGK--------------LNISQNAVYSEDSSNFYGTQIQLMQSDQVKQG
A0A2V6K2G8      PSYQSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVRHS
A0A2V5W206      PSYLSASKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVRHS
A0A2V6MW77      PSYLSASKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKHS
A0A2G4GZN8      PEYRATGRLRVFRLSPNINGG--------SSAADDNFKIVSNDDFFTAIEAMRSANIIEG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      KLYTAYSTIELLRDDPTVMLS--------SSGNLEQNEIRTAEDLNTHISKLESITVIQG
A0A2D7F4D9      KLYTAYATIELLRDDPTVM-N--------SASNLEQNEIRSSEDLNTHISRLESVSIIQG
A0A3R7RBR8      KLYTAYATIELLRDDPTVM-N--------SASNLEQNEIRSSEDLNTHISRLESVSIIQG
A0A2E0NH28      KVYTAYVSVQLLRDDPSAMR---------DETEMEPNQILSAEDLNTQISVLESLSIIQA
A0A350AS32      KVYTAVAQVQLLRDDPSAMGNI-------PGMEMEPNQIRSAEDLNTQISVLESASIIVG
A0A368BGT4      KVYTAVSQVQLFRDDASALGAY------GQGAEMELNQILGAEDFNTQIIVFESLNIMQG
A0A2E0V4K6      ERFASTATLLVKQNLSGV----------ISSEEVEDLDLRSDNVMNTIAAQVTRVGILEK
A0A2E6NAH3      KVYTAASQVQLFRDDASALGAI------GQGMEMEQNQILSAEDLNTQISVMESLSIIQG
A0A2A5VZA5      KVYTSVAVVRLLRDDPSAMGV---------SVELAQNQIVGAEDLNTQISLLQSGKIIQG
A0A424R295      KVYTSVAVVRLLRDDPSAMGV---------SVELAQNQIVGAEDLNTQISLLQSGKIIQG
B4CZV9          PVYYAHALIHLE----------------YLARPLDTDKLYEDGRLSAFVAQFTEPQIMLR
A0A290QE54      PMYQARATMQIEKPEKI-----------VTSQEIVDISINSDIELNTYLQVLGSAKLRGK
A0A1H1SWX2      PMYSSTATMQFERPERV-----------VQNEQVVDTAVRSEVDLGTYLQILQSGRLRTM
A0A4Q1C9I5      KMYASTATMQFERPERV-----------VLNEQVVDTSIRHDVDLNTYLQILTSGKLRQM
A0A3B9FM17      -------------------------------------ESHLEGLISRHTEGLNSEKLRIN
A0A1G3ZL71      PMYESRATLQFEREERV-----------MNQQKVVELAPQSEVDINTYVHQLNSGTLRSR
A0A556QP09      PLYRSAATLQIEKPEKV-----------VTTVDVVDTGINSDIELNTYLQVIASAKMRNR
A0A2T6DX88      PLYQSQATMQIEKPEKI-----------VTSQEVVDLSVTNDIDLNTYLQVLNSTKLRTK
A0A2T6CWI7      PRYAATARMQFEKPDRI-----------VMAEGVVDTAVRSEVDMNTHTEVLKSSSLREE
A0A3E1E5C8      KMYAATATMQFEKADTV-----------VTTQGVVDPSVRSELELRSNLEKLNSQRLRTK
B1ZZ74          PLYAAMATMQFEKPETV-----------VTSQVVVDPSVRSDIELNTNIQVLNSARMRSR
R7E4L8          YLYQKTARIMLRDDKQKNAQV-------SEIILSDLGFKPGEANLANESYVVKSSEVMSR
A0A4Q3BVY2      PSYSSTALVTMHSFGAPM------------VDREVAETQQVSSFHRNFLNRLRSAPIQLA
A0A4P6PCA7      PVYQAKAEIEMSVQRPQFIQT-------EVNLEEGGGTLSEDVIFNTRFAKFRSPAMEEI
A0A0E3YV65      KVYQSRSRLLVDRSERVV--DI------AQVVDQSVGGGKNDAMFDTYLAQITSPAMIVR
W0J900          KVFQASATLLVGRIEKVLGNEI------TNVVDDSVGGSKNDPAFDTHLAQITSREMIQR
A0A2T6DSN5      PVYWTEVQLLFEPKEKKV----------LNITEVVDTTTSSSLDLHTHLARLRSETFLDY
A0A2V2SMX4      PSYVSTGRMIVSMK--------------LSIPEGQLYTEEMGNFLGTQAALMQSDVVIHR
A0A317ZIW7      PNYRSNAQMMLSGR--------------ISLPENELYAEERANFFGTQIELMESSQVKSR
A0A2D7WMI4      EFYASSSSFRLIPPPAII----------N-LQKVD-REQQLQPLVSKHLDGLNSQELRAQ
A0A2D6VHX5      EMYQSSSSFVLIPPPKIL----------N-LQKVD-RDQQVNGLISKHLDGLNSQELRMN
A0A2D8I214      EFFQSSSSFRLIPPPAVL----------N-LQKVD-RDTQVQGLVAKHREGLNSQELKAS
A0A1Z8VL41      EFFRSESSFRLXPPPXII----------N-LQKVD-RXSXINTLXSRHLDGINSQXLRVN
A0A2E6TNA4      EFFRSESSFRLIPPVEVI----------N-LQKVD-RSSQINTLISRHLDGINSQELRVN
A0A1Z8RG47      EFYKSSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A1Z8RJJ5      EFYKSSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A2D7V631      EYYASSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A354RA24      EYYASSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRAN
A0A2E9RV62      SIYQSSSSFRLIPPPAIL----------N-LQPVE-QANQLVDLVRKHTEGLNSQELRAR
A0A2E4AY96      EFFSSSSSFRLIPPPAII----------N-LQKVDQQEQQFQLLVGKHRDGLNSQELRMQ
A0A3B9B9P4      EFFSSSSSFRLIPPPAII----------N-LQKVDQQEQQFQLLVGKHRDGLNSQELRMQ
A0A2D5Y6N6      ELFRSSASFRLIPPPAIL----------N-LQKVD-RDQHVQGLVAXHLDGLNSQDLRLN
A0A2E7HSS8      EYYRSSSSFSLIPPPAIL----------N-LRSVD-RDQHVEGLIAKHTEGLNSQQLRTN
A0A2D8VCK3      DKFQSSCSFSLTPPPAIL----------N-LQSVE-RESHLEGLISRHTEGLNSEKLRIN
A0A350QVY4      DKFASSCSFSLTPPPAIL----------N-LQSVE-RESHLEGLISRHTEGLNSEKLRIN
A0A2E4ZYR7      ------------------------------MQPVD-RDKYSARIIGQHLEGLRSGELRNR
A0A2E6TCV1      ELFRSSATFVIQPPLSII----------DNMQPIE-RDKYSARIVGDHLHRLKEKELRQR
A0A3D4HHL8      PSYVSYSQMIVSGR--------------IALPEGAIYSEELSNFFGTQMSLMQSHRVKER
A0A366HV03      AVYHSRSLIDYKFFA-------------LPVAADGVDGSSVARAVRSVQGQLSSRQMIAW
A0A6G6K911      AVYQSRSLIDYKFFA-------------LPVAADGVDGSTAVRAVRSVQSQLSSRQMIAW
A0A5R8KAF2      PLYSSNAVIYFRVFGSPL----------SDKGMGDSAGSQTSALKYLPWELASDSNVLAA
A0A2V2SDN0      PAYQSDARMWLTGK--------------LDLSEGRLYTEELVNFLGTQADLLRSRVIQER
A0A1V6GL40      PSYVSVGRMIVSMK--------------LAIQPASLYSEELSNFLGTQAALMQCGVVVNR
A0A2V5X6Z6      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQTELLRSPAIQGR
A0A2V5VGZ7      PAYESKARMWLTGK--------------LDIYEGRLYTEELINFLGTQAELLRSPAIQGR
A0A2V5U130      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQAELLRSPAIQGR
A0A2V6C237      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQTELLRSPAIQGR
A0A3R8L982      PMYQSTATMQIEKPERVVTS-----------QEVVDTAVSSDADLNTYLQIIGSQKLRDK
A0A2E7HPU9      KLYEATSTLLVKDSARAAFE--------GQRQDNADINLRSQEALGTIVEQIKNFELFEK
A0A388PR45      PEYRAAGRLRVYRLTPTIGT--------GNTGVDETQRIGSNDDFLTAIESMKSTAVIEG
A0A388QR61      PEYRAAGRLRVYRLTPNLGN--------NNSAVEEAQRIGSNDDFLTAIESMKSSTVIEG
A0A4P5YHI0      PEYRAAGRLRVYRLTPNLGN--------NNSAVEEAQRIGSNDDFLTAIESMKSSTVIEG
A0A2A2RS01      PEYRAVGKLRVFRMAPDVTA--------NNTAANNNFNITTNDDFYTAVESMRSTGIIES
A0A2A2Y1A7      PEYRAVGKLRVFRMAPDVTA--------NNTAANNNFNITTNDDFYTAVESMRSTGIIES
A0A388PDH9      PEYRAIGKLRVFRMAPDVTV--------NNTTANNNFNITTNDDFFTAVESMRSTSIIES
A0A2G4H1E7      PEFQATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEEMRSANIIES
A0A2G4GZA6      PEYRATGRLRVFRLTPTING--------GSSAADDNFRIGSNDDFFTAVEAMRSANIIEG
A0A388P514      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
A0A2A2YG59      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
A0A2G4F7D5      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
D5EML0          KLYQASASMTVELTTANVMDIREV----MDTNVAHVNLL--NTLMNTHLERIKTRAIADA
A0A3C1C1M3      ATEIYQAEARIELSTRRPRIVNKQDAMIEDRGYGDAEEI-----LNTQIQKFNSPSILPF
A0A2E9EYJ1      SEXLGRVQIXVQREARDIEVFRXT----GSVGXXGSDQLPYMTXMQTQFEIXQSRETXKE
A0A258AXR6      RKYRGHVEMTIERITQDINVFDRN----RGDSLAFTQEY-----IKTQFETITKPTTLYP
A0A3D3NZQ6      RKYRGRVEMKIERLQDKVQVFERS----SDNFMANSDVV-----VKNEFESITKPETLYP
A0A1T4WVZ9      RKYRGRVEMKIERLQNKVQVFQRN----TDDFMAPTDVV-----IKNEFESITKPETLYP
A0A4R7SSI6      RKYRGLVEMKIERMQNKVQVFQRS----TDDFMAPSDVV-----IKNEFESITKPETLYP
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      QLEIVSLIPSVAKNEDFKSI----------------------------------------
A0A2S7U0Z3      TAQSPEVRALRNAIPPEFSF----------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      VMQRPEVQVLEKVIPPQFSW----------------------------------------
A0A2N8IR72      ANALL-----RGLTITRPDS----------------------------------------
A0A2N8IV96      VSRKLNLAAEWGMTDEMAAT----------------------------------------
R7E1V8          VSRKLNLAAEWGMTDEMAAS----------------------------------------
A0A1T4WWY4      AARAIGVAGPSTTFDGLRDD----------------------------------------
A0A3D3LEQ6      AAKKLGVATASTTAVDLRAS----------------------------------------
A0A3D3NW23      AAKKLGVATASTTAVDLRAS----------------------------------------
A0A2E0R252      IAASPKFAEREDVA--SEKF----------------------------------------
A0A3E1EF48      VASNPLFANRPEVVPLSRRY----------------------------------------
A0A2A2PVG8      AAKGQLFANRENIA--PAKK----------------------------------------
A0A2E0R421      VAKSYLFENRDDVF--PDRF----------------------------------------
A0A2E5EJ69      AAELIVDREQLSPDISQNDL----------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      AEAYV-----RTTAAEIPVS----------------------------------------
A0A2E7ALI1      ----------KRALPETGSN----------------------------------------
A0A178IDB9      VQ--------SSFSSAEIEQ----------------------------------------
A0A290QD69      VQ--------SSFTPKEIEQ----------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      VV--------ASFTPEEKTR----------------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      ALARL-----SAPRTNAIPL----------------------------------------
A0A3C1VFY9      ARERV-----ASQNPGVT------------------------------------------
A0A522AC27      AHARA-----VAQRPDIV------------------------------------------
A0A2A2R174      VVVGQSLTNHPYFTGGSNAP----------------------------------------
A0A1H2DTI1      AINAL-----KAKNPGFVES----------------------------------------
A0A1V5L462      ASERV-----RALHPEIQKD----------------------------------------
A0A2A2R3V9      ARARV-----QALKPNLVPI----------------------------------------
A0A3D3LGD3      VVDKLDLQLKWELPTRQAAL----------------------------------------
A0A350ARX4      AKDRV-----LMLYPEITPS----------------------------------------
B5JIS2          LA--------SEFTEDEKAS----------------------------------------
A0A1H2GQN6      VIKKLNLVEKWSQRYLHGER----------------------------------------
A0A512M3Y3      TAKTLGLVETPGEYEMIRNR----------------------------------------
A0A4P5R5J1      AETRV-----HALHPDLPVE----------------------------------------
A0A4P5YK43      AQEYM-----REIDAALGVH----------------------------------------
A0A2A2RPW6      VVKANKLTNHVYFTQGTNAI----------------------------------------
B4D1I7          AANLV-----RSNNPELTPC----------------------------------------
A0A353F286      AAEKAQLPVQWGMDMDDVVS----------------------------------------
A0A354FSA6      AAEKAQLPVQWGMDMDDVVS----------------------------------------
A0A3B9GA54      AAEKAQLPVQWGMDMDAVVS----------------------------------------
A0A520LEH8      AAEKAQLPVQWGMDMDDVVS----------------------------------------
A0A6B2M0T8      VV--------DSLTTEEVNL----------------------------------------
A0A2D7B7R6      V---------IEISPELQEH----------------------------------------
B1ZT68          VL--------TSFNKEEAER----------------------------------------
W0J7C2          VL--------ASFSTAEAEL----------------------------------------
A0A2E5K4P7      VETRL-----KASEVDYNN-----------------------------------------
A0A0R2XPB1      AVERI-----RLMDPDLHDA----------------------------------------
A0A348NQP1      AVERI-----RLLNSDLHDA----------------------------------------
A0A357FV58      AVERI-----RLLNSDLHDA----------------------------------------
A0A2V6F9Q9      AAELV-----WSTHPDISPV----------------------------------------
A0A2V6NZZ3      AAALV-----RSTNPELQPV----------------------------------------
A0A2V6EBU2      AAALV-----RSTNPELQPV----------------------------------------
A0A2V6EY06      AAALV-----RSTNPELQPV----------------------------------------
A0A2V6ME53      AAALV-----RSTNPELQPA----------------------------------------
A0A538NUU0      AAALV-----RSTNPELQPA----------------------------------------
A0A2V6NIJ1      AAGLV-----RSTNPELQPV----------------------------------------
A0A2V6C292      AVGLV-----RSTNPELQPV----------------------------------------
A0A2V6D2X0      AVGLV-----RSTNPELQPV----------------------------------------
A0A2V5ZUK1      AEALV-----RSSHPELQPV----------------------------------------
A0A2V5XFN9      AESLV-----RSAHPELQPV----------------------------------------
A0A2V6EZC8      AESLV-----RSAHPELQPV----------------------------------------
A0A2V6I7Z5      AESLV-----RSAHPELQPV----------------------------------------
A0A3B9LCP2      AEALV-----RSTHPEMQPV----------------------------------------
A0A3C0R669      AEALV-----RSTHPEMQPV----------------------------------------
A0A2V6EID2      AEALV-----RSTHPEMQPM----------------------------------------
A0A2V6MHB0      AEALV-----RSTHPEMQPM----------------------------------------
A0A2W5YWL9      AEALV-----RSTHPELHPV----------------------------------------
A0A2V5NH62      AEQLV-----RSTHPEMQPV----------------------------------------
A0A2W6A620      AEALV-----RSTHPELQPH----------------------------------------
A0A2V5PIJ4      AEGLV-----HSTHPEMPTA----------------------------------------
A0A2V6K2G8      AESLV-----RSAHPELQPV----------------------------------------
A0A2V5W206      AESLV-----RSAHPELQPV----------------------------------------
A0A2V6MW77      AESLV-----RSAHPELQSV----------------------------------------
A0A2G4GZN8      VS--------KRLTVAERKQ----------------------------------------
A0A348NPT1      ------------------ER----------------------------------------
A0A2E1KV60      VE--------KRLQEDEFAQ----------------------------------------
A0A2D7F4D9      VE--------KRFQEDELAQ----------------------------------------
A0A3R7RBR8      VE--------KRFQEDELAQ----------------------------------------
A0A2E0NH28      VE--------RRLQDEERAR----------------------------------------
A0A350AS32      VE--------QRIQDDVRER----------------------------------------
A0A368BGT4      VE--------KRLQDEMRER----------------------------------------
A0A2E0V4K6      VAQRPEFAGSEDLVRKPASY----------------------------------------
A0A2E6NAH3      VE--------QRLQDELRLR----------------------------------------
A0A2A5VZA5      VN--------RRMSDEQRKR----------------------------------------
A0A424R295      VN--------RRMSDEQRKR----------------------------------------
B4CZV9          TARALGI---DTNSRDLERK----------------------------------------
A0A290QE54      VI--------QSLTPAEVKM----------------------------------------
A0A1H1SWX2      VA--------QSLTPDEIRL----------------------------------------
A0A4Q1C9I5      VA--------QSLTAEEVRI----------------------------------------
A0A3B9FM17      VAHQ------LDNNPQYKSV----------------------------------------
A0A1G3ZL71      VY--------DSFTPEEKAI----------------------------------------
A0A556QP09      VQ--------ESLTPQERQV----------------------------------------
A0A2T6DX88      VM--------ESFTPEEVKV----------------------------------------
A0A2T6CWI7      VV--------ASFSADEIKV----------------------------------------
A0A3E1E5C8      VV--------ESFTPDEVKI----------------------------------------
B1ZZ74          VV--------ESFTPEEVQI----------------------------------------
R7E4L8          VVKGLGLDVSYWEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTPLNGREFSLSYRAK
A0A4Q3BVY2      AAKRMGLVGDGATSEDILRV----------------------------------------
A0A4P6PCA7      AAEVYFSKYSKKEYEERTSW----------------------------------------
A0A0E3YV65      VV--------DSLSETEKLS----------------------------------------
W0J900          VV--------ASFKPEEKAR----------------------------------------
A0A2T6DSN5      VQ--------QSFSPKEIEM----------------------------------------
A0A2V2SMX4      AHLLV-----IAQNPNFKPQ----------------------------------------
A0A317ZIW7      AIER------VKLTEPEVYE----------------------------------------
A0A2D7WMI4      VVTK------IENSPELKTE----------------------------------------
A0A2D6VHX5      VIAR------INENSDYKTE----------------------------------------
A0A2D8I214      VIQK------ISDNPESKSI----------------------------------------
A0A1Z8VL41      VVQK------ISENPEXKSI----------------------------------------
A0A2E6TNA4      VVQK------ISENPEYKSI----------------------------------------
A0A1Z8RG47      VIQK------VKDNPEYKSA----------------------------------------
A0A1Z8RJJ5      VIQK------VKDNPEYKSA----------------------------------------
A0A2D7V631      VIQK------IKDNPEFKST----------------------------------------
A0A354RA24      VVQK------IKDNPEFKST----------------------------------------
A0A2E9RV62      VLEA------IKDNSFKKST----------------------------------------
A0A2E4AY96      VITK------IENSPELKRE----------------------------------------
A0A3B9B9P4      VITK------IENSPELKRE----------------------------------------
A0A2D5Y6N6      VTQK------IKDTPELKSE----------------------------------------
A0A2E7HSS8      VILR------LRESPEYKSV----------------------------------------
A0A2D8VCK3      VAHQ------LDNNPQYKSV----------------------------------------
A0A350QVY4      VAHQ------LDNNPQYKSV----------------------------------------
A0A2E4ZYR7      IVRA------INEDDHKKAT----------------------------------------
A0A2E6TCV1      VVKA------IESDKAKKSI----------------------------------------
A0A3D4HHL8      ----------ARLRVRAMQP----------------------------------------
A0A366HV03      TA--------HSLGVGRANA----------------------------------------
A0A6G6K911      TA--------HALGIGRANA----------------------------------------
A0A5R8KAF2      AKELGIVGPSASFEAVKSKQ----------------------------------------
A0A2V2SDN0      ALATVEKQFSNAPPLKPVPG----------------------------------------
A0A1V6GL40      AH--------ERVSAQ-KPE----------------------------------------
A0A2V5X6Z6      AL--------ARLRSELNPD----------------------------------------
A0A2V5VGZ7      AL--------AKLRSERN------------------------------------------
A0A2V5U130      AL--------ARLRSELNPD----------------------------------------
A0A2V6C237      AL--------ARLRSELNPD----------------------------------------
A0A3R8L982      VA--------ESLKPDDIKI----------------------------------------
A0A2E7HPU9      IA--------KDPDVLALEG----------------------------------------
A0A388PR45      VS--------RLLTPAERKL----------------------------------------
A0A388QR61      VS--------RLLTPAERKL----------------------------------------
A0A4P5YHI0      VS--------RLLTPAERKL----------------------------------------
A0A2A2RS01      VS--------RQLTIDEKKR----------------------------------------
A0A2A2Y1A7      VS--------RQLTIDEKKR----------------------------------------
A0A388PDH9      VS--------RQLTIDEKKR----------------------------------------
A0A2G4H1E7      VS--------KRLTTDERKQ----------------------------------------
A0A2G4GZA6      VS--------KRLTADERKL----------------------------------------
A0A388P514      VS--------KRLTADERKL----------------------------------------
A0A2A2YG59      VS--------KRLTADERKL----------------------------------------
A0A2G4F7D5      VS--------KRLTADERKL----------------------------------------
D5EML0          VV--------AALSEDQIQQ----------------------------------------
A0A3C1C1M3      VV------------ASYREL----------------------------------------
A0A2E9EYJ1      VIXNGVDXAGNXXDLKKSWG----------------------------------------
A0A258AXR6      VI--------ETLELAKKWE----------------------------------------
A0A3D3NZQ6      VV--------DKLDLQLKWE----------------------------------------
A0A1T4WVZ9      VV--------DKLDLQKRWS----------------------------------------
A0A4R7SSI6      VV--------DKLDLQKRWS----------------------------------------
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ---------------------------------KPRYMRTEEELAFKPASSVEVYELVSS
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      ---------------------------------KPKYWRDESQREFISAGDADPAEFLRL
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      -----------------------------------------------------------N
R7E1V8          -----------------------------------------------------------N
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      ------------------------------------------------------------
A0A3D3NW23      ------------------------------------------------------------
A0A2E0R252      --------------------------HMPWE---------DVPSVSGADMSPET--LGGM
A0A3E1EF48      --------------------------VLPWEPFLAKKPNPEEKPAPGTKQGPAAGDLAGM
A0A2A2PVG8      --------------------------RFPWT---------KQMRFAGEDLSPEM--LGAM
A0A2E0R421      --------------------------HLPWE---------KRQNPTREDISDVS--LGNM
A0A2E5EJ69      ----------------------------------------------------------RG
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      -------------------------------------------------TSNHQKKLVSL
A0A178IDB9      --------------IQAPY-------------------------RNPDNPSAPPPSLAGI
A0A290QD69      --------------IQNAY-------------------------RNPDSPTAPPPSLADI
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      --------------VLAAW---------------------LDKDDPPLSASQMDGRLSGL
A0A357FSP9      ------------------------------------------------------------
A0A538NJ59      ------------------------------------------------------GKDGQP
A0A3C1VFY9      -----------------------------------------------------------P
A0A522AC27      -----------------------------------------------------------V
A0A2A2R174      ----------------------------------------------------SEQMVVSS
A0A1H2DTI1      ------------------------------------------------------------
A0A1V5L462      ------------------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3D3LGD3      ----------------------------------------------------------GK
A0A350ARX4      ------------------------------------------------------------
B5JIS2          --------------IVRAF--------------------------VKGDGVPSMSAFEKI
A0A1H2GQN6      --------------LLRED-----------------------------------EVYGIL
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      ------------------------------------------------------------
A0A2A2RPW6      ----------------------------------------------------SEERLTRQ
B4D1I7          ------------------------------------------------------------
A0A353F286      --------------LLEGI-----------------------------------------
A0A354FSA6      --------------LLEGI-----------------------------------------
A0A3B9GA54      --------------LLEGI-----------------------------------------
A0A520LEH8      --------------LLEGI-----------------------------------------
A0A6B2M0T8      --------------ITKDY----------------------------RDNDGNNAPSIHN
A0A2D7B7R6      -------------------------------------------YKVDLNDPRSITSASKK
B1ZT68          --------------IQRPY-------------------------RDPTQPDKPVPSLAEI
W0J7C2          --------------IRKAY-------------------------ADPLDPDAAPPPLDAI
A0A2E5K4P7      --------------FMEPY---------------------QKMDKNGGRDEEDPIVAGPI
A0A0R2XPB1      --------------LIATE----------------------------------AYQIDGL
A0A348NQP1      --------------LMVTE----------------------------------AYQNDGL
A0A357FV58      --------------LMVTK----------------------------------AYQIDGL
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ------------------------------------------------------------
A0A2V6EBU2      ------------------------------------------------------------
A0A2V6EY06      ------------------------------------------------------------
A0A2V6ME53      ------------------------------------------------------------
A0A538NUU0      ------------------------------------------------------------
A0A2V6NIJ1      ------------------------------------------------------------
A0A2V6C292      ------------------------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      ------------------------------------------------------------
A0A2V5XFN9      ------------------------------------------------------------
A0A2V6EZC8      ------------------------------------------------------------
A0A2V6I7Z5      ------------------------------------------------------------
A0A3B9LCP2      ------------------------------------------------------------
A0A3C0R669      ------------------------------------------------------------
A0A2V6EID2      ------------------------------------------------------------
A0A2V6MHB0      ------------------------------------------------------------
A0A2W5YWL9      ------------------------------------------------------------
A0A2V5NH62      ------------------------------------------------------------
A0A2W6A620      ------------------------------------------------------------
A0A2V5PIJ4      ------------------------------------------------------------
A0A2V6K2G8      ------------------------------------------------------------
A0A2V5W206      ------------------------------------------------------------
A0A2V6MW77      ------------------------------------------------------------
A0A2G4GZN8      --------------VLEPY-------------------QGGNIFSGPLTEQEVFARQRGI
A0A348NPT1      --------------FMAPY-------------------ADALSFTGPLTPTQMLAQNRKI
A0A2E1KV60      --------------FMAPY-------------------KGVFSFSGPLTAFEILAKNRKI
A0A2D7F4D9      --------------FMAPY-------------------KGTFSFSGPLTAFEILSINRKI
A0A3R7RBR8      --------------FMAPY-------------------KGTFSFSGPLTAFEILSINRKI
A0A2E0NH28      --------------FMAPY-------------------ADAFSLTGPLTPVEMLAKNRKI
A0A350AS32      --------------FMAPY-------------------SDALSLSGPLSPTEVLGRNRKI
A0A368BGT4      --------------FMAPY-------------------MDTLSFSGPLTPLEVLAENRKV
A0A2E0V4K6      ---------------------------MPDWASAFFAREGARESNSEPDTGANLTRVAAM
A0A2E6NAH3      --------------FMAPY-------------------EDTLSLSGPLTPLEILAKNRKI
A0A2A5VZA5      --------------FLLPY-------------------EGAFSFSGPLTPTEILGKYRKI
A0A424R295      --------------FLLPY-------------------EGAFSFSGPLTPTEILGKYRKI
B4CZV9          --------------YLFKF-----------------------------------------
A0A290QE54      --------------LQQPF------------------------LATLEPGQPPPSIHEVV
A0A1H1SWX2      --------------LQRPY------------------------LKDLAPGANPPAVGGLL
A0A4Q1C9I5      --------------LQRPY------------------------LGELAPGENPPPVGQLL
A0A3B9FM17      --------------LLGPF------------------------LK----QGVRVGIASAY
A0A1G3ZL71      --------------LQRSF------------------------LKDLPPGAGPPATGDFM
A0A556QP09      --------------LQRPY------------------------IKDLAPGATPPT-GVDL
A0A2T6DX88      --------------IQRAY------------------------LKNLKPGDPLPGVGSML
A0A2T6CWI7      --------------LQRAA------------------------LKRLPPGSPPTNVGIPM
A0A3E1E5C8      --------------LQRPY------------------------LKNLPPGAGVPSAGEAL
B1ZZ74          --------------LQRPY------------------------LANLAPGASPPSAGGAL
R7E4L8          ESGENVLHGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGRLSVT
A0A4Q3BVY2      --------------IPSLV-----------------------------------------
A0A4P6PCA7      --------------IGLED--------------------------------------LAY
A0A0E3YV65      --------------AWRPY-----------------AEQDAPPPA----APVLRDTLLQI
W0J900          --------------ILAPW-----------------LDKDAPPLS----DSQTDARLASL
A0A2T6DSN5      --------------IQNPY-------------------------RDPQNANAPVPSVRNI
A0A2V2SMX4      --------------PVSLK-----------------------------------------
A0A317ZIW7      --------------SL---------------------------------EQKEEFLNEGL
A0A2D7WMI4      --------------ILAPY------------------------IQ----EGAVTSVAAAI
A0A2D6VHX5      --------------LLAPY------------------------LS----DGTPMKIQNIV
A0A2D8I214      --------------MLAPF------------------------LR----EGIPVGVESTI
A0A1Z8VL41      --------------XLAPF------------------------LX----EGXPIGVAXTV
A0A2E6TNA4      --------------LLAPF------------------------LQ----AGIPTGVASTV
A0A1Z8RG47      --------------LLEPY------------------------LK----EGISMDVGATV
A0A1Z8RJJ5      --------------LLEPY------------------------LK----EGISMDVGATV
A0A2D7V631      --------------LLAPY------------------------LK----EGISMDVGATV
A0A354RA24      --------------LLAPY------------------------LK----EGISMDVGATV
A0A2E9RV62      --------------MLAPY------------------------VH----DQQLPEIASII
A0A2E4AY96      --------------MLKPY------------------------VE----SGIPTSVGSTV
A0A3B9B9P4      --------------MLKPY------------------------VE----SGIPTSVGSTV
A0A2D5Y6N6      --------------LLSPY------------------------LK----DGISIDVGATI
A0A2E7HSS8      --------------LLAPY------------------------LK----DGVIVDLASTV
A0A2D8VCK3      --------------LLGPF------------------------LK----QGVRVGIASAY
A0A350QVY4      --------------LLGPF------------------------LK----QGIRVGIASAY
A0A2E4ZYR7      --------------LLAPY------------------------VK----QGPPPPVASVV
A0A2E6TCV1      --------------LLAPY------------------------VKDKKEQEVLPTVGQVV
A0A3D4HHL8      --------------ELDPC-----------------------------------------
A0A366HV03      --------------SFEEL---------------------------------------RS
A0A6G6K911      --------------SFEEL---------------------------------------RS
A0A5R8KAF2      --------------LRVRA-----------------------------------------
A0A2V2SDN0      --------------MADFL--------------RHGSSVNAANAE----PSELF------
A0A1V6GL40      --------------IG-------------------------------------------R
A0A2V5X6Z6      --------------LAVLL---DGGGRQSELLHLAKALCKRLFAS----GSTSSSNAPPR
A0A2V5VGZ7      --------------LAVLH---NGGGTQSELLHKAKALCKKLIAS----GSSSSSNAPPR
A0A2V5U130      --------------LAVLL---DGGGRQSELLHKPKALCKRLFAS----GSTSSSNAPPR
A0A2V6C237      --------------LAVLL---DGGGRQSELLHLAKALCKRLFAS----GSTSSSNAPPR
A0A3R8L982      --------------LQRPY--------------QQDAIASGSPLP----GPSGLVGGINV
A0A2E7HPU9      --------------LIPPSVNWWPEWSGDLLGGDGEAAIEASKME----TSQLARLIRGW
A0A388PR45      --------------VLEPY--------------QQGNVFTGP-LT----EQEVFARQRGV
A0A388QR61      --------------VLEPY--------------QQGNVFTGP-LT----EQEVFGRQRAI
A0A4P5YHI0      --------------VLEPY--------------QQGNVFTGP-LT----EQEVFGRQRAI
A0A2A2RS01      --------------VIEPY--------------QQGNIFSGP-LS----EQEVFGRQRAI
A0A2A2Y1A7      --------------VIEPY--------------QQGNIFSGP-LS----EQEVFGRQRAI
A0A388PDH9      --------------VIEPY--------------QQGNIFSGP-LS----EQEVFGRQRAV
A0A2G4H1E7      --------------ILEPY--------------QNGNYFSGP-LT----EQEVFAKQRSI
A0A2G4GZA6      --------------VLEPY--------------QAGNIFSGP-LT----EQEVFAKQRGI
A0A388P514      --------------VLAPY--------------QAGNIFSGP-LT----DQEVFVKQRGI
A0A2A2YG59      --------------VLLPY--------------QGGNIFSGP-LT----EQEVFARQRGI
A0A2G4F7D5      --------------VLLPY--------------QGGNIFSGP-LT----EQEVFAKQRGI
D5EML0          --------------LVDPY--------------YDPAIDGENKPD----PAVLLMRRMLS
A0A3C1C1M3      --------------Y----------------------------PD----DPAPEEELTAR
A0A2E9EYJ1      --------------V----------------------------PS----DEDAYRILKRK
A0A258AXR6      --------------L----------------------------PN----RQAALGRLRAN
A0A3D3NZQ6      --------------L----------------------------PT----RQAALGKLRSN
A0A1T4WVZ9      --------------L----------------------------PN----RQSALAKLRGN
A0A4R7SSI6      --------------M----------------------------PN----RQAALAKLRGN
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      --------------------------------NALMIEYIQYKKDIRKVVSGDTLASISE
A0A258AXL1      ---------------------------------EKLALLAKYRSA--------------P
A0A2E6T1E0      ---------------------------------------LTYKRE--------------N
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      --------------------------------------------------------IVLQ
A0A353DI77      ------------------------------------KQFINIREGVNEEGKKSDLQHLLA
A0A1V6GCZ3      ---------MRGTSLIEIVVYSEKPEEAARIANAIADAYKTHRQEQRAQLSRGGIKALEE
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      FGSWITISGRRGTSLIDVRVKHQDAEAARVIADTLLKVYLEKEESQLIGGSDDAFKILKK
A0A5E6MKA7      -MGSLKVEPIRNTRLVRIRCESRQPIVAAQVANGYAESFINFGLDRKLEANRHARKFLAG
A0A6B3L936      LHQRVSVENVRGTTLIAIKVTHPDAETAKTLANAVMMTYVEEEEARISGGTSDAFKVVSI
A0A2N8IR72      ----------KESSLLEMTLTSSNPQKAEDTLNHLIQVYNQISKDERNKASLKTKIFIRD
A0A2N8IV96      LAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAYKQDREMRENRLVETAIKSLKD
R7E1V8          LAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKTVPEAYKQDREMRENRLVETAIKSLKD
A0A1T4WWY4      -VMPVCRMAILDQSHFQILVVSYDAEVVKKMPQALVDAYERIRLKIRSEYRDTAVKRYAD
A0A3D3LEQ6      -LIPAIRIGFLDQNHIQLRVISYRPRIVREFPQAMIEAYEGARKRLRNEYRDKAIARYVD
A0A3D3NW23      -LIPAIRIGFLDQSHIQLRVISYRPRIVREFPQAMIEAYEGARKRLRNEYRDKAIARYVD
A0A2E0R252      MRGWVTVRWRKDTTLIDLYASHSDPEIARDTLEGLIEEYDRSVESKVAGSSEFALDYILE
A0A3E1EF48      MAGWVSVSVRENTNLVDIFAAHTNPEVARDVLSCLLTEYEKLTAESIAGSEENTINYIVE
A0A2A2PVG8      LKGWVTVRWRTDTTLLDLYATHTDPAIARDSLAAVLSAYEQLSESRVEGSSEYVLEYILD
A0A2E0R421      MRGWVSVRWRPDTKLLDIHVTHTNPEVARDVLVALLSEYERMTESKVADSSEYALDYILE
A0A2E5EJ69      QLGGVSSSLRKMTRFIDVSFRHRDRVFAMNANQAIVEAFVNWDIERKMGRGTNTIAIHTT
A0A2G4I5Z5      -----------MTRLIDVTVELGDRVLSQTLAQAVVDEYIKQINEDRAGIGTNTSQFLMG
A0A4P5QQV6      -MVMLRVEPLPQTSIFALTATGEEPLYTQKFLDAILHEYIATRREMRSQKGEFAAGAIDD
A0A2E7ALI1      LKNRCEVTVRRRTRLLDVRINHEDPKVSAELADTVVDEYLKELTEENRGTKNKRSEGLVK
A0A178IDB9      IRPHINIYQQKGTTIVRIVVTNRDPEAAALIANRFSRKYIDFTVDKAMTSTNSAIIFLKN
A0A290QD69      IRPNVRIEPQRSTTILRIMVWNKDPEAAALIANRFARQYIQYTIDRAMTKTSSAMLLLRG
A0A2E7VDS1      ---------------LRITAIARNGEGAAMIANLAQDEYERIHDVRKGKKHDMAITFLEE
A0A178IFJ2      ITSGVGVQRQGTTFLIRITCKHREPAMAALVATRFAECYIVYLMDRNASANDSAISFLRA
A0A357FSP9      ---------------------------AARVANLFADEFINYNLTLNIDGSMKAVEDLRI
A0A538NJ59      LPVEIRVRQAAKSSVFELEASAADAAYVQAYLSALMIEYLQYKKDIRKVVSGDTLASISE
A0A3C1VFY9      KPVALQVSVLPKTTIFILRATGGNPEYTKAYLQACMDEYRNLKKGMTEHASDTTVAGLTD
A0A522AC27      QPAELSVAITPKTTIFVVRAIGHDPQYVKAFLQACMEEYIKLKREMREKTSDTTLAGLTE
A0A2A2R174      VSGAVDARLRRMTRLIDVTVELGDRMLAQTVAQSVVDEYIKERNEVRAGVGTNTSQFLMA
A0A1H2DTI1      -DVRIDVHPLGSTPILIIRAMSSDAQFAKDFLQADIDAYIALQHDIKVDDKDRAIKDITD
A0A1V5L462      -WVSLWAGRKGTTDIFQLVASGGNARYTQAYLAQIIQAYLEFRRQTRLETSDDVMLSIGE
A0A2A2R3V9      -PVALSAYQQPRTSIFTLQASGSEPNYTQAFLDAVMEEYISRRKETRSEKSQSALLTIKE
A0A3D3LGD3      LRSNLDTQSSIRSDFVIIEFFDKDPALAATIANAVADSYMTRRVEVESKQKESALEMLNK
A0A350ARX4      -WVSLSVVQRSQASIFQLRAQGGSAEFTQKFLDAVMEEYQTFRSEMRSETTETTLIAVTE
B5JIS2          LAGRMDATRQRDREFFTLSFRHPEAEIALMVADRMTAAYLKLVQREIKETNQAAAEMLRL
A0A1H2GQN6      LGRHLKVEPQRGSNIIQITGISEEMEEAPLLANTIAETYIGVRTKNEKDRINRGLDNVAD
A0A512M3Y3      -YVSSIRVTLVPGNILQIEIYAYQPWLVEKWPQAMLDTYKTYTQQQRSRFKDNAVEEYTK
A0A4P5R5J1      -QVKVVVGQLPKAAIFVMNVYAKSPAYASAYVDALMDEYMAKKKEMRQTSGESAAVAIQE
A0A4P5YK43      -PELESSVSKGAGSLFMMTVDSTDLRYASLYVSNWARAFVAYKNEVNTELIEKKFGQTRQ
A0A2A2RPW6      LAYVVDARLRRFTRLIDVSVELGNAKLAQVIGQSVMEEFLKQNAEDRVGAGTNAGHALLA
B4D1I7          -PITLFVAPLPQTSIFNLSAIGTEPQYPQKFLDALMHEYIATRREMRTEKSEDAESSIED
A0A353F286      ----VETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDA
A0A354FSA6      ----VETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDA
A0A3B9GA54      ----VETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDA
A0A520LEH8      ----VETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDA
A0A6B2M0T8      IIASANKIALVGGNIFKFEFHHRNPQAAALLANRFSEEFNDFLVERSRKTNDSALRFLRS
A0A2D7B7R6      LGANITAKLRGDSLFIDLTANSENRDLAYWSAKYVSTGYTNFLKVNSRSKAMGGLIQLER
B1ZT68          IRPNLTIFARRNTTILVVGVTNRNPENAALIANRFARRYIDYNLDRANSGTNSAIIFLRN
W0J7C2          IRPNVTVFARRGTPILGIQVSNRSPEAAALIANRHARKYIDYNLDNASTRTNSAIVFLRN
A0A2E5K4P7      LHEKRRIIPKRLSLVIQIEYIHPNPEIAATVVNHFAQSFREYQLDQSLKKGISDISKLGT
A0A0R2XPB1      RALSIESNVKRDTSIFVLSAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSARTYDAIVA
A0A348NQP1      RALLIEADVKRDTSIFVLTAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSARTYDAIVA
A0A357FV58      RALSIEADVKRDTSIFVLTAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSARTYDAIVA
A0A2V6F9Q9      -PIELSVAQRPRTSIFELQAIGSSPEYTQLYLSAVMQKYLDFKRGMREGQTQTFTTGITE
A0A2V6NZZ3      -PVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A2V6EBU2      -PVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A2V6EY06      -PVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A2V6ME53      -PVELTVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A538NUU0      -PVELTVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTHTFTTGITE
A0A2V6NIJ1      -PVELSVAQRPRTSIFELQAIGSSPDYIQAYLNAVMQKYLDFKRGMREGQTNTFTTGITE
A0A2V6C292      -PVELSVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTNTFTTGITE
A0A2V6D2X0      -PVELSVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTNTFTTGITE
A0A2V5ZUK1      -PVEIFVMQKPRTSIFDLSAVGSSPEYTQAYLNAAMQKYLDFKRGMREDRGHEITTGITE
A0A2V5XFN9      -TVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHEVTTGITE
A0A2V6EZC8      -TVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHEVTTGITE
A0A2V6I7Z5      -TVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHEVTTGITE
A0A3B9LCP2      -PVDITVSQKPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFKKGMREGQGQTVITGITE
A0A3C0R669      -PVDITVSQKPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFKKGMREGQGQTVITGITE
A0A2V6EID2      -RVEITVVQKPRTSIFDLQAIGRTPDYTQAYLNALMQKYLDFKKGMREGQGQTLITGITE
A0A2V6MHB0      -RVEITVVQKPRTSIFDLQAIGRTPDYTQAYLNALMQKYLDFKKGMREGQGQTLITGITE
A0A2W5YWL9      -PVEINVLQRARTSIFELQAIGSSPDYTQAYLNAAMQKYLDFKRGMRQDQTHTLTTGMTE
A0A2V5NH62      -MVEISVVQKPRTSIFDLVAIGTTPDYTQAYLNAVMQKYLDFKKGMRENQGSTVTTAITE
A0A2W6A620      -LVEITVTQKPRTSIFDLVAIGSTPEYTQAYLNAVMQKYVDFKKGLRENQGSTVTTAITE
A0A2V5PIJ4      -PVEITVSQQSRTSIFDLRAVGAVPEYTQAYLNALMQKYLDFKKGMREGQGHNVTTAITE
A0A2V6K2G8      -PVEIFVLQKPRTSIFDLSAIGSAPEYTQAYLNATMQKYLDFKRGMREDRGHEITTGITE
A0A2V5W206      -PVEITVLQKPRTSIFDLAAVGSAPEYTQAYLNAVMQKYLDFKRGMREDRGHEITTGITE
A0A2V6MW77      -PVEITVLQKPRTSIFDLAAVGSAPEYTQAYLNAIMQKYLDFKRGMREDRGHEITTGITE
A0A2G4GZN8      NPQRQ-------TLVINVDFTHPNRDLARQVARLFCESIKKNSEDDRLMVTNPLIEKARI
A0A348NPT1      LPQRG-------TLMIGVGYNHPDPVMAARVANLFADEFINYNLTLNIDGSMKAVEDLRI
A0A2E1KV60      IPRRM-------SLMVNISYTHPNPIVAAKIANLFGDEYINSMLSQNIDASMKAVEDLRK
A0A2D7F4D9      IPRRM-------SLMVNIAYTHPNPIMAAKIANLFGDEYINTMLSQNIDASMKAVEDLRK
A0A3R7RBR8      IPRRM-------SLMVNIAYTHPNPIMAAKIANLFGDEYINTMLSQNIDASMKAVEDLRK
A0A2E0NH28      IPRRM-------SLMVNVGFTHPDPIIAARVANLFADEFIAYNLTKSVDASMDAVEDLRI
A0A350AS32      MPKRM-------SLMINIAYTHPDPIIAADVANLFAKEFIDYNLKLNIDGSMKAVEDLRI
A0A368BGT4      IPRRM-------SLMINLAYSHPDPLIAAEVSNLFAKEFIDYNLRLNIDGSMKAVEDLRI
A0A2E0V4K6      LAQRCDATVRKRTRLLDVTVTHEDPELARTLADAVVDEYLKELAEEDKGSADRRSAGLLG
A0A2E6NAH3      IPRRM-------SLMVNFTYSHPDPFLAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRI
A0A2A5VZA5      MPQRM-------SLMVNVAYTHPDAQIAADVANLFAQEFINYNLSENIDASMVAVEGLRI
A0A424R295      MPQRM-------SLMVNVAYTXPDAQIAADVANLFAQEFINYNLSENIDASMVAVEGLRI
B4CZV9          ------RASLNTEKNIDVEAWPYSADWAHRWTETMVQQFIAYRQERRNEEKNLIVNTYSE
A0A290QE54      GSIGV--QAIKNSFLISITATHRSGEGAALIANRYVDQFMQDLLMNVGGKNEYAVQSLRT
A0A1H1SWX2      GSMSP--LSIRNSFLITITVNNRDPEGAALLANRFVEQFMRYLMENVGGKNEFAVDYLRS
A0A4Q1C9I5      GSMSP--QSIRNSFLIHISVTNRDPQGAALLANRYVEQFMRYLFENAGGKNEDAVNFLRS
A0A3B9FM17      SYRIT-QAGSKSRPRFIITSDARSALGAKYVADVVQKEYEKLHKSTKNEKVEFVKQTLED
A0A1G3ZL71      GQVVA--DAVRGSRLIRITARHRDPAAAALVANRTYQQFVNQLIENAGGSSEFTVEFLQL
A0A556QP09      GVMSV--QSVRSTFLINIAVSHRDPDAAAILANRYIEQFIESLLENVSGGHDYAVKYLRD
A0A2T6DX88      GSTSV--QSVRNSFIIRIVVSHPDPEAAALIANRTVDQFMQYLLDSVSGKNEYAVERLRL
A0A2T6CWI7      GELSV--FPIRNTYLIAVTVTHDDPDAAALVANRFVEVFMKRLYDTAGGRTADAVKFLRE
A0A3E1E5C8      GAVSI--DSTRNSLLISITVRHPDPVAAALVANQYVNQFVGYLMDYYGGKNETGVEYLRA
B1ZZ74          GGVSI--DAARNSLLITVRVVHPDPEAAALVANRYVNQFMTYLIERVGGVNESAVEFLRN
R7E4L8          RPDSK------ESSLLELTLRLSHPQKAEDALNYLIEVYNDHSRREKQMAASRAEEFIVK
A0A4Q3BVY2      -------IRAMDGRTIELTVVAHDKRAVRGFAEAIVTAYQDIQQENYEEYRDEALRRYAE
A0A4P6PCA7      WVRQVGWYKQGNANIVHVSFQSPDPEFAAQLVNVMIEAAGVLMERDNKELSDGAVKWLVD
A0A0E3YV65      IGSSVSAARQGNTFFISINVLQRDPDSAALLASRFASQFIIHLLDRNSAVNNSAIAFLRE
W0J900          IADNVGVVRQGSTFLVRVSYKHREPAVAALVATRFTECYIVYLMDRNTSSNDSAISFLRE
A0A2T6DSN5      VRSAIQIRDDKATTIVRIGAYHRDPEAAALIANRFARKYIDFMLDEAMSGTTSAILWLRN
A0A2V2SMX4      ------VTILPKTTIFLLVGTGDDPVYTQKFLQACMEEYANLKAEMRTQTSDKTLSGLSE
A0A317ZIW7      RSLKIAAEVKDDTSIFALSAITPDRKFSQEFLDAVMAEYINRRSEMRAKTSEKTYDAIAA
A0A2D7WMI4      SYSVSVS--GEGRPVITISSNARSAQAAMIIAREVQTEYEILHRSRSNLKVESAKQTLEG
A0A2D6VHX5      TYNVSVSSPSEGRPRFKINSQSRTGKGAMIIADLVQKEYDKLNSIKKTEQVQTAKGILEL
A0A2D8I214      SYSISVSPPSEGRPRFVISSTSRSAKGAMLVADLVQSEYEKLHKSKKNQQVESVRNLLEK
A0A1Z8VL41      SYSVSVTPPSAGNPRFTISATSRSARGAQIIADTVQLEYEKLHKSRKSEKVESARNLLEL
A0A2E6TNA4      SYSVGVTPPSAGNPRFTISAVSRSARGAQIIADTVQSEYEKLHKSRKSEKVESARNLLEL
A0A1Z8RG47      SYGVSVSPPSEGRPRFTINSNSRSGKGAMIVADIVQSEYEKLHRSKKSQQVESVRNVLEV
A0A1Z8RJJ5      SYGVSVSPPSEGRPRFTINSNSRSGKGAMIVADIVQSEYEKLHRSKKSQQVESVRNVLEV
A0A2D7V631      TYSVGVSPPTEGRPRFTINSNSRSGKGAMIVADVVQSEYEKLHKSKKSQQVESVRNVLEV
A0A354RA24      TYSVGVSPPTEGRPRFTINSNSRSGKGAMIVADVVQSEYEKLHKSKKSQQVESVRNVLEV
A0A2E9RV62      NYSVS--VGGEGRPVFTITATGRSPESVQLVADLVQQYYDESHKKGAGEIVRGARSVLES
A0A2E4AY96      SYSIS--LSEESRPRFTITSNARSAKSAMIIAREVQSEYEILHRSNSSLKVESAIKTLER
A0A3B9B9P4      SYSIS--LSEESRPRFTITSNARSAKSAMIIAREVQSEYEILHRSNSSLKVESAIKTLER
A0A2D5Y6N6      SYSISVSPPSEGRPRFTINSTARSGRGAQIIADVVQSEYEKLHKSKKSLQVENVKNVLQL
A0A2E7HSS8      SYRVD-QSGTKSRPRFIITSDSRSAKGAMIVADLVQKEYEKLHKSSKSEKVEFVKKTLED
A0A2D8VCK3      SYRIT-QAGSKSRPRFIITSDARSALGAKYVADVVQKEYEKLHKSTKNEKVEFVKQTLED
A0A350QVY4      SYRIT-QAGSKSRPRFIITSDARSALGAKFVADVVQKEYEKLHKSTKSEKVEFVKQTLED
A0A2E4ZYR7      NYTVS--LAGEGTPILRINSMARNGEGAAMVANLAQDEYERIHESRQGKKHDTAIAFLEE
A0A2E6TCV1      NYKID--LIGKGTPTLQITAEARNAEGAQLVANLVQIEYERAHKSRKGQNQTKSVAFLDI
A0A3D4HHL8      -VVRVSVSQSPDASIFILSAVGEKPEYTQAYLNALMNEYLSFKREMRSETADRTFLAITE
A0A366HV03      GPLRKIELGLLDGATMQLDVFSTNPNVVREFPQALINQYDSYTREKRFEFFEVALKRYNE
A0A6G6K911      GPLRKVELGLLDGATMQLDVFSTNPNVVREFPQALINQFDTYTREKRFAFFEVALKRYNE
A0A5R8KAF2      --------STMNWSHLQISVMSPDPAVVRVFAKKLIEVYRAQREEAWAKYRNEALIRYAR
A0A2V2SDN0      ---KLKVVESSKSSILELHATGAEPLSTRAFLNAVMAEYLSFKRESREKTSDRAVASLAR
A0A1V6GL40      HAVALNVLVLPKTTIFVLQATGRDRDYTQAFLQACMDEYIALKKEMRSQTSDTTVAGLTE
A0A2V5X6Z6      FPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTTDRTATSLGV
A0A2V5VGZ7      FPFDVKVLEGAKSSTLALRVIGAEPASTRAFLDCLMEEYLSFKKESREKTSDRTAASLAA
A0A2V5U130      FPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTSDRTATSLGA
A0A2V6C237      FPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTSDRTATSLGV
A0A3R8L982      QSVAR-------SYLISITAYNRDPDGAALIANRYVDQFITYLIDSVSGRNEDAVSYLNT
A0A2E7HPU9      TEVSN----RRKTRLVDVVVSHPLPEVASALADKISQTYANELGVERATGRTNSSSVLAQ
A0A388PR45      NPTRQ-------TFVVNVDFTHPNRELARLVAQRFCDVIQKSSEDERLTITHPLVEKARI
A0A388QR61      NPTRQ-------TFVVNVEFTHPNRELARMVAQRFCDVIQKSSEDERLTMTHPLVEKARI
A0A4P5YHI0      NPTRQ-------TFVVNVEFTHPNRELARMVAQRFCDVIQKSSEDERLTMTHPLVEKARI
A0A2A2RS01      NPLKS-------TFVVTVEFTHPNRDLARQVAGIFCKAIQKNSEDERLTITNPLVEKLRS
A0A2A2Y1A7      NPLKS-------TFVVTVEFTHPNRDLARQVAGIFCKAIQKNSEDERLTITNPLVEKLRS
A0A388PDH9      TPLKS-------TFVVAVEFTHPNRELARQVASIFCKAIQKNSEDERLTITNPLVEKLRS
A0A2G4H1E7      NPQRQ-------TLVINVAFTHPTRDLSRKVAQLFCEAIKKNSEDGRLMMTNPLVEKARI
A0A2G4GZA6      NPQRQ-------TLVINIDFTHPNRDLARQVARHFCDSIKKSSEDDRLMVTNPLIEKARI
A0A388P514      NPQRQ-------TLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARI
A0A2A2YG59      NPQRQ-------TLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARI
A0A2G4F7D5      NPQRQ-------TLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARI
D5EML0          VERGE----NEESQVLNIIITHQNPRIAQQVANTYVDEYIAYKAGLRSSSTGEAVNFLER
A0A3C1C1M3      LANRGRFAIIKRTRLVSVTFTDPDPEFAMRACAAYAAGAEAAARAENRSGSNAAVAWLEA
A0A2E9EYJ1      VETQD----VRGTDLIDIEVYDTDPNLAADIANAVADAYRTRRQEEEQSRAQKALALLDQ
A0A258AXR6      LETQS----MLRSDFVTIDYYDQDPQLAATIANEVAKSYMTQRNNIETGKKHKALEVLQQ
A0A3D3NZQ6      LDTQS----SIRSDFVIIEFFDKDPALAATIANAVADSYMTRRVEVESKQKESALEMLNK
A0A1T4WVZ9      LDTQS----SVRSDFVVIEYFDQDPGVAAEIANAVYQSYMTRRVEVETSQKQEALAMLAK
A0A4R7SSI6      LDTQS----SVRSDFVTIEFYDQEPGAAAEIANAVAQSYMTRRVEVESKQKQDALTMLGQ
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      QVLRLERDLKSEQENLVAFQRTNNLAI----------VQQEA-------------TIAGG
A0A258AXL1      LPVGTIVRREPNPDPFLIKTAGPNVVP----------GATGE-------------QVNGA
A0A2E6T1E0      DIISLEESQNVTLKALIQAQTDFDMAR----------SAEVT-------------AVAAA
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      -------------------------------------------------------DLDQN
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ALKQAQADLDKARSDAAAARK----------------LDEEV------------------
A0A353DI77      AAKERESELETARRRAGSYTPA---------------LEAEK------------------
A0A1V6GCZ3      RFAEQEAKVKAAQERVDNLRKELNISDAMASGDGPSPLMTAE------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      EADGARLEMELAEKSLQFYVSAIKL-----------------------------------
A0A5E6MKA7      QMDALRKKMAQSEERLADFMAEAGIAH----------LSPQEKAPAEKESVQIRDSLLRA
A0A6B3L936      EADEIAAEMEAAERSFQTYRAALEL-----------------------------------
A0A2N8IR72      RLKELGASLSDVDKKLTEFKTKSDIVKD---------ADTTM-------------SADFS
A0A2N8IV96      VLREQEDAVNEKMMALKKLIAESSYLP-------TSWRNGEHRSTLTAGMEEEEFRNAKA
R7E1V8          VLREQEDTVNEKMMSLKKLIAESSYLP-------TTWRNGENRSTLTAGMEEEDFRNAKS
A0A1T4WWY4      EVTEIRKKVAEQLDSRLQFEEQSALAN----------AQIEM-------------ERLSN
A0A3D3LEQ6      ELADVRAKVTSQLDSRLKFEEESALAS----------AQIEL-------------ERLSD
A0A3D3NW23      ELADVRAKVTSQLDSRLKFEEESALAS----------AQIEL-------------ERLSD
A0A2E0R252      SSDKVKEKMLNLERALRLYKRCLEL-----------------------------------
A0A3E1EF48      KCRELQEGIFKIESSLARYQGCVDL-----------------------------------
A0A2A2PVG8      SSAEIKERLLDLESTLQLYQRCLEL-----------------------------------
A0A2E0R421      NTNRIRKGILDLERAIELYNNCQDL-----------------------------------
A0A2E5EJ69      AAEELKVKWLEAQEIAHQYVKSNSLAV------------GMT-------------DMKRM
A0A2G4I5Z5      EEIRIKAGLLKAEVAVQEYLKTNSSSL----------IQGQ--------------NIVTE
A0A4P5QQV6      EIERVAAELRKEEDRLLAFQRDNKTGF----------LEQEG-------------NAAAA
A0A2E7ALI1      QAEEARVGLQEATSALAIYNRA---------------IEAHK------------------
A0A178IDB9      QSEEKRSEVESVERAMQDYRARHNMAA----------LGEAT-------------NIVRQ
A0A290QD69      QAEEKRTELQLIERQKQDFRAKHNMAA----------LGENK-------------GVVQQ
A0A2E7VDS1      QMNKSRKLGQAIDANTRDFKRQHNLAF----------IEDEK-------------KDVAD
A0A178IFJ2      QTEDLRKKAEASERALHAYREKSRMVS----------LEESQ-------------NIVVD
A0A357FSP9      RADQQKERVEELELKMAEYREDNNAVS----------LESQE-------------NIAAT
A0A538NJ59      QVLRLERDLKSEQENLVAFQRTNNLAI----------VQQEA-------------TIAGG
A0A3C1VFY9      QMLRLDPEMRKVDDQVAVFLSTNDVAF----------L-EEA-------------SGVAN
A0A522AC27      EILHLQRDLKKSDEELAEFQKTNSVVL----------LQEQG-------------NNYGM
A0A2A2R174      EETRIKEKLLLAERAAEQYLRTNSSSL----------IQSQ--------------NIVTE
A0A1H2DTI1      ELTKAEATLQTDEDDVLGFQKANNIVF----------LQEQG-------------SSLGS
A0A1V5L462      ELRELDVKIQQIQEAIRRFQQENNTIA----------IKELS-------------EKAAG
A0A2A2R3V9      QVDKSEKEINQVDEEMLSFQKENNVIF----------MEEQG-------------NKNAT
A0A3D3LGD3      QITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNSTVPGAE-------------LRTTG
A0A350ARX4      QLYRLEEEIENQENTVVDFQKENNLIF----------LKEQD-------------SSTGA
B5JIS2          QAEQLQAEISELEGKQRDFRERNNVIS----------LEENQ-------------DLLAE
A0A1H2GQN6      QIEKQRTIVTDAKKKVDDMRLQLGVDIIPGTQNESQLLDQEL-------------EGKQK
A0A512M3Y3      DLDRLKTRIASEQNATAKFEEDNHLIEQYIANNGLESVPGEM-------------LTTKN
A0A4P5R5J1      ELVRLEKDMKLEEEEMHGFQQKNNIGF----------LKEDG-------------NSAAT
A0A4P5YK43      EVKRYEQNLEKARESTLIFKKKHNIGD----------IRDAG-------------LAAQD
A0A2A2RPW6      SEAAIKQRLLKAEHAVAEYRRTKNIS-----------LQDTS-------------DIQTA
B4D1I7          EISRVQADVRKEEEKLVTFQRENNVGF----------LEQGG-------------NSAGA
A0A353F286      ESTEQEDLVDDYRKDLTVLIQQYGIPY----------FDGGSAGNRLGLSEQAMFQSAKG
A0A354FSA6      ESTEQEDLVDDYRKDLTVLIQQYGIPY----------FDGGSAGNRLGLSEQAMFQSAKG
A0A3B9GA54      ESTEQEDLVDDYRKDLTVLIQQYGIPY----------FDGGSAGNRLGLSEQAMFQSAKG
A0A520LEH8      ESTEQEDLVDDYRKDLTVLIQQYGIPY----------FDGGSAGNRLGLSEQAMFQSAKG
A0A6B2M0T8      QSEELKLKVERSELAVQRYRQERNLVS----------LEESQ-------------NLIVD
A0A2D7B7R6      GRELSQKDLEDAQKALIRFQTKNRITN----------LKERK-------------EQLET
B1ZT68          QAEELRAQVEAVESSLQEFRARNNIAA----------LGENQ-------------NVVLQ
W0J7C2          QADETRAQVEAAEKALQNYREKNNLAA----------IGETQ-------------NVVLQ
A0A2E5K4P7      EIQEKEKDVLVLEAKAVNYKTQFTSLG----------LDSEE-------------NIFLR
A0A0R2XPB1      QLKVLEAEVDAGEDAIVEFQQRNNIVF----------IQEQG-------------AAAST
A0A348NQP1      QLKVLEAEVDAGEDAIVEFQQRNNIVF----------IQEQG-------------AAAST
A0A357FV58      QLKVLEAEVDAGEDAIVEFQQRNNIVF----------IQEQG-------------AAAST
A0A2V6F9Q9      HLIQVEKDLRTAEDEMLEFQKENNIGF----------IQEEG-------------NSAAQ
A0A2V6NZZ3      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6EBU2      QLIQVEKDLRAAEDDMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6EY06      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6ME53      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A538NUU0      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6NIJ1      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6C292      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V6D2X0      QLIQVEKDLRAAEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V5ZUK1      QLIQVEKDLRNSEDEMLEFQKQNNIGF----------IQEDS-------------TSAAA
A0A2V5XFN9      QLVQVEKDLRNSEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6EZC8      QLVQVEKDLRNSEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6I7Z5      QLVQVEKDLRNSEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A3B9LCP2      QLIQTEKDLRTAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A3C0R669      QLIQTEKDLRTAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6EID2      QLIQTEKDLRTAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6MHB0      QLIQTEKDLRTAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2W5YWL9      QLIQVEKDLRAAEDEMLEFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V5NH62      QLIQVEKDLRGAEDEMIEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2W6A620      QLIQVEKDLRNSEDEMLDFQKQNNIGF----------IQEEG-------------NSAAQ
A0A2V5PIJ4      QLIEVEKDLRTAEDELLEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V6K2G8      QLIQVEKDLRNSEDEITEFQKQNNIGF----------IQEEG-------------NSAAA
A0A2V5W206      QLIQVEKDLRNGEDEMLEFQKQNNIGF----------IQEQG-------------NSAAQ
A0A2V6MW77      QLIQVEKDLRNGEDEMLEFQKQNNIGF----------IQEQG-------------NSAAQ
A0A2G4GZN8      EIETLEDKVRRLNEQKNGLIKNQKLLS----------IAKDT-------------NTLTA
A0A348NPT1      RADQQKERVEELELKMAEYREDNNAVS----------LESQE-------------NIAAT
A0A2E1KV60      RAEQKKNRVEELELKLAEYRELKNAIS----------LDKQE-------------NIAAE
A0A2D7F4D9      RAEQKKNRVEELELKLAEYRELKKAVS----------LDKQE-------------NIAAE
A0A3R7RBR8      RAEQKKNRVEELELKLAEYRELKKAVS----------LDKQE-------------NIAAE
A0A2E0NH28      RADQQRQRVEELELKLAEYREEHNAVS----------LDQQE-------------NIANE
A0A350AS32      RADQQKERVEELDMKLADYREQNNAVS----------LDSQE-------------NIARE
A0A368BGT4      RADQQKDRVEELELKLAEYREQNNAVS----------LQSDE-------------NIAGA
A0A2E0V4K6      QADVARESLQEANSALAVYNRALETHA---------------------------------
A0A2E6NAH3      RADQQKNRVEELELKLAEYREQNNAVS----------LQSDE-------------NIAAV
A0A2A5VZA5      RADQQKERVEEIELKLAEYRERHNAVS----------LDSQE-------------NIARE
A0A424R295      RADQQKERVEEIELKLAEYRERHNAVS----------LDSQE-------------NIARE
B4CZV9          ELKELVGRLDQQFSEKLDFQDQQDFTKTLILVNSINNLPADL-------------TKLQM
A0A290QE54      RAEQLRKEVEVADQRLQTYMKEQRLVS----------LDSSV-------------NIVSD
A0A1H1SWX2      RAKELQQESEAAEGKLQDYRRKHNLVS----------LDNSM-------------NIVGE
A0A4Q1C9I5      RADELRKDSETAEGRLQDYRRKHNLVS----------LDNSI-------------NIISD
A0A3B9FM17      LLDTSLGKEKKIAADMANYKKEHNLPF----------LEDEK-------------RDTGD
A0A1G3ZL71      RATELRKELGEKEALLQDYKKRHNLIS----------LDDSL-------------NIVAD
A0A556QP09      RATQLQEEARIAEQRLQDYMRAQNLVS----------LDNST-------------NIAQA
A0A2T6DX88      SAEQLRKEAEAADQKLQSYMREHNLVS----------LDNSV-------------NIVSD
A0A2T6CWI7      QASRLEREAQEKEQALQQYMTKHQLTS----------LDTSQ-------------SMSDE
A0A3E1E5C8      QADRLGKDAADAEQKLMAYKKEHNLVS----------LGNST-------------NIVGT
B1ZZ74          RADQLRKEAEQADVKLNAYMQAHNLVS----------LDKNK-------------DIVSE
R7E4L8          RIGKLGGQLGGVDKQVIDYKRNSRIVKD---------MDTTL-------------DATFN
A0A4Q3BVY2      QVDRLEAEISQTLSSLSSVERSQNLTEAMLEQQSLLEIPKQL-------------IQTRE
A0A4P6PCA7      QTEVLRKELEAVELELAGKRQDFQIAT----------LEQRR-------------ESLRA
A0A0E3YV65      QTQELRVKAESSERALQQYREKSGMVS----------LDESR-------------NIVVD
W0J900          QTEDLRKKAEASERALQAYREKTRMVS----------LEESQ-------------NIVVD
A0A2T6DSN5      QAEETRSQLEAATRELQEFRERHNMAS----------VGENK-------------GVIAQ
A0A2V2SMX4      EVESLRKELKQSSVQLEAFQGSNSVVV----------LDQQG-------------NSAGN
A0A317ZIW7      KIKSLEDEINQNEDAIVDFQRKNNIVF----------IQEQG-------------SAAGT
A0A2D7WMI4      LLQKEIQKEENIKRQITALKIKRSVPN----------LEDIK-------------RDNAT
A0A2D6VHX5      LLDKSLMEEDRILKEISDIKESNDIPF----------IEDAK-------------KINSS
A0A2D8I214      LLAQSIEKESQLADEMSAYKKNLGLPF----------IEDEK-------------RDTAD
A0A1Z8VL41      LLENRQSEEKRIAQEMSQFKKGKNIPY----------LEDAK-------------NSIFA
A0A2E6TNA4      LLENRQSEERRIAQEMSQFKKGKNIPY----------LEDAK-------------NSIFA
A0A1Z8RG47      LLQKSIDEESRISGEMSGYKKNNQLPF----------LEDEK-------------KDTAD
A0A1Z8RJJ5      LLQKSIDEESRISGEMSGYKKNNQLPF----------LEDEK-------------KDTAD
A0A2D7V631      LLQKSIDEESRISGEMSEYKKANQLPF----------LEDEK-------------KDTAD
A0A354RA24      LLQKSIDEESRISGEMSEYKKANQLPF----------LEDEK-------------KDTAD
A0A2E9RV62      LLEKSQSREDSILEEMTKYKGERELPF----------VEDER-------------LDNAA
A0A2E4AY96      LLDREMKKEKDIQAKISQYKAEKEAPF----------LEDDK-------------KDISA
A0A3B9B9P4      LLDREMKKEKDIQAKISQYKAEKEAPF----------LEDDK-------------KDISA
A0A2D5Y6N6      LLDKSLQEEERISQEQSSFKKKYDLPF----------LEDEK-------------QDTSA
A0A2E7HSS8      LLENSLSKERKIAYDMSEFKKVNQLPF----------LEDEK-------------RDTGT
A0A2D8VCK3      LLDTSLGKEKKIAADMANYKKEHNLPF----------LEDEK-------------RDTGD
A0A350QVY4      LLDTELSKEKKIAADMANYKKDNNLPF----------LEDEK-------------RDTGD
A0A2E4ZYR7      QMTRSRNAETEIDNKVREFKRRHNLAF----------IADEK-------------KDVAD
A0A2E6TCV1      QMAESRKKEDAIIKQINSFKTNHNLTY----------IEDDK-------------KDNAE
A0A3D4HHL8      EMMDLQKEIESGEDEKLNFQKENNIVF----------IQEQG-------------SSVGA
A0A366HV03      ELGLLKKKIDESLQVKTSFERDNEINE----------LLIKQ-------------NSLAQ
A0A6G6K911      ELGLLKKKIDESLEVKTNFERDNEVNE----------LLIKQ-------------NALAQ
A0A5R8KAF2      EVDTLEGLAVDSYKDLSKLERESRMTE----------VKIEQ-------------SRLFM
A0A2V2SDN0      QVNQLANELKAQQEKMYAFQMSNNVVF----------LQEQG-------------SGAGS
A0A1V6GL40      QVMRLEKDLRRAEAEMVQFQSTNSMML----------TQEQG-------------NSPAH
A0A2V5X6Z6      EVTQLKGELEAQQEKLHAFQASNNVVF----------LQEQG-------------NSAGS
A0A2V5VGZ7      EVTQLKSELEAQQEKLHAFQASNNVVF----------LQEQG-------------NSAGS
A0A2V5U130      EVTQLKGELEAQQEKLHAFQASNNVVF----------LQEQG-------------NSAGS
A0A2V6C237      EVTQLKGELEAQQEKLHAFQASNNVVF----------LQEQG-------------NSAGS
A0A3R8L982      SADRLRDEANAAEQRLLDYMRRENLVS----------LDNST-------------NIVRE
A0A2E7HPU9      KSEEAEKLLNQ-------------------------------------------------
A0A388PR45      EIESLEDKIRRLYEKKNGLVKSGDLLD----------IAGTT-------------NSIAA
A0A388QR61      EIESLEDKVRRLYEKKNGLVKSGELLD----------IAGTT-------------NSIAA
A0A4P5YHI0      EIESLEDKVRRLYEKKNGLVKSGELLD----------IAGTT-------------NSIAA
A0A2A2RS01      EIDLIEERLRKLSDKRSDLIKTQKLLS----------IAKDT-------------TTLNT
A0A2A2Y1A7      EIDLIEERLRKLSDKRSDLIKTQKLLS----------IAKDT-------------TTLNT
A0A388PDH9      EIDLIEERLRKLSDKRSDLIKSQKLLS----------IAKDT-------------TTLNT
A0A2G4H1E7      EIETLEDKVRRLFEQKNDLIKNQKLLS----------IAKDT-------------NTLTA
A0A2G4GZA6      EIETLEDKVRRLYEQKNDLIKSQKLLS----------IAKDT-------------NTLTT
A0A388P514      EIETLEDKVRRLYEQKNDLIKNQKLLS----------IAKDT-------------NTLTT
A0A2A2YG59      EIETLEDKVRRLYEQKNDLIKNQKLLS----------IAKDT-------------NTLTT
A0A2G4F7D5      EIETLEDKVRRLYEQKNDLIKNQKLLS----------IAKDT-------------NTLTT
D5EML0          QVAEMREELELQEVELQDYRQQHNL----VSVQQDKGITADR-------------LARLN
A0A3C1C1M3      QALAQRQELEKADQELFDARQTLQM----------DVLAGRR-------------KTIEE
A0A2E9EYJ1      QIKSQEGRLEKARXNMIELMEELNIVD--LSLGEPVWLRGSQ-------------PNTGT
A0A258AXR6      QISDQEGLRSQAQVRSQEARRKAGIVGDWIVGGGSSLNPGGE-------------MRSEK
A0A3D3NZQ6      QITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNSTVPGAE-------------LRTTG
A0A1T4WVZ9      QIAEQEQLRDQARLKMQEAKKKGGIVGEWFSSGTNSTAPGAN-------------LRTTE
A0A4R7SSI6      QISEQEQLRDQARLKMQEARKKGGIVGEWFSNGSNSTAPGST-------------LRTKE
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      SLARLSTELSDGIL----------------------------------------------
A0A258AXL1      NTAR--------------------------------------------------------
A0A2E6T1E0      EEAA--------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ---ASTLADNLKES----------------------------------------------
A0A2V6N5E0      LDRAQNKTEAASGQ----------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ---------------------------------TLRKIESLR------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      RLLMLQKQIRLERA-------------------KAALAD---------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      TSQALEKEIFDLET-------------------QIKLASTLADNLKE-------------
A0A2N8IV96      QAMDFERREKELAS-------------------YVQELQRLPDD----------------
R7E1V8          QAMQFEKDEKELAS-------------------YVQELQRLPDD----------------
A0A1T4WWY4      IPVDIVRAKYRLKEHEEISRILQEQQSSLDVIGKLSLISGFTDEEKDPLEAGRVVRKGG-
A0A3D3LEQ6      VPVQQVRVRYKLQEMDGVRQVLKDQGGTLDTVGTLALLTSMTSDKDDPLSVGRIVRRTGD
A0A3D3NW23      VPVQQVRVRYKLQEMDGVRQVLKDQGGTLDTVGTLALLTSMTSDKDDPLSVGRIVRRTGD
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      ELESIGKELTVSKN-------------------EKLKLDTDWKM----------------
A0A2G4I5Z5      EFKSLSERRSAATD-------------------ERRDMERDFEM----------------
A0A4P5QQV6      YLSKLNTRLAELRN-------------------ESQLLDLFDADQQI-------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      KVGLLGNDLAQAQL-------------------EQTTLQTLIQL----------------
A0A290QD69      KVTMLGNSLAEAEL-------------------RQTNLRTLIES----------------
A0A2E7VDS1      RKSQYQGAITLAQV-------------------EKLRIQSTLRQIIAIQGRVEQSTRTTK
A0A178IFJ2      RMKAISSALTEAQV-------------------ALLAIEARLQQ----------------
A0A357FSP9      QLSSLNTIKIENKH-------------------LYDNLETRINL----------------
A0A538NJ59      SLARLSTELSDGIL-------------------QTQLLESRALGLE--------------
A0A3C1VFY9      YLSVLYQRLAESKS-------------------EYDLLQSMTLDQNLLLEQGRSPALAGA
A0A522AC27      YLASLTRKLADLKS-------------------EYDLLTTMTLDQN--IERQRQQGVAST
A0A2A2R174      EFKALNERRAVATD-------------------ERRDVERDFEM----------------
A0A1H2DTI1      HLAQLNNQLVDRRN-------------------EYDLLVKLTAKQGDLQGLP--------
A0A1V5L462      RLSELKTRLEDYRT-------------------QLRILESFD------------------
A0A2A2R3V9      YLINLSKQLDDLNT-------------------EFQLLSKLTLDQNIERRSTNTSKPQTT
A0A3D3LGD3      DSMAVTREQAIFQADLDVETLSA----------EIGQLQTLEGDELVARAGGLKLDNAN-
A0A350ARX4      YLARLTTQQAELKT-------------------QLLILE---------------------
B5JIS2          RLKGIDANRIEARL-------------------DRFRLETKLGN----------------
A0A1H2GQN6      QLDDARQDAVARRV-------------------RYEQLKNLSTEDLIDTLPSLGLNDAN-
A0A512M3Y3      RMDSMQQVIEMIESGKLPAV-------------EQLSLLKKFRGTPVPVGTIMRNSRPDE
A0A4P5R5J1      YLSILNRRLDELKT-------------------EFNLLQRLDIDQTLDRTPSVA------
A0A4P5YK43      RLNRLTAELDEIVL-------------------VRKRLESYTKDELLEGKMPEILSKNPA
A0A2A2RPW6      DFKAMAEKLNEAKD-------------------EVRLLELEWGM----------------
B4D1I7          YLAKLNTQLAEFKK-------------------EAQLLDLFQLDQKIA------------
A0A353F286      KLANFETQADQIKI-------------------QIGKLVQL-------------------
A0A354FSA6      KLANFETQADQIKI-------------------QIGKLVQL-------------------
A0A3B9GA54      KLANFETQADQIKI-------------------QIGKLVQL-------------------
A0A520LEH8      KLANFETQADQIKI-------------------QIGKLVQL-------------------
A0A6B2M0T8      RMKNLSGSLNDAKV-------------------ELLNLSATLEK----------------
A0A2D7B7R6      KNNSDRLVLDNLKL-------------------ELSRIQNDLEDLESVGYVDAASEKARP
B1ZT68          KVGTVGTALVRAQM-------------------EQVEMRSVLDK----------------
W0J7C2          KMSSLGTAVVAATL-------------------DQIDAKSLIDK----------------
A0A2E5K4P7      ELTVLREHLIKKDD-------------------VRKAVESRWQQ----------------
A0A0R2XPB1      YLAELKRELAELNT-------------------ENRVLTSILNVDAVKMSL---------
A0A348NQP1      YLAELKRELAELNT-------------------ENRVLTSILNVDAAKMSL---------
A0A357FV58      YLAELKRELAELNT-------------------ENRVLTSILNVDAAKMSL---------
A0A2V6F9Q9      YLVKLNQDFARLKT-------------------EYELLQKLDLDQNLDRGEKTKTEASPG
A0A2V6NZZ3      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A2V6EBU2      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A2V6EY06      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A2V6ME53      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A538NUU0      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEKTQTEASPN
A0A2V6NIJ1      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEK--TESSPG
A0A2V6C292      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEK--TESSPG
A0A2V6D2X0      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGEK--TESSPG
A0A2V5ZUK1      YLVKLNQQYAQLKT-------------------EYALLNLLDLDQNLDRAQT-KLDS-SS
A0A2V5XFN9      YLVKLNQQYAQLKT-------------------EYALLNLLDLDQNLDRAQN-RTETAAS
A0A2V6EZC8      YLVKLNQQYAQLKT-------------------EYALLNLLDLDQNLDRAQN-RTETAAS
A0A2V6I7Z5      YLVKLNQQYAQLKT-------------------EYALLNLLDLDQNLDRAQN-RTETAAS
A0A3B9LCP2      YLVKLNREYAGLKT-------------------EHDLLSLLDLDQNLDRAQI-KPESLAN
A0A3C0R669      YLVKLNREYAGLKT-------------------EHDLLSLLDLDQNLDRAQI-KPESLAN
A0A2V6EID2      YLVRLNRDYAGLKT-------------------EYDLLNLLDLDQNLDRAQN-KSEMNLG
A0A2V6MHB0      YLVRLNRDYAGLKT-------------------EYDLLNLLDLDQNLDRAQN-KSEMNLG
A0A2W5YWL9      YLVKLNQDYARLKT-------------------EYELLEKLDLDQNLDRGQS-TAKPEAS
A0A2V5NH62      YLVRLNQQYAQLKT-------------------EYDLLSLLDLDQNLDRAQG-KNDMPSA
A0A2W6A620      YLVRLNQQYAQLKT-------------------EYDLLSLLDLDQNLDRTSG-KNDGTTP
A0A2V5PIJ4      YLVKLNQSFAALKT-------------------EYDLLSMLDLDQNLDRKQV-QPDGAGS
A0A2V6K2G8      YLVKLNQQYAQLKT-------------------EYDLLNLLDLDQNLDRAQN-KMDSAGG
A0A2V5W206      YLVKLNQQYAQLKT-------------------EYDLLNLLDLDQNLDRAQN-KTEAASG
A0A2V6MW77      YLVKLNQQYAQLKT-------------------EYDLLNLLDLDQNLDRAQN-KTEAASG
A0A2G4GZN8      ERSVLVRDREETRK-------------------QIDENEILVLV----------------
A0A348NPT1      QLSSLNTIKIENKH-------------------LYDNLETRINL----------------
A0A2E1KV60      ELASLNQIKTAAKM-------------------ELDQSETRWNL----------------
A0A2D7F4D9      QLASLNEIKTMAKM-------------------NLDQAEIRWNL----------------
A0A3R7RBR8      QLASLNEIKTMAKM-------------------NLDQAEIRWNL----------------
A0A2E0NH28      QLMTLNAIKSGNKN-------------------QFDAQETQWNL----------------
A0A350AS32      QLASLNEMKLNAKN-------------------VYDMIETKWNL----------------
A0A368BGT4      QLAHLNEIVLTNKN-------------------TYDQFQTKWNQ----------------
A0A2E0V4K6      ------------------------------------------------------------
A0A2E6NAH3      QLSHLNEIELTNKN-------------------IYDQFQTKWDQ----------------
A0A2A5VZA5      QLVTLNQIKLESKN-------------------NYDQLDTKWNL----------------
A0A424R295      QLVTLNQIKLESKN-------------------NYDQLDTKWNL----------------
B4CZV9          RIDEIGRVRVRLQDPAL----------------DSVAKLSLIASADDNDTRLSVGQTVAQ
A0A290QE54      RLKTVNAALSSARL-------------------DRLQLEELNNQI---------------
A0A1H1SWX2      RLRTVNATLTTARL-------------------ARLDIETLLSQI---------------
A0A4Q1C9I5      RLRGYNTSLTDARN-------------------ARIAIENRLAQI---------------
A0A3B9FM17      RKSQFSSEVTKSRL-------------------EQIRINSLLRQILAIKTRIGSNSNSVS
A0A1G3ZL71      QLRRANEARTAARH-------------------ERLRVENLFRQ----------------
A0A556QP09      NLSSVNQALQGARL-------------------DRLAIAEQERL----------------
A0A2T6DX88      RLKSVNAALQTARL-------------------ERLSIEEQVNQ----------------
A0A2T6CWI7      ALKKAHTMRDDARL-------------------RLMAVDEKITQ----------------
A0A3E1E5C8      RLTTVNDALTKARL-------------------ARIDLETQYHQ----------------
B1ZZ74          RLKTISSTLTSAQL-------------------VRLNFENQYAL----------------
R7E4L8          RVQEIGTELFSTRT-------------------ELIQVKVLARLLAD-------------
A0A4Q3BVY2      RLARMRDVRILLTNLENKASAEGSEGGTGSDQ-KIGNMMSLLSLLGSFENEAEVNVGDIV
A0A4P6PCA7      ILADLGTQKAGLEN-------------------QLALRQTEYDYLSEW------------
A0A0E3YV65      RMKALSSTVTGARV-------------------SRVTIEARLNQ----------------
W0J900          RMKAISSALTEAQV-------------------ARFAINARLQQ----------------
A0A2T6DSN5      KVVQLGQSLVGIEL-------------------EQTNLRTILET----------------
A0A2V2SMX4      YLTALNQRLAGLKS-------------------ELELLRTMSVEQTLER-----------
A0A317ZIW7      YLADLKRRLAELKT-------------------ESRTLSSISDS----------------
A0A2D7WMI4      RKSQYQSEITRCNI-------------------EQLRLDSTLSQIRSILKRINSNKE---
A0A2D6VHX5      KKSQFQAKITASKL-------------------DQIQINSILRQILDIRKRISSNKESSI
A0A2D8I214      RKSQYSAEVTTSKL-------------------EQIKIDSLLRQVLQIQARIGSRNSSS-
A0A1Z8VL41      RXSQYQSEITRSKX-------------------XQXKITTLLKQIINVRVNIGVQNESL-
A0A2E6TNA4      RKSQYQSEITKSKL-------------------EQIKITTLLKQIINVRXNXGXQNESX-
A0A1Z8RG47      RKSRYQAEITKCKL-------------------EQIRINSLLRQILQIQMRIGNETSSL-
A0A1Z8RJJ5      RKSRYQAEITKCKL-------------------EQIRINSLLRQILQIQMRIGNETSSL-
A0A2D7V631      RKSQYQAEITRCKL-------------------EQIRINSLLRQILQIQMRIGAQTSSL-
A0A354RA24      RKSQYQAEITRCKL-------------------EQIRINSLLRQILQIQMRIGAQTSSL-
A0A2E9RV62      RKSSYHSEITKAKV-------------------EKVRINSLLRQIIQIQASISSRIQND-
A0A2E4AY96      KKSQYQAEITRCRI-------------------ERLRIESLKSQVLAVDNKI----KSR-
A0A3B9B9P4      KKSQYQAEITRCRI-------------------ERLRIESLKSQVLAVDNKI----KSR-
A0A2D5Y6N6      RKSQYQSEITSSKL-------------------EQIRINSLLRQILQIQVRIGSQSEST-
A0A2E7HSS8      RKSQYSEEVTKSRL-------------------EQIRINSLLRQILAIKTRIGSGSDSV-
A0A2D8VCK3      RKSQFSSEVTKSRL-------------------EQIRINSLLRQILAIKTRIGSNSNSV-
A0A350QVY4      RKSQFSSEVTKSRL-------------------EQIRINSLLRQILAIKTRIGSSTNSV-
A0A2E4ZYR7      RKSQYQSAITQAQV-------------------EKLKIQSTLRQIIAIQGRVERATNAV-
A0A2E6TCV1      RKSQYQNAITTADV-------------------KLLEIDSHLVSIRGIHNKVVQSLKAL-
A0A3D4HHL8      YLAELNQQLAELET-------------------QYRFLDTLSLDAIGERA----------
A0A366HV03      IPLDILRVQHRMRQYDEVRGIVQSRSQNSVIA-PLEHLSLLESAKKSSLDENPVGQLVV-
A0A6G6K911      IPLDILRVQHKIRQYDEVRSIVESRVQNGAMD-PLEHLSLLDSAKKSSLDENPVGQLVV-
A0A5R8KAF2      VPAELIMTKEVVRRMEEVRLSLDQRGTLGTAPEKLTAEQIFAELSMLTAFEKERELRVG-
A0A2V2SDN0      YLALLNRQLATLRT-------------------ELQLLQLVQPDQ---------------
A0A1V6GL40      YLTTLYQRLVTLKS-------------------EYALLQRLTLDQNLARRQAAGGTFSL-
A0A2V5X6Z6      YLASLNKQLATLRT-------------------ELRLLQSLQPEQ---------------
A0A2V5VGZ7      YLASLNKQLATLRT-------------------ELRLLQSLQPEQ---------------
A0A2V5U130      YLASLNKQLATLRT-------------------ELRLLQSLQPEQ---------------
A0A2V6C237      YLASLNKQLATLRT-------------------ELRLLQSLQPEQ---------------
A0A3R8L982      RLTSVNAALQTARL-------------------ERLAIENLNNQVEA-------------
A0A2E7HPU9      -------------K-------------------ENALANYQIILLTL-------------
A0A388PR45      QRSKLIQDREDYRK-------------------QLDEIGIVVALVAQ-------------
A0A388QR61      QRAKLIQDREEYRK-------------------QVDEVGIVVALVKQ-------------
A0A4P5YHI0      QRAKLIQDREEYRK-------------------QVDEVGIVVALVKQ-------------
A0A2A2RS01      ERGVLVRNREDARK-------------------QIDELEIIWKLILE-------------
A0A2A2Y1A7      ERGVLVRNREDARK-------------------QIDELEIIWKLILE-------------
A0A388PDH9      ERGVLVRNREDARK-------------------QIDELEIIWKLILE-------------
A0A2G4H1E7      ERSVLVRDREETRK-------------------QIDENEILVLVIAS-------------
A0A2G4GZA6      ERSVLVKDREETRK-------------------QIDENEILVSVIAS-------------
A0A388P514      ERSVLVKDREETRK-------------------QIDENEILVSVIAS-------------
A0A2A2YG59      ERSVLVKDREETRK-------------------QIDENEILVSVIAS-------------
A0A2G4F7D5      ERSVLVKDREETRK-------------------QIDENEILVSVIAS-------------
D5EML0          DAL----------T-------------------DAEIRQLSVETRQR-------------
A0A3C1C1M3      SLLHFNESLSEVEA-------------------KASMEQ-----KML-------------
A0A2E9EYJ1      ASLVMAAKQREFAA-------------------EEAIQNLRSTIKSL-------------
A0A258AXR6      DSMVISREQALMIA-------------------DQEILTLQSEIDQV-------------
A0A3D3NZQ6      DSMAVTREQAIFQA-------------------DLDVETLSAEIGQL-------------
A0A1T4WVZ9      DSMVVTREQALLNT-------------------ELEVQALQAEIAEL-------------
A0A4R7SSI6      ESMVMSREQALLQA-------------------DLEVQSLRAEIDEL-------------
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      -----------QTQLLESRALGLEANGPVGAGVSVGLNGPLLGADSEIPS---TGTSERQ
A0A258AXL1      ---------------------------RLSPEVG--AATPEASTTTIVTPQVAKRANEWE
A0A2E6T1E0      ---------------------------RVFHETKQYGTIPEVATDTEVRK----------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      -----------------------------------------ERKQGLISVETGLPDSGIA
A0A2V6N5E0      -----------------------------------------GSDNQGMPFSDVGPEGDYL
A0A2V6NH44      ------------------------------------------------PFSDVGPEGDYL
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ---------------ERLLHAATSIDAIPLVAG--------NPLIQDM------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      -----------IESQAEYVRQATRLDRLKNLGKELGPEGLAQAITTDAPDTLLTSL----
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      -----------GRAGVPENPYTLEI-----------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      -----------SERKHGLISVETGLPDSGIARQ---------------------------
A0A2N8IV96      -----------KLLDYVISSDLLNAETVGADAL--------RKTYAEF------------
R7E1V8          -----------KLLDYVISSDLLNAESVGAKAL--------RETYAEF------------
A0A1T4WWY4      --AVAPFTFSSPSTDKKFTQVVVQPNMVDGLKS--------WQELERT------------
A0A3D3LEQ6      PRTSAPATFQTPEMAKEYNQIVVQPDMVEGIEP--------WRELDKK------------
A0A3D3NW23      PRTSAPATFQTPEMAKEYNQIVVQPDMVEGIEP--------WRELDKK------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      -----------IQQYSNNVERLLTVQSILDDKQ--------VSALRTQ------------
A0A2G4I5Z5      -----------TRRVGGKVSELLILASISRAPE--------VAALKEK------------
A0A4P5QQV6      -----------ARDRKMPKPDGGDLREGDPRIPSATGPLLEYERARQR------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      -----------IEDYRKRGQSLYEISAIIGFGN--------VASLKTQ------------
A0A290QD69      -----------VEDYQKNNKNILEISDIASYGN--------VSEMKTR------------
A0A2E7VDS1      DNEHAR-----TNDEMEKIKEYFEISAVETYGN--------VQALRQK------------
A0A178IFJ2      -----------AESVIAKNSSPLELASITEFSS--------LASVQSQ------------
A0A357FSP9      -----------IESFRRAGRNLSELPFIAEQGQ--------VSQL---------------
A0A538NJ59      -ANGPVGAGVSVGLNGPLLGADSEIASTGTSER---------QGASRD------------
A0A3C1VFY9      GMPGGLGTGNGILANAALGGQSTLFAPSTMGMQ--------YLSIKQQ------------
A0A522AC27      SSEAGSERGG--------GGRNANYE----------------LTYQKR------------
A0A2A2R174      -----------TRRVGVKVAELLTLSTVSRVPE--------VVALKEK------------
A0A1H2DTI1      -----------VVAGASNSQQESRMRLAAATTE--------FFKAQQK------------
A0A1V5L462      -----------ENVSLDQIQDVVNLDTIESSQN--------YRNTKRQ------------
A0A2A2R3V9      TKNPATTNTAEKRTPDSEEIKAAAGDLLSPESE--------YRNSNQQ------------
A0A3D3LGD3      -----------------------------------------VAQMTGE------------
A0A350ARX4      -----------NLKTGDITTSVVEQSPLIEAES--------VALLNKT------------
B5JIS2          -----------VKAALGEDGRPFDNPFLANFAN--------NERLRQE------------
A0A1H2GQN6      -----------------------------------------IDQIRQQ------------
A0A512M3Y3      VVSIAAPIAGSTVAGLSSDSPSAPIPAVPAGASAGAMMIAAMSQPKIVVPSMVEELEPWE
A0A4P5R5J1      -----------TGAEGQLNRMDSLAGAPGPLAE--------YLKVKQA------------
A0A4P5YK43      KDAASA-----VTAGPDKSKTADPLAPFRQNSY--------TEH----------------
A0A2A2RPW6      -----------SQKVGNSVDELLKLPMISRSPE--------VAALKEK------------
B4D1I7          -----------ADESRAGDKDGERNPRLTGQPE--------MEYTHAR------------
A0A353F286      -----------TSEELISYAAGLDLPQNQVTAY--------A------------------
A0A354FSA6      -----------TSEELISYAAGLDLPQNQVTAY--------A------------------
A0A3B9GA54      -----------TSEELISYAAGLDLPQNQVTAY--------A------------------
A0A520LEH8      -----------TSEELISYAAGLDLPQNQVTAY--------A------------------
A0A6B2M0T8      -----------IQEAKGDLDLLAKLPAINQMGT--------LPSKFES------------
A0A2D7B7R6      -----------DNLTNEQLEIVSLIPSVAKNED--------FKSINGL------------
B1ZT68          -----------IDEYRKEGKDLFEIPAILGYGQ--------VSALRTR------------
W0J7C2          -----------IEEYQAGNRDLLEITQIRTSGQ--------VADLNNS------------
A0A2E5K4P7      -----------LLAYEAEGRSLLDLGFISNTTH--------VATL---------------
A0A0R2XPB1      -----------LLDQWQGAEDTSSATTGGSAGD--------NQSYQLS------------
A0A348NQP1      -----------LLDQWQGAEDTSIAASGGSDGD--------DQSYQYS------------
A0A357FV58      -----------LLDQWQGAEDTSIAASGGSDGD--------DQSYQYS------------
A0A2V6F9Q9      --------------ASPTDQAGMPFSDVGPEGD--------YLKAKQQ------------
A0A2V6NZZ3      --------------PSANDQVGMPFSDVGPEGD--------YLKAKQQ------------
A0A2V6EBU2      --------------PSANDQVGMPFSDVGPEGD--------YLKAKQQ------------
A0A2V6EY06      --------------PSANDQVGMPFSDVGPEGD--------YLKAKQQ------------
A0A2V6ME53      --------------PSANDQVGMPFSDVGPEGD--------YLKAKQQ------------
A0A538NUU0      --------------PSANDQVGMPFSDVGPEGD--------YLKAKQQ------------
A0A2V6NIJ1      --------------ASPTDQVGMPFSDVGPEGD--------YLKAKQQ------------
A0A2V6C292      --------------ASPTDQVGMPFSDVGPEGD--------YLKAKQQ------------
A0A2V6D2X0      --------------ASPTDQVGMPFSDVGPEGD--------YLKAKQQ------------
A0A2V5ZUK1      --------------GQASDNQGLPFADVGPEAD--------YLKAKQQ------------
A0A2V5XFN9      --------------NQPVENGGLPFSDVGPEAD--------YLKAKQQ------------
A0A2V6EZC8      --------------NQPVENGGLPFSDVGPEAD--------YLKAKQQ------------
A0A2V6I7Z5      --------------NQPVENGGLPFSDVGPEAD--------YLKAKQQ------------
A0A3B9LCP2      --------------GQTAEDQGLPFAGVGPEGD--------YLKAKQQ------------
A0A3C0R669      --------------GQTAEDQGLPFAGVGPEGD--------YLKAKQQ------------
A0A2V6EID2      --------------GQSTEDQGMPFSGVGPEGE--------YLKAKQA------------
A0A2V6MHB0      --------------GQSTEDQGMPFSGVGPEGE--------YLKAKQA------------
A0A2W5YWL9      P----------SASASEQT--GMPFSDVGPEGD--------YLKAKQT------------
A0A2V5NH62      P----------NTQSNDDKPPGMAFSDVGPEGD--------YLKAKQA------------
A0A2W6A620      P----------STQSTDEKAPGMAFSDVGPEAD--------YLKAKQT------------
A0A2V5PIJ4      T----------NTQPSDDSA-GMAFTDRGPEGD--------YLKAKQA------------
A0A2V6K2G8      A----------N--PGSDNQ-GLPFSDVGPEGD--------YLKAKQQ------------
A0A2V5W206      --------------QGSDNQ-GMPFSDVGPEGD--------YLKAKQQ------------
A0A2V6MW77      --------------QGSDNQ-GMPFSDVGPEGD--------YLKAKQQ------------
A0A2G4GZN8      -----------IASYESEGRPVGDIPQIRADND--------VAAA---------------
A0A348NPT1      -----------IESFRRAGRNLSELPFIAEQGQ--------VSQL---------------
A0A2E1KV60      -----------IQDYLRQNKDLWELPFISQQIR--------VASL---------------
A0A2D7F4D9      -----------TQDYQKQGKELWELPFISEQIR--------VATL---------------
A0A3R7RBR8      -----------TQDYQKQGKELWELPFISEQIR--------VATL---------------
A0A2E0NH28      -----------IESYRRDGRDLWELSFIADQSR--------VAFM---------------
A0A350AS32      -----------VESYRREQRDLWELSFISEQSR--------VASL---------------
A0A368BGT4      -----------VETYRKEGRNLWELAFVAEQLR--------VSSL---------------
A0A2E0V4K6      ------------------------------------------------------------
A0A2E6NAH3      -----------IETYRLEGRNLWELPFVAEQSR--------VASL---------------
A0A2A5VZA5      -----------IETYKREERKLWQLTFVAEQSR--------VSRL---------------
A0A424R295      -----------IETYKREERKLWQLTFVAEQSR--------VSRL---------------
B4CZV9          PQSGQSADKKDAAANNSVVVVPSLLKSLHPWDE--------LAQQQQQ------------
A0A290QE54      -----------ASFKKDA-RNLLEIAAISNHGT--------IPAVSSQ------------
A0A1H1SWX2      -----------EKMQKENPANLLEIGYISAYGN--------IPVLKNN------------
A0A4Q1C9I5      -----------ERMQQAG-GNLLDIDYISAYGN--------VAALKTQ------------
A0A3B9FM17      SKD--------IKDDIAVIKEFFEIDAIEQFGN--------IPALRQT------------
A0A1G3ZL71      -----------VEAYRQNGRDLLELSEITGYGN--------IPALRNQ------------
A0A556QP09      -----------VERYQAEKRNLLEITAIAAYGS--------VPDLSKQ------------
A0A2T6DX88      -----------VASYKREGRDLLQISSIANHGT--------IPAIRTQ------------
A0A2T6CWI7      -----------VEAYQKEKRNLFEVVEIANYGA--------VPSLRAQ------------
A0A3E1E5C8      -----------VEAYRKEGRNLMEIAYIAGHAT--------VPTLKNQ------------
B1ZZ74          -----------VEAYRKEGRNLVEIQFIAGHGT--------VPTLSAQ------------
R7E4L8          -----------RSRQQDMIPANIGIQDAGIAKQ--------IELFNDN------------
A0A4Q3BVY2      PNGQFKGSLTSVKTPETNIVSPAEVDSIEPWRK--------LEKERRL------------
A0A4P6PCA7      -----------EESGRSIETLPTGLPKEQQLYE--------LLGVWQT------------
A0A0E3YV65      -----------AEFIMAGGGDPLELAAATEFAN--------LSAVQSQ------------
W0J900          -----------AESIISKNSDPLELASVTEFSS--------LASVQSQ------------
A0A2T6DSN5      -----------IETYQKNNRDLMEIPQIASFGG--------VGALRGE------------
A0A2V2SMX4      -----------RQQGGGVLPAPEPVADVNNSAS--------SSLSAND--SSQNDYFKAK
A0A317ZIW7      -----------SEVEELILKDVPTPDDGSSDGT--------IVSAIGS----KEDNEKYT
A0A2D7WMI4      ----SSNS---IEERFELFSEIFKIDEIENFAN--------IPALRSS------------
A0A2D6VHX5      DSTNTGVD---VESNIAQIKQYFEIDVIEGFGS--------IPSLRQE------------
A0A2D8I214      ----RSKD---IDNDIALIKDFFEIDAIESFGN--------VPSLRKT------------
A0A1Z8VL41      ----KSQD---IETDIAMIKEFFEIDAIESYGS--------VPALRKN------------
A0A2E6TNA4      ----KSQD---XEXDXAXIKEXFXIDAIESYGX--------VPAXRKN------------
A0A1Z8RG47      ----QSAD---VAGDIAVIKEFFELDAIESYGN--------IPSLRQT------------
A0A1Z8RJJ5      ----QSAD---VAGDIAVIKEFFELDAIESYGN--------IPSLRQT------------
A0A2D7V631      ----KSDD---VEGDIAVIKEFFELDAIETYGS--------IPSLRKT------------
A0A354RA24      ----KSDD---VEGDIAVIKEFFELDAIETYGS--------IPSLRKT------------
A0A2E9RV62      ----GASKD--VNANIDAIKEYFKIDAIESFGN--------VPALQKR------------
A0A2E4AY96      ----KVES---IEERYALFGEFFKIKEINQFGR--------IAFLRED------------
A0A3B9B9P4      ----KVES---IEERYALFGEFFKIKEINQFGR--------IAFLRED------------
A0A2D5Y6N6      ----SSQD---IDDDIAVIKEFFEIDAIESYGS--------IPSLRQN------------
A0A2E7HSS8      ----SSKD---VNDDIAVIKEFFEIDAIEEYGN--------IPSLRQT------------
A0A2D8VCK3      ----SSKD---IKDDIAVIKEFFEIDAIEQFGN--------IPALRQT------------
A0A350QVY4      ----SSKD---IKDDIAVIKEFFEIDAIEQFGN--------IPALRQT------------
A0A2E4ZYR7      ----KDNEHARANAETDKIKEYFEISAIEGYGN--------VQTLRQK------------
A0A2E6TCV1      ----TATGPARTTAKIKIIEDFFKISAIAEYGN--------VNSLRTE------------
A0A3D4HHL8      -------Q---AVAELAKAKRKNNTEVVPAENH--------SGAALTSELYKLSEQYLVA
A0A366HV03      ----PASG---DLKDALLVPSNSPAPLAAP-SI--------VVQPSMV---EGLNSWQML
A0A6G6K911      ----PATG---DLKDNLLTPSVAPVAAITPSSI--------VVQPSMV---EGLNPWHTL
A0A5R8KAF2      ----DLLR---RQSQQGMVDKPEGAPAQPVPAS--------FVVQPNM--VEGLRPWQDL
A0A2V2SDN0      -------W---VEIGSRTRPSGPGEPP-AGEAS--------PQDIMAGLTGPQSDLFRAN
A0A1V6GL40      ----GNEP---LAEGNDSLPDTNAVALTAGGTP--------GQSSTAAGDRGDTAYLQAQ
A0A2V5X6Z6      -------W---IETGHKGVPSG----------E--------MLASLAE---PQLELFKAN
A0A2V5VGZ7      -------W---IEAGHKVVPSSESLPDQATEKE--------MLASLAE---PQLELFKAN
A0A2V5U130      -------W---IETGHKGVPAGESLPDPATEKE--------MLASLAE---PQLELFKAN
A0A2V6C237      -------W---IETGHKGVPSGESLPDQAAEKE--------MLASLAE---PQLELFKAN
A0A3R8L982      -------F---RKDNKDL----IELNIISTYGT--------VPALRAQ------------
A0A2E7HPU9      -------E---DLEKREA------------------------------------------
A0A388PR45      -------Y---RAAGRDL----SEIPLVRSDAD--------VAAARAK------------
A0A388QR61      -------Y---RVAGRDL----AEIPLVRADVE--------VTNTRNK------------
A0A4P5YHI0      -------Y---RVAGRDL----AEIPLVRADVE--------VTNTRNK------------
A0A2A2RS01      -------Y---KTAGKDA----YDIAQVRTDER--------VAALGPK------------
A0A2A2Y1A7      -------Y---KTAGKDA----YDIAQVRTDER--------VAALGPK------------
A0A388PDH9      -------Y---KKATKDV----YDIAQVRTDER--------VAALGPK------------
A0A2G4H1E7      -------Y---EQEGRSL----GDIPQIRADTD--------VATTLTA------------
A0A2G4GZA6      -------Y---EKESRPL----GDIPQIRADTD--------VAAVQMV------------
A0A388P514      -------Y---EKEGRPL----GDIPQIRADSD--------VAATQTA------------
A0A2A2YG59      -------Y---EKEGRPL----GDIPQIRADSD--------VAATQTA------------
A0A2G4F7D5      -------Y---EKEGRPL----GDIPQIRADSD--------VAATQTA------------
D5EML0          -------Q---IAAADGVIDRLMEIPYIGERDA--------VNAVYAQ------------
A0A3C1C1M3      -------D---ALSEGKLPAEIPG------AAD--------VAASLDR------------
A0A2E9EYJ1      -------T---QLEGAELIKSAVDLGV--KNET--------LNSGWSE------------
A0A258AXR6      -------S---KLTPDELIDQASGLRL--ENQN--------ITAITVK------------
A0A3D3NZQ6      -------Q---TLEGDELVARAGGLKL--DNAN--------VAQMTGE------------
A0A1T4WVZ9      -------S---KLSDEELVARSSGLKL--ENAN--------VTNMLAE------------
A0A4R7SSI6      -------S---KLEGDELVSRASGLKL--ENTN--------VTGMMAD------------
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A2V5UAD5      GASRDLELLKLQRERLSKFLRPKHPKIAQLDTQIQRAEKLIELFRNQSR---------EQ
A0A258AXL1      YIEGQLHSSEREYERLSNSLLPGHEKMRELRKQIENYQFSLDAEWKKQI---------AS
A0A2E6T1E0      -IRGDLALAEAELAELLKRYLDKHPKVIEKRGKIESLIEGLASSQKRIF---------DS
A0A2D5W0Q9      ----------------------------------------------------------PN
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      RQIEHYNEAYLEYQKIAGSAGSQNPITVSLKDRMNSTRAAANKALSNYR---------SN
A0A2V6N5E0      KAKQQIQLLKAERETLAKDLRPNHPKILKLNDEITKQDKLIQLFRADAL---------EK
A0A2V6NH44      KAKQQVQLLKAERDTLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAF---------EK
A0A432FDF6      -----------TLANHGIDLGEEHPRIKGLKKVVATLEGQIDNRIKGIL---------AG
A0A522ACN3      ------NIAEQRLLALRKEHGEDHPEVINTQKQIDLLNTKIEARVSGIM---------YS
A0A353DCA1      ------------------------------------MKQMV-------------------
A0A3C1AXQ2      ---------------VNSGRGREHPEVEGVDSQILLSKQLILDAVKSHL---------SA
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      --------------------------MIQLLQRLQESEIELTEAVTNST---------DK
A0A3D3DET9      ------MLLRVEQQELGRYLRPNHPKMIAMQEDIARREELLKILRTQSE---------EQ
A0A355SVK9      -----------------------EVELVSAVEN--------------SV---------GK
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      -----------------------HPKIIAATEEIAHLERLLPIYREQSN---------EQ
A0A2V6FIP7      --RKSLAEREALLANLLKRYKDKYPDVIRVREEIASLKESIQKESQKVR---------QA
A0A353DI77      ----EMAVAEKAVQDLSIRYGPKHPKIISATDHIDLKTKILLSAMMDVLSNDLETDYWRG
A0A1V6GCZ3      --LDQLTMAEQRLIALEADYGPENTEVLKCKGLAEDLHKKIKSRVEGIM---------LG
A0A3C1UJT2      --NGLYKAAKTTVRNLEVDLKSKHPLMIDALRNVNNTRRVLLETISDVP---------KG
A0A2S7U0Z3      --SEQIQEKRNQVIILRQRYLPKHPARIQEEALYTDLLESFGGAIKRSSGKPSEKSYWLE
A0A5E6MKA7      --KKLLLKEVARYQQMEETYKPEYPGMTRLHAEIEGLKGELAQEKEGSV---------AD
A0A6B3L936      --NQELNTFRSELSAFRQRYKSKHPRLIEAEAIYQDLYRRFRLEIETAARTGDEVDYWKP
A0A2N8IR72      --IEHYNEAYLEYQKIAGSAGSQNPIAVSLRDRMNSTRAAANKALSNYR---------SN
A0A2N8IV96      --SDKLKEKEN---LKSQNIGARHPKMLALLETERILGDKLNKELIGLR---------SS
R7E1V8          --SDKLKEKEN---LKAQNIGARHPKMLALLETERILGEKLNKELIGLR---------SS
A0A1T4WWY4      -----KRATEEKLRLIQTKFLDDHPEVIKLKDELKQVESALDIELKVAL---------TS
A0A3D3LEQ6      -----KRSLEEKMAQSRAKFLDDHPEMIKLREELRETVSALELELQVAR---------RA
A0A3D3NW23      -----KRSLEEKMAQSRAKFLDDHPEMIKLREELRETVSALELELQVAR---------RA
A0A2E0R252      --SDEIRGSETAIAQMEKRYLPKWPALVEAKELGAILKKNFSKELDQVI---------RL
A0A3E1EF48      --SKRIETTRIAIIEMEKRYLPKWPDLIEAKELLALLLNRFSTELAQVI---------AG
A0A2A2PVG8      --SKEIDEAERQVAEMEKRYLPKWPALVEAKELLKILQDRFVQEFNQVM---------NL
A0A2E0R421      --ITEIKLVESRIAGMEKRYLPKWPALVESKEHSKILKQRFSAELERVL---------RL
A0A2E5EJ69      -----ELEKRSEISQLEERYREKHPKMIAARKEVVDLGARLQEAILAAP---------SK
A0A2G4I5Z5      -----LQVQEATLANHQLRYREKHPEMIKAKTELESIRQQFEVEVLKAP---------LR
A0A4P5QQV6      --IETLKAERA---GYARDLTPRHPIMVELDEQIAQQQQLIDTFRKQST---------EE
A0A2E7ALI1      --LLELEAIKVS--DLARRYRAKHPKMISTVAKLEDSRKKFMSEFLVAA---------SS
A0A178IDB9      --YENILAERT---ALAERYLEEHPRMRQNALALADTRARLDAAVDLAI---------AE
A0A290QD69      --IDTLRAERR---QLDERYLSEHPRMKQNQLAMEDAEAGFKSAVDLAI---------AE
A0A2E7VDS1      --LLDLETTRK---AFEVKYLEKHPKMSANTRAVQELHRLLRLEVKTAI---------KD
A0A178IFJ2      --LDELVARKA---VMAEKYGRRHPAMIDQERSIQALEKLRGDLILTAV---------AN
A0A357FSP9      --LSQISAIKIGISSSSKRYREKHPVMIEQQQTLQESEVELAAAVKDSV---------DK
A0A538NJ59      --LELLKLQRE---RLSKFLRPKHPKITQLDTQIQRAEKLIELFRNQSR---------EQ
A0A3C1VFY9      --ILLLKAEQD---RFGEFLKPKHPKMVAMNEESEKMGRLLGIYRDQSV---------EQ
A0A522AC27      --TVLL-AEKE---RLEEYLRPKHPRLIGINEEIAQQERLLNTYRKQTS---------EY
A0A2A2R174      -----LQAQEAVLVNHQLRYKEKHPEMIKARAELESIRQQFEAEVLKAP---------LR
A0A1H2DTI1      -AQERITELETQMKEEEEYLRPAHPKRVALAAQIADLKRSITLSKEQNI---------EE
A0A1V5L462      --HQQLLAMKE---QFGIYLKPKHPRMMDIEAELEILSNRIRIFRAQAF---------GQ
A0A2A2R3V9      --IQLLLLQRD---ELSQYLKPKHPKIIALNAEIQRQQTLLDMFKKQSI---------EQ
A0A3D3LGD3      --LQRLEVAREG--LVNQGRGRRHPEVLANDSQITKYKELIAAAAKDHL---------AG
A0A350ARX4      --QQEWTQLKAQLEEYSLYLKPKHPKIIDLELNIERATNLIDILERQTT---------DS
B5JIS2          --LDKLNGQRE---VMALRYGRNHPKMRDLDSRIEAVEGNLNRNMEMAL---------KD
A0A1H2GQN6      ----ELQGSANIQSLLKGGFGEEHPRVQSLRAAVGRAQEQLKSLAEGKR---------RA
A0A512M3Y3      RTERDLRVARQKREQAAQTYLPGHEIMRNLDREITDLEASLSSEVNTAI---------TS
A0A4P5R5J1      --INQLKADRQ---EFLQTLKPKHPAVVALDEQIAKNEAMLGTYKQLGQ---------DA
A0A4P5YK43      --KLNLKAREAEYFRYQATLKPKHPFLVSLQNEIQRTRQELQFQLDNIE---------ER
A0A2A2RPW6      -----LQSHEAALSNLQLRYKDKHPTMIQARNELSTLKAQFEVEIRRAP---------ER
B4D1I7          ---QQIEVLKSERAEYAKDLRSKHPIMVELDRQIAQQQQLIDAFRKQSA---------ED
A0A353F286      --LQNRSAVDRMLDLEAQGIGKKHPDMVTMKQRAEGALAKAHEEVISLK---------EV
A0A354FSA6      --LQNRSAVDRMLDLEAQGIGKKHPDMVTMKQRAEGALAKAHEEVISLK---------EV
A0A3B9GA54      --LQNRSAVDRMLDLEAQGIGKKHPDMVTMKQRADGALEKAHEEVISLK---------EV
A0A520LEH8      --LQNRSAVDRMLDLEAQGIGKKHPDMVTMKQRADGALEKAHEEVISLK---------EV
A0A6B2M0T8      --RNNLLAERN---SLSLRYGRRHPRMIENASSLEGVETEIQAALEKNV---------SD
A0A2D7B7R6      -----YKAAKTTVRNLEVDLKSKHPLMIDALRNVNNTRRVLLETISDVP---------KG
B1ZT68          --YAELQAQRK---LLGEKYLRLHPKMTQNELETTETKRLLDEAAAQAI---------AN
W0J7C2          --LISLLTQRT---LLAEHYLGEHPKMKQNEAETRETRRMLAESIAKAV---------AD
A0A2E5K4P7      --VARNSLKKEELGLLAARYRSKHPKMLQALQAQALVKKELDNAILMAR---------NK
A0A0R2XPB1      --KKQLQVLHAQLDEFSIYLQPKHPKIIGLKNQIERTENQLEIQRDQTL---------RR
A0A348NQP1      --KKQLQVLHGQLDEFSIYLQPKHPKIIGLKNQIERTENQLEIQREQTL---------TR
A0A357FV58      --KKQLQVLHGQLDEFSIYLQPKHPKIIGLKNQIERTENQLEIQREQTL---------TR
A0A2V6F9Q9      --VQLLKAERD---TLSQDLRPRHPKIIKLNDEISKQEKLIAVFRADAV---------EK
A0A2V6NZZ3      --VQLLKAERD---TLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV---------EK
A0A2V6EBU2      --VQLLKAERD---TLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV---------EK
A0A2V6EY06      --VQLLKAERD---TLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV---------EK
A0A2V6ME53      --VQLLKAERD---TLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV---------EK
A0A538NUU0      --VQLLKAERD---TLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV---------EK
A0A2V6NIJ1      --VQLLKAERD---TLSLDLRPKHPKIIKLNDEISKQEKLIELFRSDAV---------EK
A0A2V6C292      --VQLLKAERD---TLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAV---------EK
A0A2V6D2X0      --VQLLKAERD---TLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAV---------EK
A0A2V5ZUK1      --AQMLKAERD---TLAKDLRPNHPKILKLNDEVAKQDKLIELFRADTL---------ER
A0A2V5XFN9      --VQLLKAERD---TRAKDLRPNHPKIIKLNDEITKQDKLIELFRADTL---------EK
A0A2V6EZC8      --VQLLKAERD---TLAKDLRPNHPKIIKLNDEITKQDKLIELFRADTL---------EK
A0A2V6I7Z5      --VQLLKAERD---TLAKDLRPNHPKIIKLNDEITKQDKLIELFRADTL---------EK
A0A3B9LCP2      --LQLLKAERD---TLAKDLRPKHPKIVKLNDEISKQEKLIDLFRADTV---------EK
A0A3C0R669      --LQLLKAERD---TLAKDLRPKHPKIVKLNDEISKQEKLIDLFRADTV---------EK
A0A2V6EID2      --VQLLKAERD---TLAKDLRPKHPKILKLNDEISKQEKLIDLFRADTV---------EK
A0A2V6MHB0      --VQLLKAERD---TLAKDLRPKHPKILKLNDEISKQEKLIDLFRADTV---------EK
A0A2W5YWL9      --VQLLKAERD---TLAKDLRPKHPKILKLNDEITKQEKLIQLFRSDAV---------EK
A0A2V5NH62      --LQLLKAERE---TLSKDLRPKHPKIIKLNDEVTKQEKLIELYRQDTV---------EK
A0A2W6A620      --LQLLKAERE---TLSKDLRPKHPKIIKINDEITKQEKLIELYRQDTV---------EK
A0A2V5PIJ4      --LQVVKAERD---TLAKDLRPRHPKILKLNDEIAKQENLIKLFREDSI---------EK
A0A2V6K2G8      --VQLLKAERD---TLAKDLRPNHPKIIKLKDEISKQEKLIELFRADTL---------EK
A0A2V5W206      --IQLLKAERE---TLAKDLRPSHPKILKLNDEITKQDKLIQLFRADAL---------EK
A0A2V6MW77      --IQLLKAERE---TLAKDLRPNHPKILKLNDEITKQDKLIQLFRADTL---------EK
A0A2G4GZN8      --QTAISGSKIRVSQMTETYTDQHPKLVAEREALKQLERQLKEATTQAI---------KS
A0A348NPT1      --LSQISAIKIGISSSSKRYREKHPVMIEQQQTLQESEVELAAAVKDSV---------DK
A0A2E1KV60      --TEQISNIRIAMSTMSKRYREKHPEMRSLLQQLQESQSELDYAVQNAV---------DN
A0A2D7F4D9      --IEQISAIRIAISTKSKRYREKHPEMRSLLQQLQESQSELEYAVQNAV---------DN
A0A3R7RBR8      --IEQISAIRIAISTKSKRYREKHPEMRSLLQQLQESQSELEYAVQNAV---------DN
A0A2E0NH28      --LQEVSKTKIEISSLGKRYRSKHPVMIQLLQRLQESEIELTEAVTNST---------DK
A0A350AS32      --LESISQAKIQISSLSKRYREKHPVMIQLLQQLQESEAELSSAVQNAV---------NK
A0A368BGT4      --LQQISSTRISISSASKRYREKHPAMIELLQTLQEGELELELAVQNSV---------DK
A0A2E0V4K6      ----ALEVEEVKVADLARRYRGKHPKMIAASAKLAAAKGSFLEEFLVAA---------RS
A0A2E6NAH3      --LQQVSSTRIEISSLGKRYREKHPAMIQLLQTLQEGELELSRAVQNSV---------DK
A0A2A5VZA5      --LESISATRIEISSYSKRYREKHPIMIQLLQTLQESEIELQEAVTNSV---------DK
A0A424R295      --LESISATRIEISSYSKRYREKHPIMIQLLQTLQESEIELQEAVTNSV---------DK
B4CZV9          --------VKKEISEGLRKYLPTAGAMKPLYQQLDVINQRLDAEVEVAT---------NR
A0A290QE54      --LSELTRQQS---VLAQRYFERHPKMIELEKSIKAAREQLTRATDLAI---------AD
A0A1H1SWX2      --LAELNKQQA---ILSERYLERHPKMIELANSIDVVTAQITRNIEQSI---------SD
A0A4Q1C9I5      --LTDLQNQQS---ILSERYLERHPKMINVANSIDVLTAQIKTDIAQAI---------AA
A0A3B9FM17      --LYDLEKTRRDYEETGSGYLERHPKMLENARSVQQVKSALRQSVTSAI---------ED
A0A1G3ZL71      --LSELLQTQK---VLSDRYLERHPRMIELARQIATVRADLEKSIQLAV---------AD
A0A556QP09      --LETLNRDHS---LLAERYLERHPKVINVVNAIHVAQEQLDTAIRLSI---------AD
A0A2T6DX88      --LADLQRQQS---VLSERYFERHPKMMDLARAIKVSQDQLASAIDLAI---------AD
A0A2T6CWI7      --LSTLQQEQN---ILSERYYERHPRMIDVANRIDVTEKELAKAVQLAI---------DD
A0A3E1E5C8      --LSNLHQNQS---VLGERYLERHPKMVDLANQVTVVQDQLEKAVDLAV---------AD
B1ZZ74          --LSSLLQSQS---VLAERYLERHPKMIDLANSIAIVQEQLGKALDLAI---------AD
R7E4L8          ---------FLQHKKLFASAGRQNPMVSSLAENMKEMRESIGRSIANYC---------NA
A0A4Q3BVY2      --LISQIR------QNSTIYQPGHRVMKDLEKKLEDTERALETEFKMLR---------QK
A0A4P6PCA7      --------ALDEFQRVSEKYTEKHPRYQEAKRAEERALSRLDQFVEVSW---------KA
A0A0E3YV65      --LDTLRTQRA---TMGERYGVRHPSMIENDRSREALERLRTELITAAM---------SN
W0J900          --LDGLIAKKA---VMSEKYGRRHPAMVEQERSIQALEKLRGDLVRAAL---------ST
A0A2T6DSN5      --LENLKAERR---MLSETYLDEFPKMKENALATENTEKRLQANIELAI---------AE
A0A2V2SMX4      QQIALMEAQKQDWSEF---LRPKHPKMVALDEDISRRRRLLGIFKDQSS---------EQ
A0A317ZIW7      EAKNQLDQLKADLEEFEIYLKPKHPKIIGLKDQIERTSNQLEILRRQAF---------ER
A0A2D7WMI4      --LFELYKQRRDYQEVGTGYLSKHPKMLSNARQIQDTYGRINKQVKDAI---------FD
A0A2D6VHX5      --LLEHELQRKTYVETGTGYGPNHPKMIENARQVQEVQELLRKEVTLAI---------ED
A0A2D8I214      --LFDLEKTRMRYQEGSPGYLERHPKMLENARQVNEVKNSLIKEVTSAI---------ED
A0A1Z8VL41      --LFDLEKTRRDYQELEPGYLERHPKMLSNAKQVKDVKKALALEVKSAI---------DD
A0A2E6TNA4      --LFDLEKTRRDYQELEPGYLERHPKMLXNAKQVKDVKKELAXEVKSAI---------DD
A0A1Z8RG47      --LYNLELTRKNYQETGTGYLERHPKMMENARQVLEVKQSLNLAVKSAI---------ED
A0A1Z8RJJ5      --LYNLELTRKNYQETGTGYLERHPKMMENARQVLEVKQSLNLAVKSAI---------ED
A0A2D7V631      --LYDLETTRKNYQETGTGYLERHPKMMENARQVSEIKTTLNLEVKSAI---------ED
A0A354RA24      --LYDLETTRKNYQETGTGYLERHPKMMENARQVSEIKTTLNLEVKSAI---------ED
A0A2E9RV62      --LFDLEQSHKLY---GQKYLANHPKMIETARQIKDVERILQLEVKASI---------ED
A0A2E4AY96      --LQKLYSTRKNYQEVGTGYLEKHPKMLANARQIRDTNMQILSEIRNAI---------SD
A0A3B9B9P4      --LQKLYSTRKNYQEVGTGYLEKHPKMLANGRQIRDTNMQILSEIRNAI---------SD
A0A2D5Y6N6      --LYDLESKRRDYQETGSGYLERHPKMIENARQVQLVKQALNKEVKSAI---------ED
A0A2E7HSS8      --LYNLEKTRRDYEETGSGYLEKHPKMLENARNVLQVKNALKDEVTSSI---------ED
A0A2D8VCK3      --LYDLEKTRRDYEETGSGYLERHPKMLENARSVQQVKSALRQSVTSAI---------ED
A0A350QVY4      --LYDLEKTRRDYEETGSGYLERHPRMLENARSVQQVKSALRQSVTSAI---------ED
A0A2E4ZYR7      --LLDLETIRKEHE---VKYLELHPKMSSNTRAIMELHRLLRLEVKTAI---------ED
A0A2E6TCV1      --LQEHEKTRKTYE---AKYLENHPKMKENALAIGELHKILLNEVQVAI---------ED
A0A3D4HHL8      KKELNLLKAQRD--EYLTYMKGKHPKLAAVNLEIERKENEMSVLKRQAL---------HE
A0A366HV03      ERDKRKVETEIA--EASRVYLEDHEILKALRTKQRQIDESLTTELEVER---------KR
A0A6G6K911      ERDKRKVETEIA--EAARVYLEDHKVMKELRAKQRQISEALTTELDVER---------KR
A0A5R8KAF2      EKKRRVIEEELM--EANKRYLPAHAIVKGLEEDLANNTRALAAELEVMR---------RR
A0A2V2SDN0      QQIRLLKD-KRD--ELSKGLRPMHPKILKLNEDIAAQEKLVEGSRSEVM---------KQ
A0A1V6GL40      QQLLLLRV-EQQ--ELGRYLRPNHPKMIAMQEDIARREELLKILRTQSE---------EQ
A0A2V5X6Z6      QQMQLLKA-KRD--ELSRFLRPLHPKILKLNEQIATQEKLVQISRDEAL---------KQ
A0A2V5VGZ7      QQMQLLKA-KRD--ELSRFLRPLHPKILKLDEQIATQEKLVEISRDEAL---------KQ
A0A2V5U130      QQMQLLKA-KRD--ELSRFLRPLHPKILKLNEQIATQEKLVQISRDEAL---------KQ
A0A2V6C237      QQMQLLKA-KRD--ELSRFLRPLHPKILKLNEQIATQEKLVQISRDEAL---------KQ
A0A3R8L982      --LAEHLR-TQA--VLSERYLDRHPRMIEIDNSIRVTRQQLAAAIALAI---------AD
A0A2E7HPU9      ---------TFS--ELDLRYLSKHPKLIAAKNALEEYAFRFLREFDQVR---------KA
A0A388PR45      --MTDAQT-RVR--AMEEIYTDLHPKMIAERQALAQLSAEFQRAVKTKA---------DS
A0A388QR61      --VAEETA-KTR--AMEEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKA---------DS
A0A4P5YHI0      --VAEETA-KTR--AMEEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKA---------ES
A0A2A2RS01      --VTELRV-LVS--TMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSV---------NR
A0A2A2Y1A7      --VTELRV-LVS--TMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSV---------NR
A0A388PDH9      --VTELRV-LVS--TMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSV---------NR
A0A2G4H1E7      --LSASKI-RMS--QMTEKYTDQHPTLVAEREALNQVDRQLREAVVQAV---------KS
A0A2G4GZA6      --ISASKI-RVS--QMTETYTDQHPKLVAEREALKQLDLQLKESISQAI---------KS
A0A388P514      --ISASKI-RVS--QMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAI---------KS
A0A2A2YG59      --ISASKI-RVS--QMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAI---------KS
A0A2G4F7D5      --ISASKI-RVS--QMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAI---------KS
D5EML0          --LSELKRERL---VLDERYLRKHPKIVENEAAMKSVSTELSRAIRQAE---------QQ
A0A3C1C1M3      --WRQAMTERDA--LLSR-YTPEHPAVEAQDKAVALYKEQANQALNRAK---------NT
A0A2E9EYJ1      --YQTLELSRAA--LIXSGVGVKHPKIVNIDSQLNLRMNQLLDAVETHK---------KA
A0A258AXR6      --LQDLKVAREG--LVNEGRGRLHPQVLSVDSQMAEYQSLILGAAKAHV---------AG
A0A3D3NZQ6      --LQRLEVAREG--LVNQGRGRRHPEVLANDSQITKYKELIAAAAKDHL---------AG
A0A1T4WVZ9      --LTRLQVTREG--LVNAGRGRRHPEVMGVDSQIALSKQLILDAVKAHL---------AA
A0A4R7SSI6      --LNKLQVTREG--LVNAGRGRKHPEVIGVDSQIILSKQLILDAVKSHV---------AA
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ----------------------------------------EYENLQRSVSRLQALYDLVF
A0A2V5UAD5      IAAAQQVLKLKMNGIQTSIKE----SLGKVLAANDR--IADAERMKMNISRIQFHYDRVV
A0A258AXL1      FHLEKEHLQQRLESLQDKLPE----YRKLIAGYDDF--RRDYKLQSSGHLAWEAAYVGMK
A0A2E6T1E0      IINKAELAKATALNLKGVLEI----RKSEQQAMNQK--SIQYFALEREAKQSETLYNLAL
A0A2D5W0Q9      IKSQSLVERDLQAHLHPQSNA---------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      ---------------------------------------------------NRALYESVL
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      LDLKLNQLIDKRNSLTERLTE----TAIK---------EQEIIPLIREHKVKEELYLMLL
A0A2V6N5E0      LKTRRESIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLYDRLT
A0A2V6NH44      LETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLYDRLT
A0A432FDF6      LGLRVNSSQAQVEQLQRDVDA----AKKRESDMRKT--GREYFDAKRELSNTTRIRDTIL
A0A522ACN3      LSNQVEIARSEVGALKRQVED----AKRVDRDKAEK--CRPYFEKKRELEEAIRLRTILN
A0A353DCA1      -------------------RE----KKDGTVDLSMR--QHQYNSAKEEYEQSRMMYREMS
A0A3C1AXQ2      LQTRMDFAIKRRASLQNSNED----AKKGMLDQQSA--QNDYKTAADEVAYIESLLLQLK
A0A3D0IZR7      --------------------------MRGQLRADRSDRLAPYNEARRDFETQSQLLEVLM
A0A520LRZ3      ---QLSMAEQQFQNSKETKEK----TEKASLKERKD--NINYIEAKKEYELSKEMLNGMQ
A0A356FSV4      IYAAYIEAKRNFEVSSQRLAE----KENELIQLSKT--RVDYNTLYREFEVQQGFLTAIV
A0A3D3DET9      LKNRKELLAVEIEILEKDLKA----WDARNQEFQHK--NAEYQALKANVQRIRALYDQLL
A0A355SVK9      VDSAYAEAKTNFELASRRLAE----KESELIQLSKT--RVEYSSLERELNVQQGFLQALV
A0A2E5D7I3      -------------VELKEVQS----NESEGLATARRLLLARTQVLDGETKSRMSVFNSIL
A0A2V5NYE2      LTNKLNSLDMQIKNRRKDIKE----QEEQVLEINRK--TAEWQRLKDNKQRIQAAHDSLQ
A0A2V6FIP7      IRAEAELAKAKETTMASELKK----KEQESFELSQL--RIQYDVLSRQADQSKLLYNIVL
A0A353DI77      FQDQIDDVKNEENFRELRNAM-----------------KLRASLLTNSVETKNELYNTLL
A0A1V6GCZ3      LDTRVLSLSNSLVNLQQEVGR----ATTNDVTQANL--TRPYFEAKRALEELQRFRQVLD
A0A3C1UJT2      LYAQIKYQQEFIEELTQSIEN----QTSKLFEWEQL--YMQQAALEQDLEIGTKLIDNIK
A0A2S7U0Z3      YKDEMDALEKIIDGDGPDKSD--AADKWVLLSQGAL--ASRAKLLNNTSEQTRDKYQSIS
A0A5E6MKA7      LEADFEAAKANYEGLEQEFQH----SMEKVRGESKA--LAHYALLKREADTDREMYSSVM
A0A6B3L936      LMADVDRLDKQIASAESEADRRDATDRWLSFVQNKL--SSRASVLESRIGSLRGRYETFT
A0A2N8IR72      LDLKLNQLIDKRNSLTERLTE-----------TAIK--EQEIIPLIREHKVKEELYLMLL
A0A2N8IV96      LKSKLEMVAASRKHWEATVAQ----KEEDLQKHVLQ--VPMYEQASRDYDAALDQLKELD
R7E1V8          LKSKLEMVSASRKHWEATVAQ----KEEALQKHVLQ--VPMYEQASRDYDAALDQLKDLD
A0A1T4WWY4      FDLEKARLTEKLEELDGKLPE----YHKAIKSYDTK--KLDYDLMEKSQLAWDKAYEKLS
A0A3D3LEQ6      FDLEYEKLKEQLVELEAKLPD----YYKAAKSYDEK--KLAYELMEKGQLAWDKAYEQLS
A0A3D3NW23      FDLEYEKLKEQLVELEAKLPD----YYKAAKSYDEK--KLAYELMEKGQLAWDKAYEQLS
A0A2E0R252      SDEEKAFWEQHSESFSSMDAD-----TRIDSQIQIA--STRASVLERELEAEQQIYDNLI
A0A3E1EF48      SAEEQRFWKENASVLAGLEGE-----ALIAAQLRTV--ASRASILSKALETEQGIFENLN
A0A2A2PVG8      SEEERKYWETSLASLQGAPME-----ALTNAKRQVV--STRSNVLERELEAEKAVYDNLI
A0A2E0R421      SEEERQFWEDAGTSIADVEGE-----ELATDQMQIV--ATRSRSLGRELESEQDIYNNLI
A0A2E5EJ69      VHTTILTLSSQIDSQQGRLEA----QEKKVAADQQK--EIEYKHLKAQAESLQAMYQRVL
A0A2G4I5Z5      LNQQLQAAIDKEKGLELAVKE----QEKKLSLLNSQ--RSGFDHLQAEVMQNRKLHDTVI
A0A4P5QQV6      LKRRRDATTLEIRNLETTVKE----WEAKAASNSER--LTQHAGIQAGISRMRAQYENLS
A0A2E7ALI1      AADKSYWEGAGAELQQIANDE----EAGLASARRLL--LARTQVLDGETKSRMSVFNSIL
A0A178IDB9      THARLNLARQHEQRLRSEYAA----AEKQAQDLDRI--TIDYKFLEEDAVSKRQAYNSIL
A0A290QD69      LKNRFNFAKQHELRLRTDYAE----TEKQAQELDKI--TSEYKYIEDESNIKSKNYQDIL
A0A2E7VDS1      LTNRVSEMASQESEFTKAMDA----VQRESQKLDDI--ETRINEMTREKEIHEKTHDIML
A0A178IFJ2      LRNQREKALENERQLQRQLAD----SEKASLALDRQ--AVEYNVLRREAETNRATYTQVL
A0A357FSP9      LSSALVEAKSNFELASQRLAE----KELELIKLSKT--RVAYSSLQREMDVQQGFLQALV
A0A538NJ59      IAAAQQVLKLKMNGIQTSIKE----SLGKVLAANDR--IADAERMKMNISRIQFHYDRVV
A0A3C1VFY9      LEAKKSALALQIKNLENQTKQ----WGRQNIELGHK--SAEYASLKAKSQRLQALYDQLL
A0A522AC27      LENLKKSLELQITNVEKDVVE----WDAKNLSISQR--TAEYQKLKAGQSRVQALYDRLL
A0A2A2R174      LGLQLQAAIEKEKGLEAAFKE----QEKKLSDLNAR--RSGYEHLQADVTLHRSLHDAVI
A0A1H2DTI1      ANVRRETLALEIQHLEAMVKE----YEPKAISLGAK--LAEFERLKSKRSMDQSLYESLL
A0A1V5L462      IEEEKSALRNRIDTLLPEINK----WEEEVIQYSLG--VADLETMNSNLSRLLSTRESLI
A0A2A2R3V9      LNNRREGLRLQIQNLQELIKS----EEVKALDVNRR--MADYQRMKSKRQRLQAFYERLV
A0A3D3LGD3      LQNRLESARKRKEALEASNQD----AKSELLGQQSA--FNEYKTAKDDVTDIEAILRTLK
A0A350ARX4      LDDRKDQLRRQIQNLDAVIAQ----WEKQALSISRK--SAEFERLQYRLDRSRNTYQRLL
B5JIS2          LEGQYTNVVSLEKRLDDDFRK----KFTESIEVGRL--ADQFLVIGSEVDAKREALTSLL
A0A1H2GQN6      LLIDLNVSEEKLKLLEADVASL---RDKLRQEKSDK--MAPFQEAVKERDRQQYILDQYE
A0A512M3Y3      FRLQKEQMAARMQELSKKMPD----YRRVLNDFDHY--KREYSLMSSGKLLWESAYADLS
A0A4P5R5J1      ITSRRGAIKTQIESLDDNIKT----WETKALDLAKR--VADFDKIKSKIERTKVHYDRLN
A0A4P5YK43      RRAEIEKLRKDEIGLRPRVEE----MRREVFEKSTV--LNEFEKLKKEEDYLEKELDRQK
A0A2A2RPW6      LKLMREGAMAKEKKLEQELRE----QEKKLGQLSLL--RIEYDRLQREAASERKLYDTVI
B4D1I7          LQHRREATRLEIENLEKTIKE----WEAKALDLSQR--LAEYGSLQANVTRARAQLESLS
A0A353F286      LKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--QTSYTQAKEQYEQARGMLREMK
A0A354FSA6      LKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--QTSYTQAKEQYEQARGMLREMK
A0A3B9GA54      LKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--QTSYTQAKEQYEQARGMLREMK
A0A520LEH8      LRTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--QTSYTQAKEQYEQARGMLREMK
A0A6B2M0T8      FVQQHSQLKARVSNLEEALTQ----AEQESLELDQV--AIEYNVLRRKLDTDKRLFTQVH
A0A2D7B7R6      LYAQIKYQQEFIEELTQSIEN----QTSKLFEWEQL--YMQQAALEQDLEIGTKLIDNIK
B1ZT68          LETRNRIAAQHEIRLRAELEQ----AERSAHELDKT--SVDYKFLEQDAATKRATYSRIV
W0J7C2          LRARYDVSAHYLQRLQAETTG----SEAQARELDKI--SIDYKFLEQDANAKRATYARIM
A0A2E5K4P7      AEAEHLLATVHYKEAQRDVAI----KEQEYLALEKN--REEYGGLTRKLEQARKSLEHLR
A0A0R2XPB1      IRERQSVLNNTAANLTLEIAI----WEKSALEHGRL--IAEFERLQSRLERSKAASVNSQ
A0A348NQP1      IRERQSVLNNTAANLSLEIAI----WEESALDNGRL--IAEFERLQSRLERSKAASVNSQ
A0A357FV58      IRERQSVLNNTAANLSLEIAI----WEESALDNGRL--IAEFERLQSRLERSKAASVNSQ
A0A2V6F9Q9      LETRRKSIGKQMENLQSNIKE----WETKALDLSQR--LAQFNRIKGKMDRTKQLYDRLT
A0A2V6NZZ3      LETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLYERLT
A0A2V6EBU2      LETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLYERLT
A0A2V6EY06      LETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLYERLT
A0A2V6ME53      LETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLYERLT
A0A538NUU0      LETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLYERLT
A0A2V6NIJ1      LETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLYDRLT
A0A2V6C292      LETRRKSIGKQMENLQGNVKE----WEVKALDLSHR--LAQFNRIKGKVDRSKLLYDRLT
A0A2V6D2X0      LETRRKSIGKQMENLQGNVKE----WEVKALDLSHR--LAQFNRIKGKVDRSKLLYDRLT
A0A2V5ZUK1      LKTRRESIGKQMENLQGNIKE----WEAKALDLSQR--LAQFNRIKGKSDRLKQLYDRLT
A0A2V5XFN9      LKTRRESIGKQMENLQANVKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLYDRLT
A0A2V6EZC8      LKTRRESIGKQMENLQANVKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLYDRLT
A0A2V6I7Z5      LKTRRESIGKQMENLQANVKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLYDRLT
A0A3B9LCP2      LETRRKSIGKQMENLRANIKE----WEAKALDLSQR--LALFNRVKGKVDRLKTLYDRLT
A0A3C0R669      LETRRKSIGKQMENLRANIKE----WEAKALDLSQR--LALFNRVKGKVDRLKTLYDRLT
A0A2V6EID2      LETRRKSIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRVKGKVDRLKVLYDRLT
A0A2V6MHB0      LETRRKSIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRVKGKVDRLKVLYDRLT
A0A2W5YWL9      LETRRKSIGKQMENLLGNIKE----WEAKALDLSQR--LGQFNRIKGKVDRTKQLYDKMT
A0A2V5NH62      LDTRRKSIGKQMENLQTNIKE----WETKALDLSQR--LAQFNRIKGKAERLKTLYDRLT
A0A2W6A620      LETRRKSIGKQMENLQTNIKE----WEAKALDLSQR--LAQFNRIKGKAERLKTLYDRLT
A0A2V5PIJ4      LDTRRKSIGVQMENLEKSIAE----WEKKALDLSQR--LAQFNRIKGKADRLKTLYDRLT
A0A2V6K2G8      LKTRRESIGKQMENLQTNVKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLYDRLT
A0A2V5W206      LKTRRESIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLYDRLT
A0A2V6MW77      LKTRRESIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLYDRLT
A0A2G4GZN8      RRSSLDNAKARHEAILRNLLA----KEEEISRLQAA--NVDLERVDKEIRASEEFLGRMK
A0A348NPT1      LSSALVEAKSNFELASQRLAE----KELELIKLSKT--RVAYSSLQREMDVQQGFLQALV
A0A2E1KV60      LNASFKEAKDNFAQASKRLVE----KERDMIELSKT--RVEFNSLIRDLEVEQMTYQKLI
A0A2D7F4D9      ISGYFAESRDNFKQASKRLLE----KEREMIELSKT--RVEFNSLIRDLEVEQMTYQKLT
A0A3R7RBR8      ISGYFAESRDNFKQASKRLLE----KEREMIELSKT--RVEFNSLIRDLEVEQMTYQKLT
A0A2E0NH28      IYAAYIEAKRNFEVSSQRLAE----KENELIQLSKT--RVDYNTLYREFEVQQGFLTAIV
A0A350AS32      LDSSFSESKSNYEVASQRLAE----KEQELIELSKT--RVEYNSLLRDLDVQQSFFIALT
A0A368BGT4      IYAGYSESKSNFEMASLRLAE----KERELIELGKT--KIEFNSLLRDLEVQQSFFQALN
A0A2E0V4K6      PVDKSYWEGVSDQLGTIKDGG----EAEVAIARRLL--LARTQVLDGETKSRMSVFNSIL
A0A2E6NAH3      IYAGYSESKSNYEVASLRLAE----KEKELIELGKT--KIEFNSLLRDLEVQQSFFQALN
A0A2A5VZA5      LYASYIEAKSNFELSSKRLAE----KESELIALSKT--RVEYNTLLRDLDVQQSFFQALN
A0A424R295      LYASYIEAKSNFELSSKRLAE----KESELIALSKT--RVEYNTLLRDLDVQQSFFQALN
B4CZV9          FNLEYQELLNKKHDLEAKLPE----YQELSRKHAKL--LSQLSIFDASRVPYDTYLANMQ
A0A290QE54      LHASLEKSRANEKSLEQEYAL----NEKEQIRLRDL--SIDFKSLENQAAVAKGNYTQIL
A0A1H1SWX2      LRTQYVKLQDTEASYIKEYQA----AEKDNLRLGDL--SVDFKSLENQAQVAKSNYLEIL
A0A4Q1C9I5      LRAQHETLKQTEASYVREYKE----AEKEQLRLGEL--SVEFKSLENQAAVAKNNYLQIL
A0A3B9FM17      LRDKHIQLSAQEKEFADEMEK----VQKQSEQLSEI--EETLKNFERELAVVQRSTDSIH
A0A1G3ZL71      LSASLEKARDGEQTFEKEYAQ----HEKDQIKLNEL--KPEYGSLENEALAKRTAYLQVL
A0A556QP09      LKTSLERAVAREKTLEKEYAA----QEKEQLRLRDL--SIEYRSLENQAQVAKSNYSQIL
A0A2T6DX88      LQASLEKARANEKSLEQEYQL----HEKEQMHLRDL--AVDFRSLENQATVAKSNYSQIL
A0A2T6CWI7      LRARQAEARQAYESFSAEFAQ----REKDAMRLGEL--RVEFNSLVQQSQVARENYQNIF
A0A3E1E5C8      LATQLSEARQSEANLQTEYDR----AEKESLHLGDL--SVEYNSLENQANVAKSNYVQIL
B1ZZ74          LGTRLNEARENERTLQEQFAK----AEKESLDLGAL--APEFNSLQNQAQVSKANYLSIL
R7E4L8          LEVRMGELEKERNELNRLLSD-----------MASK--DEGLVPLLREQKVMEELYLMLL
A0A4Q3BVY2      FDLNFAGLTEKEKQLEARVPE----YHAITEQVGKS--SHVYSTIAAKQQMWDKARERLA
A0A4P6PCA7      IQNELTLLKTKISQMQSRMENIETELRDLDKQIADG--KRRLLKLERKRDAAETSYRSIL
A0A0E3YV65      LRNQRAKALNEETQLQSQLAQ----AEKESFRLDEM--AVQFNVLRREAETNRATYAQLL
W0J900          LRNQREKAVENERQLQEKLAD----AEKASLGLDRL--AVEYNVLRREAETNRATYTQVL
A0A2T6DSN5      LRSRYEVAGQHEKRLRQDFAD----AEKRLQELDRA--TDRYKFLEDDYNRKNQALNSIE
A0A2V2SMX4      LQTLQKTLELQIANMERDVRE----WDAKCLEISRK--TAEYQRLKNDSQRVQGLYDRLL
A0A317ZIW7      IGERKLVIERRIDNLNDEIAI----WEQSALENGRL--IAEFERLQSRLERSKAAYERNQ
A0A2D7WMI4      MDNRKLQLQALANDFTVAMTT----VQDEANFLSKI--DDNISSMERELEIVQTSSGQMQ
A0A2D6VHX5      LRDRHIQLDAQEREFMGAMDK----VQTESRRLGHI--EEAISKAERTLAVVRSSTDIIR
A0A2D8I214      LKDKRVQLTAQEKEFQQAMEK----VQQDSMKLSEI--EEWLINKERELTVVRTSTDQIQ
A0A1Z8VL41      SRDKLLELQHQEGEFTMAMQE----VQSQSNELSEI--EERLEDYKRELSVVRASTDQIH
A0A2E6TNA4      SRDKLLELEHQEGEFTKAMQK----VQLQSNELSEI--EERLEDYKRELSVVRASTDQIH
A0A1Z8RG47      LRDKYIHLVAQENEFAKAMQK----VQEDSRKLSEI--EEKLINFERQLAVVRKSTDQIH
A0A1Z8RJJ5      LRDKYIHLVAQENEFAKAMQK----VQEDSRKLSEI--EEKLINFERQLAVVRKSTDQIH
A0A2D7V631      LRDKHIQLNAQEKEFATAMQK----VQEDSRKLSEI--EETLTNFDRQLAVVRKSTDQIQ
A0A354RA24      LRDKHIQLNAQEKEFATAMQK----VQEDSRKLSEI--EETLTNFDRQLAVVRKSTDQIQ
A0A2E9RV62      LKNSYHQLEAQEQEYANEMDK----VQVEAVELSEM--EKDLEVLDRKLQIQRGSTDTIQ
A0A2E4AY96      LYERENQLLALEDKFSIAMND----VQIEAKDVSLI--DDTLRNFERELQIVQTSSAQMQ
A0A3B9B9P4      LYERENQLLALEDKFSIAMND----VQIEAKDVSLI--DDTLRNFERELQIVQTSSAQMQ
A0A2D5Y6N6      LRDKHIQLTAQEKEFASAMAK----VQEESRTLSEI--EEKLKNLDRQLAVVTRTTDQIH
A0A2E7HSS8      LRDKHIQLSAQEKEFGDEMAK----VQLESEKLSEI--EDRLKNFTRELAVVQRSTDGIQ
A0A2D8VCK3      LRDKHIQLSAQEKEFADEMEK----VQKQSEQLSEI--EETLKNFERELAVVQRSTDSIH
A0A350QVY4      LRDKHIQLSAQEKEFADEMAK----VQKQSEKLSEI--EETLKNFERELAVVQRSTDSIH
A0A2E4ZYR7      LTNRVSELASQEREFTKAMLA----VQKESQKLDDI--EVQILGMTREGLVHRTTYDQML
A0A2E6TCV1      LTNQKNELNVQKAKFVYLREK----IKKQAQQLGQK--EQQIARLEQDLTLERQTFSSLH
A0A3D4HHL8      LKDEKEVLQSKISHLKDVIDE----QEVKALDYSRR--LAEFERINSRLDRQKSLLENLT
A0A366HV03      FEVERLRLGDQLKELEAKLPE----YSEMTEKLNKL--RQDYKLGHEGDLAWTKAYTDLS
A0A6G6K911      FEVERLRLGDQLKELESKLPE----YSEMTEKLNKL--RQDYKLGYEGDLAWTKAYADLS
A0A5R8KAF2      FELDFQQQTQKIATLEKRLPE----YYQTNEEAGLA--GEQYMSASQGRAMWGRARDKLS
A0A2V2SDN0      LVNRRDGLQLEVKNLEKVFRE----WEGKALEASRK--MVDYDRLRQDVQRTQAAYDKLL
A0A1V6GL40      LKNRKELLAVEIEILEKDLKA----WDARNQEFQHK--NAEYQALKANVQRIRALYDQLL
A0A2V5X6Z6      LAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--MADYEQIRQNLQRLQTAYDKTL
A0A2V5VGZ7      LAHRRRAIELQVQNLEVAFKE----WDAKAIESSRK--MADYEQIRQNLQRLQTAYDKTL
A0A2V5U130      LAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--MADYEQIRQNLQRLQTAYDKTL
A0A2V6C237      LAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--MADYEQIRQNLQRLQTAYDKTL
A0A3R8L982      LQATLEKARAREASLAIEYTA----NEKEHLRLRDL--SVEYKSLENTAAVAKSNYAQIL
A0A2E7HPU9      AADKSYWDKNKSEWDKQDLDQ----LSRLQVARRLL--TARATVLTSGIASQREVYNSLN
A0A388PR45      LAAAQVDLRAKLDNAVEILRQ----KDEAINRLQAA--AVELEKIDKDIRANEEFLGRMK
A0A388QR61      MQTTWLDLQAKLANSVEILRQ----KDEAINKLQAA--AVELEKIDKDIRANEEFLGRMK
A0A4P5YHI0      MQTTWLDLQAKLANSVEILRQ----KDEAINKLQAA--AVELEKIDKDIRANEEFLGRMK
A0A2A2RS01      IQASVQNARSSYDAIVANLER----KDDEIYRLQAA--NNELERVDKEIRGQEEFLARQK
A0A2A2Y1A7      IQASVQNARSSYDAIVANLER----KDDEIYRLQAA--NNELERVDKEIRGQEEFLARQK
A0A388PDH9      IQASVQNARSSYDAIVANLER----KDDEIYRLQAA--NNELERVDKEIRGQEEFLARQK
A0A2G4H1E7      RRASLENAKARHEAILRNLVA----KEEEISKLQAA--NVELERVDKDIRASEEFLGRMK
A0A2G4GZA6      RRSSLENAKARHEAILRNLVA----KEEEISKLQAA--NVELERVDKDTKASEEFLSRMK
A0A388P514      RRSSLENAKARLEAILRNLLA----KEEEFSKLQAA--NVELERVDKDIKASEEFLGRMK
A0A2A2YG59      RRSSLENAKARLEAILRNLLA----KEEEFTKLQAA--NVELERVDKDIKASEEFLGRMK
A0A2G4F7D5      RRSSLENAKARLEAILRNLLA----KEEEFSKLQAA--NVELERVDKDIKASEEFLGRMK
D5EML0          STIEYQTVQKEVSDLTARIQE----TEGRVLVAERS--LLEYKRMERDVDQKREMFNKLM
A0A3C1C1M3      AAANLALYQEQAGSLQKKNEELLETASKLDRDILEG--EMRITALNRTRSAADASYLGLL
A0A2E9EYJ1      LTTQLAMAEQQYENSKESKER----TEKMSLQERKQ--NVRYIEAKKEYELSKEMLNGMQ
A0A258AXR6      LQNRLDASRKKRESLKIYNDD----AKQELQNMSSL--YTEYKTAKDEVTYLEDLLVKMR
A0A3D3NZQ6      LQNRLESARKRKEALEASNQD----AKSELLGQQSA--FNEYKTAKDDVTDIEAILRTLK
A0A1T4WVZ9      LQTRLDFSIQRRETLRSSNEE----AKSEMLDQQSA--QNDYKTAADDVAYIENLLLQLK
A0A4R7SSI6      LQTRLEFAIKRHTALQSSNED----AEKEMFDQQSA--QTDYKTAVDDVAYIENLLLQLK
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      --------------------DLATAQMA----PIKPKKMLTLFLGIVGGLGAGFGLAFFV
A0A660Q3A0      NRLKEVDVSIGIEPERIRIVERAEVPTS----PVTPRKLQSIFIAALIGLGLGIGLVFGL
A0A2V5UAD5      NLLQNVDISRNI---DQGTLAILD--PASEAVRSYKQDVSLLAMTLVAGLLAGFGCVFLV
A0A258AXL1      GRLAAMDYTGPE---VQVEFQFKGFTDVRDDIPVSPNKQKLLTYALALSIGLGLGGPVLT
A0A2E6T1E0      QRLKETELQEKD---IVQNMHVIDLATAQMS-PIKPKKLLTLFLGIVGGLGAGFGLAFFV
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      -------------------------------------------------MGXXLVIPIAL
A0A2V5U7A0      KRLSETNVSNDIAVSN-MQIMQSAERPRSPDAPN---IPINLTMYAALGLFLGVGMAFAL
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A3D4CZT6      -----------------------------------------LSLGAAVGLIFGIAIAFSL
A0A4V1S9Q4      -----------------------------------------------------VGIAFFL
A0A355VK99      SKEQENALAMAVTESN-ARVLEAAHGPNLPISPK---TIKYVAGGTAGGALLSILAFMGV
A0A2V6N5E0      TNLKDIDVSQVTGSEDQVSIMEMATPPISV-RPG---LIKSLLIGFGIGALAGLAILILL
A0A2V6NH44      NDLKSVDVSQVIDTGDQISIMEPATPPVSV-RPG---LLKSLLLGFGGGALVGIMILLLL
A0A432FDF6      FRIMQEEVDLALPKESTVEITDDADLPIKAVRPN---IPLNIALGVVVGLVLGVGLAFFI
A0A522ACN3      MRIAQERTDINLPHTTMVEIIDRATPGARPVRPN---KPLNIALGVIIGLVVGVGLAFFI
A0A353DCA1      VKQQQQRVLLKMPRTP-ITLHERAKKAKAPAYPN---VTLNLLLGAGVGLIFGIGIAFLL
A0A3C1AXQ2      STYFQTKAELELVKSP-ATIYAIATPEGKPAKPN---VALNLALGGVLGLMLGVGLAFFL
A0A3D0IZR7      SRYRQQSVESRIETRP-VQVVNRAEPAVRPVKPS---LKLNLALSMVVGLILGLSLAFFI
A0A520LRZ3      SKLAKEKIDAAGQRTP-MVIHEIAEAADPG-NPARPNIKLHLVLGAAVGLVFGIGMAFFL
A0A356FSV4      SRMTMQKAQINLKNPN-ARIVDEALPPLRHSSPN---LFLNIALGAFGGVVVGLGLVFGI
A0A3D3DET9      ATMQTLDVNKEISPES-VETIEAASPA----YAARLDLWKGAVNGALLGLALGLGLLLVL
A0A355SVK9      SRLTEEKAQVTLKNPN-SRVIDEALPPMRHSSPN---IPMNLAAGFLGGLAAGAGFVLLI
A0A2E5D7I3      VALEESKVNSIDEEVI-AELHSRAAPSDSAVFPNRLRVQ---AVGGIGGVASGLGLVLLL
A0A2V5NYE2      ATMDKLDVGKEAAPES-VTIHQKASPA----VPNRPQLSRKLATGALVGLALSVVLLLIL
A0A2V6FIP7      QRMKETDLTSKD-KAQNMRVVDKAVVPMN---PIKPRVVLTLFLGVIGGLGVAMGLAFFV
A0A353DI77      SRVGVLKTDAEGVEAEVIKHEDAPRAWA----PFSPNRKKIMVKTTMLGLCGGLALAFMF
A0A1V6GCZ3      AKIAFEKIDVELPKTLMVEVVDRAMPGLR---PVRPNKPLNIALGIIIGLVVGVGLAFFI
A0A3C1UJT2      DQIQSIEFTAES-EGTTIELAEKATEPS----TIEPNKTQRIILGVLLGLGLAYGYLYLM
A0A2S7U0Z3      QRMTEIDVADNQ-SMNNLKVVEPAFIGL----AKESVRLIYLAAGSIFGIFTGFAAAFGL
A0A5E6MKA7      RRMRETDITSALNASNVEVVESAEVPNM----PSRPKKARNLLLGFLGGGMGGIGLAIGL
A0A6B3L936      RRLAEIDVADDEGVNSKVRVNEAATIPP----PSKYKHLITLAAGSVLGGGVGVGLVFLL
A0A2N8IR72      SKEQENALAMAVTESNARVLETAHGSNL----PISPKTIKYVAGGTAGGALLSILAFMGA
A0A2N8IV96      SRYKDEIARLRVPREAIEMYQLPTYPAA----PYKPNVTINLAVGAGAGLLLGIGLALLL
R7E1V8          SRYKDEIARLRVPREAIEMYQLPTYPAA----PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A1T4WWY4      QRIESLEFDG---DKAPLSLEFRGFTNLRSEMPVSPNKSKLFMMGCLLGLGLAGGVPFLL
A0A3D3LEQ6      RQIEGLEFGS---DESAVSLEFRGFTDIRSEAPVSPNKSKLLMLGCLLGLGMAGGVPFLL
A0A3D3NW23      RQIEGLEFGS---DESAVSLEFRGFTDIRSEAPVSPNKSKLLMLGCLLGLGMAGGVPFLL
A0A2E0R252      TKLKEGNVSKGFDSKQFDVVQPPSLPAN----PTGPNKKKITMKYLFGGAALGVGIILLL
A0A3E1EF48      TKLKEADVTRGIATRQFEIIQPPTLPGG----PIAPSMNDIVGRFSGGGFLLGIACIFLI
A0A2A2PVG8      LQLKEGNVTRGFASRQFEVVQPPTMPAA----PVAPIKTRMLVQFAGGGAALGIAIIMLL
A0A2E0R421      AKLKEGNVTKNFAGKQFDIVQPASLPGG----PIGPNKKSIMSKYTMGGVAVGVALILLM
A0A2E5EJ69      GAKQESSVTEGI---QNRTVEVYNPASLPGA-PVSPRKSVIMMVAMIVGCGLSFMLVFIV
A0A2G4I5Z5      QRLKELDIVSGNKNKNEVRIIEPASLPLT---PIRPNKKMLLIYALALGTALSVGLIWLL
A0A4P5QQV6      RSKGSVEITRNV-DQEIISVRQKATPAQ----TARFGVARTLTTGFVLGLLGGIVCLLGI
A0A2E7ALI1      VALEETKVNS---IDDEVIAELHSRSAVPSS-PVFPNRLRVKAVGGLGGIAGGLGLVFLL
A0A178IDB9      SRLNETTIVSQL---ENVNIKVLDKALVPGA-PSNSPSSQILLQAGAFGFILFLGLPIGI
A0A290QD69      SRLSEISIISQL---DNVNITIHDKALVPGF-PDTGTPKEVIKQAAALAFVLFFGIPVGL
A0A2E7VDS1      NRLNEVKVTRAL-PQEDDPLKRDSPAVTPTS-PFEPDKSSIHRTGALIFLACFILIPMAF
A0A178IFJ2      SRLNEASLTAQL-GNSNIKIAERARPPTV---PLEPNPKKILLSIGFLGVLIVIGYPVGM
A0A357FSP9      QRMTQERAAVNL-KNPNSRVIDEALPPLR---HSSPNIVMNLAAGFFGGLAVGAGLIFVV
A0A538NJ59      NLLQNVDISRNI-DQGTLAILDPASEAV----RSYKQDVSLLAMTLAAGLLAGFGCVFLV
A0A3C1VFY9      ATFQTLNVNKDA-SPETVTIYQPASDAF----PDTTLLKKGLMFAGLLGLGLGLAILILM
A0A522AC27      ATMQTLDVNKEI-SPESVTIMEPAFDAV----PERPPIIQSLFKAGLIGLGASLAILLLL
A0A2A2R174      KRLRELDIVSGDKSKSEVRVIEPANLPLT---PIRPNKKMLLLYALAAGTALSVGVIWLL
A0A1H2DTI1      QSVQKIDLNRRL-DEQRFTLMEPPSDAT----SIKDQYQVRLLSAGLGGLIVGMAILFII
A0A1V5L462      RRKERLDIGRNV-DTELISVLVPATSAV----LRQVDKRREIAKGGALGLGMGAAIVFLL
A0A2A2R3V9      SSVQSVDLSQNI-DQEMISIMEHPGLAQ----PVHVGMSGMLLNGFLLGLLAGVGILFLL
A0A3D3LGD3      TRYFETKAGLEI-FKSPATIYAKAEPEGR---PAKPNVALNLALGGILGLMFGFGLAFAL
A0A350ARX4      DSIQAIQSNQNI-EQDTIGILAHASRAG----VQPPQVGKKVAEGAAFGLAVGIVIIAAI
B5JIS2          RRVSNANVVSNL----PVDVMRVVDPAFIAK-PKLAKRKLVAAFTVLLAGGAFFGVPLGM
A0A1H2GQN6      IRYKQENLDQQSPSQPATVISPANTNPN----PVRPILWLNITLSGVAGLLLGLSVAFFI
A0A512M3Y3      KRLTAMDYTG---IDVRVEFEWQGFTYLRNDVPISPNKQKLLLYGVMLGVGCAAGGCFGL
A0A4P5R5J1      GQLRSMDVYKNL-AQDTVLILEHATKPE----QIQMELNKLLLIGGFGGLALGLLVLFVL
A0A4P5YK43      RSLLALEST----PTNEETISTVEEGVGLEK-PVGPNRPKIILLGLLLGLFSGIGIVYVL
A0A2A2RPW6      NRLREIDLTGNIEKKSEFRIIEPASLPSI---PIRPNKKMILLYALMVGMAASVGLIWLL
B4D1I7          RSKGNVEINRNV-DQDIISIRQRASAAT----PQKPGAVKTVGTGIGLGLFVGLLLLVLI
A0A353F286      FKHSEAKILLKM---PRDPITLHEKPKKASK-PVFPNFTMNLLLGAGVGLIFGIAIALLL
A0A354FSA6      FKHSEAKILLKM---PRDPITLHEKPKKASK-PVFPNFTMNLLLGAGVGLIFGIAIALLL
A0A3B9GA54      FKHSEAKILLKM---PRDPITLHEKPKKASK-PVFPNFTMNLLLGAGVGLIFGIAIALLL
A0A520LEH8      FKHSEAKILLKM---PRDPITLHEKPKKASK-PVFPNFTMNLLLGAGVGLIFGIAIALLL
A0A6B2M0T8      QRLNEAILASQL---SDVNLRVVDQAWPAGA-PFTPDVKKIYSVTVFLFLFAFSCVPFGI
A0A2D7B7R6      DQIQSIEFTAES-EGTTIELAEKATEPS----TIEPNKTQRIILGVLLGLGLAYGYLYLM
B1ZT68          DRLNEASVASQM---ENTNIKIFDPAYVPGG-PIGDALAILIAKASFIGVGLFVLIPLGM
W0J7C2          DRLTEAGITSRM---ANTNIAIFDPAWVPDA-PSDTGALEIAVKAGAAGLGLLFVLPLGI
A0A2E5K4P7      MLKFKEDVRTDT-KNSSVNIYVDGVAPTK---HFTPSLTLNLAFGTIGGAGFGLFMVFFT
A0A0R2XPB1      DSLQAIDTNQNL-QQETVSILVNARKPI----PAGVGLVQQFAMGALFGVVLAAGILFVL
A0A348NQP1      DSLQAIDTNQNL-QQESVSILVNARKPI----PAGVGLVRRFAMGGLFGLILAAGVLFVL
A0A357FV58      DSLQAIDTNQNL-QQESVSILVNARKPI----PAGVGLVRRFAMGGLFGLILAAGVLFVL
A0A2V6F9Q9      NDLKAVDVSQVVDAGDQISIMEPATPPV----SVRPGLIKSLLLGFGGGAVAGILILLVL
A0A2V6NZZ3      NDLKSVDVSQVIETGDQISIMEPATTPV----SVRPGLLKSLLLGFGGGALVGIMVLLLL
A0A2V6EBU2      NDLKSVDVSQVIETGDQISIMEPATTPV----SVRPGLLKSLLLGFGGGALVGIMVLLLL
A0A2V6EY06      NDLKSVDVSQVIETGDQISIMEPATTPV----SVRPGLLKSLLLGFGGGALVGIMVLLLL
A0A2V6ME53      NDLKSVDVSQVVDTGDQISIMEPATSPV----SVRPGLLKSLFLGFGGGALVGIMILLLL
A0A538NUU0      NDLKSVDVSQVVDTGDQISIMEPATSPV----SVRPGLLKSLFLGFGGGALVGIMILLLL
A0A2V6NIJ1      NDLKSVDVSQVVDSGDQISIMEPATPPV----SVRPGLLKSLLVGFGGGALVGIVILLLL
A0A2V6C292      NDLKSVDVSQVVDSGDQISIMEPATSPV----SVRPGLLKSLLLGFGGGALVGIMILLLL
A0A2V6D2X0      NDLKSVDVSQVVDSGDQISIMEPATSPV----SVRPGLLKSLLLGFGGGALVGIMILLLL
A0A2V5ZUK1      NNLKEIDVSQVVGGEDQVSIMEMATTPV----SVRPGLIKSLLIGFGAGALLGLGILILL
A0A2V5XFN9      NNLKEIDVSQVVGGEDQVSIMEMATAPI----SVRPGLIKSLLIGFGIGALAGLAILILL
A0A2V6EZC8      NNLKEIDVSQVVGGEDQVSIMEMATAPI----SVRPGLIKSLLIGFGIGALAGLAILILL
A0A2V6I7Z5      NNLKEIDVSQVVGGEDQVSIMEMATAPI----SVRPGLIKSLLIGFGIGALAGLAILILL
A0A3B9LCP2      NNLKEVDVSQVVDSGDQVGIMDMATPPI----SVRPGLIKSLLIGLGCGLLAGIGILILL
A0A3C0R669      NNLKEVDVSQVVDSGDQVGIMDMATPPI----SVRPGLIKSLLIGLGCGLLAGIGILILL
A0A2V6EID2      NNLKEVDVSQVVDSADQVSVMEMATPPI----SVRPGLIKSLLIGLGCGLLAGIGILFLL
A0A2V6MHB0      NNLKEVDVSQVVDSADQVSVMEMATPPI----SVRPGLIKSLLIGLGCGLLAGIGILFLL
A0A2W5YWL9      NDLKSVDVSQVVDTGDQISIMEAATAPI----SVRPGLLKSLLIGLGCGALAGFGILLLL
A0A2V5NH62      NSLKDVNVSQSVDSGDQVSIMEMASGPV----SVRPGLIKSLLIGLGIGALAGIAILLLL
A0A2W6A620      NNLKDINVSQSVDSGDQISIMEMAGAPI----SVRPGLLKSLLIGLGCGALAGIGILLLL
A0A2V5PIJ4      NNLKEVNVSQVVDTGDQIAIMENATAPV----SVRPGLIKSLLMGLGAGILGGLAVLFLL
A0A2V6K2G8      NNLKDIDVSQVTGSEDQVSIMEMATAPI----SVRPGLIKSLLIGFGIGALAGLAILILL
A0A2V5W206      TNLKDIDVSQVTGSEDQVSIMEMATPPI----SVRPGLIKSLLIGFGIGALAGLAILILL
A0A2V6MW77      NNLKEIDVSQVVGGEDQVSIMEMATSPV----SVRPGLIKSLLIGFGIGALAGLAILVLL
A0A2G4GZN8      LSYEDAKLRSST-SGTSTSISILDAPSVSDK-PINKNYYFSALVGIGSGLLFGVVLIIVI
A0A348NPT1      QRMTQERAAVNL-KNPNSRVIDEALPPLRH---SSPNIVMNLAAGFFGGLAVGAGLIFVV
A0A2E1KV60      SLMAEEKIQVNI-KNANARIIDKAFPPPEDQ-PSSPNVFLNLAGGFFGGIFFGLGLVFAV
A0A2D7F4D9      ALMAEEKIQVNI-KNANARIIDKAFPPREDR-PSSPNVFLNLAGGFFGGMIFGLGLVFAV
A0A3R7RBR8      ALMAEEKIQVNI-KNANARIIDKAFPPREDR-PSSPNVFLNLAGGFFGGMIFGLGLVFAV
A0A2E0NH28      SRMTMQKAQINL-KNPNARIVDEALPPLRH---SSPNLFLNIALGAFGGVVXGLGLVFGI
A0A350AS32      SRMTQEKAQVNL-KNPNARIVDEAFPPMKH---SSPNVVMNLAAGLFGGVAVGMGLVFIV
A0A368BGT4      LRMTTEKAQVNL-KNPNARIVDEAFPPPEDQ-PSSPNIVLNLFAGFFGGIAFGVGLIFSV
A0A2E0V4K6      VAMEESKVNQ---IDDEVIADLHSRASTPET-AVYPNRIRSYFAGGAGGAACGVGLILLL
A0A2E6NAH3      QRMTTEKAQVNL-KNPNARIVDEAFPPREDQ-PSSPNVVLNLAAGFFGGIATGVGLIFAV
A0A2A5VZA5      SRMTQEKAQVSL-KEANARVVDDAFPPL--R-HSSPNITVNLLVGVFGGLAVGGGLVFIV
A0A424R295      SRMTQEKAQVSL-KEANARVVDDAFPPL--R-HSSPNITVNLLVGVFGGLAVGGGLVFIV
B4CZV9          REINEVEFAGEK---ERINLKYSGLLEVRDD-PVSPNRLRIMLLSFVGGLVLALGIPFLI
A0A290QE54      DRLSQATTSSNL---ERISVRPLDPATPAGA-PYTPDIRSIAKTSIGLFVLVFVGVAIGL
A0A1H1SWX2      NRLNQVTTSKNL---ENIPVKPLDRALPKGS-PDTPNIRNIVKTSIGLGLVVFAGVAIGL
A0A4Q1C9I5      DRLAQATTSKNL---ENIPVKPLDQALPAGA-PYTPNLRNIIKTSLGLGLLVFVGVAVGL
A0A3B9FM17      SRLNDVNIEQALPSEQDEPLRVDSVAYEPGG-PYAPDKNRIREEGMMIFAVLFILIPVCL
A0A1G3ZL71      DRLNQTTTSKNL--DSRVPLRVIDRATPSHA-PYTPNLARVVRTSTIVGLLIFFGVAFGL
A0A556QP09      DRLSQATTSKYL--E-KIPVRPLDPALPAGK-PYTPDLGRIARTAVGVGVLVFFGVAIGL
A0A2T6DX88      DRLSQTTTSSKL--E-KIPVRPLDRATPTPA-PYTPNMTRVIRLSVIVGLLVFVAVAFGL
A0A2T6CWI7      KRLTDTTTVKNL--D-KIPLHPLDHAVANRW-PVSPNRQKITRTAIGLGLMVFLGVALGL
A0A3E1E5C8      NRLNETTTTRNL--E-KIPLHPLDAAVVPGG-PYEPDLARIIRTCLGVGLLVFFAAGLGL
B1ZZ74          DRLNQTTTTKNL--E-KIPLHPLDHAVVPGA-PFTPNLNAIIRLCVGVGVMVFFGVAFGL
R7E4L8          KKREENALALAT-TEPSARILEPAFGSNA---PVAPRLSLMTMGGMAGGAFASLLALLAG
A0A4Q3BVY2      QKLATVTFAEDF---DWVELRFKGLVSLRDEVPISPSKFKVAIIALTLGVAGAFGVPTAL
A0A4P6PCA7      QRTENTRLAA---EQDTAFVKVLREATVPRI-PVAPDKKKIVIVTVFLFGIIGAGLAILM
A0A0E3YV65      NRLNETSITAQL---ANSNVRVADGGTPAGL-PLEPDPRKIAITLLVLGLGVFVAYPVAL
W0J900          GRLNETSLTAQL---GNSNIKISERAQIPTF-PIEPDPKKIFRALGFLGLLIIIGYPVGM
A0A2T6DSN5      GRLQEATIVSRL---ENVNIRILDRANVPSV-PANGTPKDTALQASALGLFLLFGIPLGL
A0A2V2SMX4      ATMQTLDVNKQI-NPESVTIYEKATQA---Y-PDRVNLPMKLALGAVAGLGLSLLVMLFV
A0A317ZIW7      EALRAIDTGQSL-SQETVSVLEDASPA---Y-PAGQGTVIRLAEGAAYGIVLAIGVLALI
A0A2D7WMI4      KRLNDVTIEQAFPQDQDDPLQKEQFAFVPGG-PYSPDKNGIYKKSFGIFVGIFFVVPFLL
A0A2D6VHX5      KRLDDVRIEAALPSEQDDPLQKDQLAFTPXS-PYSPDYNKIKQQGVLIFVGIFLVIPIAL
A0A2D8I214      KRLNEVRIEQALPSEQEEPLHKEQYAFLPGG-PYTPDKAKIKRTGIYIFLGLFILIPVSL
A0A1Z8VL41      KRLNDVKIEQSLPSEQDDPLHKENFASLPGG-PFSPDKNAIKQKGLXIFFAVFIIVPILL
A0A2E6TNA4      KRLNDVKIEQSLPSEQDDPLHKEQFASLPGG-PFSPDKNAIKQKGLIIFFVVFIIVPILL
A0A1Z8RG47      DRLNDVRIEQALPSEQEEPLHKEQFATQPSA-PYTPDKNQIRQSGFMIFFSVFFALPILL
A0A1Z8RJJ5      DRLNDVRIEQALPSEQEEPLHKEQFATQPSA-PYTPDKNQIRQSGFMIFFSVFFALPILL
A0A2D7V631      SRLNDVRIEQALPSEQEEPLHKEQFAYQPFA-PYTPDKNKIRKSGFIIFFAVFFALPILL
A0A354RA24      SRLNDVRIEQALPSEQEEPLHKEQFAYQPFA-PYTPDKNKIRKSGFIIFFAVFFALPILL
A0A2E9RV62      RRLQDVVIQIELPQEQDDPLHKGNIAY-PGI-QISPNLPEIHKTGFMIFAALFVLIPFGF
A0A2E4AY96      KRLNDVTIEQAFPQEQDNPLQKEQFASLPAS-AYSPDKAAIQKKAATVFLAIFILFPFLL
A0A3B9B9P4      KRLNDVTIEQAFPQEQDNPLQKEQFASLPAS-AYSPDKAAIQKKAATVFLAIFILFPFLL
A0A2D5Y6N6      NRLNDVRIEQALPSEQEEPLNKEQFAYLPGA-PFTPDKNKIKRDGTMLGLAIFVIIPFLL
A0A2E7HSS8      SRLNEVKIEQALPSEQDEPLRMESFANEPGG-PYSPDKQKIKEQGIMIFSVLFILIPICL
A0A2D8VCK3      SRLNDVNIEQALPSEQDEPLRVDSVAYEPGG-PYAPDKNRIREEGMMIFAVLFILIPVCL
A0A350QVY4      ARLNDVKIEQALPSEQDEPLRVDSVAYEPGG-PYAPDKNRIREEGMMIFAVLFILIPVCL
A0A2E4ZYR7      KRLNEVKVTRELPQDEDDPLRRGDVAMTPAT-PISPDKAAIRRTGILIFVACFILIPIGF
A0A2E6TCV1      KRKKEVEVTGALPEAQTDPLQISDVATVPYL-PVSPDKAAIKTKGILIFFACFVLIPIAF
A0A3D4HHL8      ASIQSIDINLNL-DQEFLTILENASPA---Y-AVRISIVKNLVMGVVAGVFMGVGILFII
A0A366HV03      KMIATINFGGDK-DRVDLQFREFALLRDVD--PVSPTKSKLAILAAVLGLGLAIGVPLGL
A0A6G6K911      KMVATINFGGDK-DRVDLQFREFALLRDVD--PISPTKSKLLILAVVLGLGLAIGVPLGL
A0A5R8KAF2      DKLSMISFTQDL-DWVEMHFKEFVNLR-DVE-PTSPNKMKLLMISLMLAIGGAIGAPTLV
A0A2V2SDN0      SVISTVDVGKSV-DQENVSVLEPASPAGRAS-----KLVRNLALAFAMALVLGAGLLWVL
A0A1V6GL40      ATMQTLDVNKEI-SPESVETI---EAASPAY-AARLDLWKGAVNGALLGLALGLGLLLVL
A0A2V5X6Z6      TLIQTVDVSKKV-EQENVGIL---EPASVAA-PTH-RLFRNMAIALVGSLLLGFGLLYCI
A0A2V5VGZ7      TLIQTVDVSKKV-EQENVGIL---EPASVAA-PTH-RLFRNMAIALVGSLLLGFGLLYCI
A0A2V5U130      TLIQTVDVSKKV-EQENVGIL---EPASVAT-PTH-RVLRNMAIALIGSLLLGFGLLYCI
A0A2V6C237      TLIQTVDVSKKV-EQENVGIL---EPASVAT-PTH-RRLRNMAIALVGSLLLGFGLLYCI
A0A3R8L982      DRLSQVNTSRNL-EKLPVRRLDRALPA--GA-PYSPNPRSITQTSVALGLLVFFGVAFGL
A0A2E7HPU9      TQLAE--LNAKK-GETAVEVELDSFSELPRK-PSSPKQLTTLGAGTILGSVLGFALAFLL
A0A388PR45      LNYEEAKLRTAT-SGISTSIRVMDKPSVSDK-PVNKNFSVNALAGLALGFFAGVGLVLLL
A0A388QR61      LNYEEAKLRTAT-SGISTSIRVMDKPSVSDK-PVNKNFTFNALAGLLLGLFSGVGLVVLM
A0A4P5YHI0      LNYEEAKLRTAT-SGISTSIRVMDKPSVSDK-PVNKNFTFNALAGLLLGLFSGVGLVLLM
A0A2A2RS01      QNYEEQKLRSST-SGTSTSIKIQEMPSVADR-PVNKNYYMNALTGMGLGLLVGFGLIVLM
A0A2A2Y1A7      QNYEEQKLRSST-SGTSTSIKIQEMPSVADR-PVNKNYYMNALTGMGLGLLVGFGLIVLM
A0A388PDH9      QNYEEQKLRSST-SGTSTSIKIQEMPSVADR-PVNKNYYMNALTGMGLGLLVGFGLIVLM
A0A2G4H1E7      LSYEDAKLRSST-SGTSTSISILDAPSVSDR-PINKNYYYAALIGFGSGLLFGIVLVFVL
A0A2G4GZA6      LSYEEAKLRSSN-SGTSTSINILDAPSVSDK-PINKNYYLNALVGMGSGLLFGVVLIVVI
A0A388P514      LSYEEAKLRSST-SGTSTSISILDQPSVSDK-PINKNYYFNALVGVGSGLLFGVVLIVVI
A0A2A2YG59      LSYEEAKLRSST-SGTSTSISILDAPSVSDK-PINKNYYFNALVGVGSGLLFGVVLIVVI
A0A2G4F7D5      LSYEEAKLRSST-SGTSTSISILDQPSVSDK-PINKNYYFNALVGVGSGLLFGVVLIVVI
D5EML0          NRYRETRIAQQM-NLNNMLVLDRANLP--MQ-PLTMSRTQMVAAAIVLGAVFLVGCPLVI
A0A3C1C1M3      TRIQEARLSADE-NTATVKLASEVAP---AR-QIFPRPARVLLMALLLGLAVGFGLAILT
A0A2E9EYJ1      SQLAKETIDSAG-QRTPLVIHELAEPQDVDK-PARPNXKLHLVLGAAVGLIFGIGMAFFL
A0A258AXR6      SRYFEEKAGIEL-VKSPATIYSDAEPE--GK-PAKPNVPLHLALGGVLGLMFGLGLAFFL
A0A3D3NZQ6      TRYFETKAGLEI-FKSPATIYAKAEPE--GR-PAKPNVALNLALGGILGLMFGFGLAFAL
A0A1T4WVZ9      SSYFETKAGLEL-VKSPATLYAKAEPE--GK-PAKPNVALNLALGGVLGLMLGVGLAFFL
A0A4R7SSI6      SSYFETKAGLEL-VKSPATIYAIATPE--GK-PAKPNVALNLVLGGVLGLMLGIGLAFFL
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      NFLDDSIKSQDDVESYLKLPFLGYIPNIK-TTSVIERDLQSH------------------
A0A660Q3A0      EYLDDTIRYPEEVTEGLGLPFFGVIPTAQWDPDDLATHLLSN------------------
A0A2V5UAD5      AVRDDRFITLTDVIEKLGDAVLGQVPEVR---KRRRKSPLPL------------------
A0A258AXL1      ERLRFTSSFVGEAEKYCQYPACGIVPLME---IDDRRL-VPQ------------------
A0A2E6T1E0      NFLDDSIKSQDDVETYLNLPFLGYIP--------NIKT-TSI------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      EVIDNRIKSPWDIETFVGEDLLTGIQKIS---EIDELRRPKI------------------
A0A2V5U7A0      EYIDSHLNTPEHVWRAVDLNTLGVVPDLD---SLGHRPLISYAPASRAKLLPTRMGQTQL
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ----------DDVEHYLGVPVLAVIP--------------------------KDVG--VL
A0A3D4CZT6      EYLDTSVKTLEDVERYLQVPVLAVIP--------------------------TDVG--VL
A0A4V1S9Q4      EYLDTSVKSLEDVERYLQVPVLAVIP--------------------------KDVG--VL
A0A355VK99      AMLNNKVNNKHDLPSVNRQPVIAELP--------------------------QMSK--KE
A0A2V6N5E0      DRIDDRMASFSEFQHHFSENILGQIP---------------------------KEK--TK
A0A2V6NH44      DRIDDRMASYGEFQRHFSENVVGQIP---------------------------KEK--VK
A0A432FDF6      EYLDTSVKTIDDVERALNAAVLGVIP--------------------------QNVG--SL
A0A522ACN3      EYLDTSVKTIDDVERTLQSPVLGVIP--------------------------QNVG--YL
A0A353DCA1      EHLDTSVKSLEDVERYLQVPVLAVIP--------------------------KDVG--VL
A0A3C1AXQ2      EYMDTSVKSLDDVERFLGVPVLAVIP--------------------------KDVA--VL
A0A3D0IZR7      EYLDTSIKTMDDVERFLGISVLAVIP----------------------------------
A0A520LRZ3      EYLDTSVKSLDEVEHFLELPVLAVIP--------------------------QAVG--VL
A0A356FSV4      AFLDDRVKSAFDIEGTIGLPLIGIIP------------------------QIKKLD--ST
A0A3D3DET9      DRLDDRVGSFTELQDLFDENVLGQVP------------------------REKLVA--SK
A0A355SVK9      AFLDDRVKSAFDIEGAIGLPLLGVVP------------------------QIKKLD--AH
A0A2E5D7I3      LXLDNRFXTVSQVEXETGMPVLAAVPVLE---AKKLEAAEXSESXSXAKTXEGEGA--PR
A0A2V5NYE2      DRLDDRVNSVTELQDLFDEPILGQVP------------------------QERAPA--RR
A0A2V6FIP7      NYLDDSIKSQDDVETYLRLPFLGYVPNIK---TNSVLERDLQ------------------
A0A353DI77      QFVDNKIHGVADIEQTFGISILSAIQKLP-------------------------------
A0A1V6GCZ3      EYLDTSVKTIDDVERALQCPVLGVIPQNV----------GLL------------------
A0A3C1UJT2      NMMDQSIKSVEQAEKILQLPVLAAVPVSE---INGKPTDSRL------------------
A0A2S7U0Z3      SILDYKIYDVRSAEEATGLTCMAAIPASS---KFGRQDKWQS------------------
A0A5E6MKA7      AKFDTRLRGKEEVERALGLPVLGMVPDTE---KLRAKGIDEIPADLPMALA---------
A0A6B3L936      SLMDYKIYDVRSAEEATGLPCLAAIPLSS---AVDSEDGEWRS-----------------
A0A2N8IR72      AMLNNKVNNKHDLPAANRQPVIAELPQMS---KKESKNTKLF------------------
A0A2N8IV96      EFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSDV-----------------------
R7E1V8          EFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSDV-----------------------
A0A1T4WWY4      RRFDSSVVELSEFEGTLGINGIGLVPLSD-PKELESLNRAPT------------------
A0A3D3LEQ6      KQMDSTVTDLNEFEETLGIPGIGLVPLTD-PEVLEEVNRSQT------------------
A0A3D3NW23      KQMDSTVTDLNEFEETLGIPGIGLVPLTD-PEVLEEVNRSQT------------------
A0A2E0R252      GFLDPTVRTVADLEVLTGTPVIGAMPASK---NTERKGSLAL------------------
A0A3E1EF48      GFLDPSIRTVGELERDARLPVIGAVPSSSSKGDGTKRELVLL------------------
A0A2A2PVG8      GFLDPTLRTVAEVEQFCGIPVVAGLPAFK---KRESRAESLE------------------
A0A2E0R421      GFLDLTIRTVSELEGMTGKPVLGAIP--D---EKNPGEGVLV------------------
A0A2E5EJ69      QQLDKTVKSIDEAERLFGVPVVGAVPKNP---EIKDDQGRLF------------------
A0A2G4I5Z5      VQLDTTIKSVDHAERLLGIPVLGAVPKNK---LIKNGKGRLF------------------
A0A4P5QQV6      SMFDDRIDSVVDFQATFPDRLLATIPHVS---CAVGAVDVAP------------------
A0A2E7ALI1      LRLDNRFRTVSQVEEETGMPVLSAVPVLE---LRKIEAAEK-------------------
A0A178IDB9      GLMDTRVKSSHDVETGLDHPLLGGIKTMK---KLTEAERPNV------------------
A0A290QD69      GFLDTRVKSSHDVESGLNQTLLGGIKAMK---KLSETERPNV------------------
A0A2E7VDS1      EFIDNRVKSPWDIEVFLGRDLIAGIPKIS---TIKEAERPLI------------------
A0A178IFJ2      ELLFNRIKTWTDVERYIGLPLLSEFPVLK---NLPGDTLNHL------------------
A0A357FSP9      AFLDDRVKSAFDIEGTVGLSMLGVVPRIK---KLDSNSKAQA------------------
A0A538NJ59      AVRDDRFITLTDVIEKLGDAVLGQVPEVR---KRRRKSPLPL------------------
A0A3C1VFY9      DRVDDRMSSFTELEELFDEDVLGNVPREK---SPDKNTVLPL------------------
A0A522AC27      DRLDDRMNSYTDLQDLFDEEVLGQIPHEG---LEKGQKHLGL------------------
A0A2A2R174      VQLDTTIKSVDHAERILGLPVLGAVPKNK---LIRDGKGRLF------------------
A0A1H2DTI1      DRFDDRINSTTELRDYFSERILGQMPFEV---SLGDRSNRRL------------------
A0A1V5L462      AALNNRITSADDLRRMFSSKVIGLIPQTK---AKITV-----------------------
A0A2A2R3V9      DRIDDRINSFTELRDHFEEPVLGQIPMDP---TLARKKGGPSL-----------------
A0A3D3LGD3      EFMDTSIKSLDDVERFLGVPVLAVVPKNV---GILHRATG--------------------
A0A350ARX4      SFLDVRIRNSDELAKRFDHPVIGVIPEEL---QNANGQIDLL------------------
B5JIS2          QLFDQRLKCATDIEKEFGKGLLGGIPKLS---RVKVADRPHV------------------
A0A1H2GQN6      EYLDTSVKSLNDVEKTLGVPVLGIIPRGV---KP--------------------------
A0A512M3Y3      EKLRSTTSLVTETEKLTGLNAVGVVPLLA---NSAQVETLAINEH---------------
A0A4P5R5J1      DKMDDRIGSFFEFRERFPEPLLGQVPREL---TKAGLDL---------------------
A0A4P5YK43      YRLDDRLDLAEDIEESLQEPVLGQIPAVD---RKNHADGPLL------------------
A0A2A2RPW6      VQVDSSIKSVDHAERVFGLPVLGAIPKNK---LITDGKGRLF------------------
B4D1I7          DQLDDRVASYTEFQSYFRERVFAQIPHSP---SDGRSESPAI------------------
A0A353F286      EHLDTSVKSLEDVERYLQVPVLAVIPKDV---GVLHKQSG--------------------
A0A354FSA6      EHLDTSVKSLEDVERYLQVPVLAVIPKDV---GVLHKQSG--------------------
A0A3B9GA54      EHLDTSVKSLEDVERYLQVPVLAVIPKDV---GVLHKQSG--------------------
A0A520LEH8      EHLDTSVKSLEDVERYLQVPVLAVIPKDV---GVLHKQSG--------------------
A0A6B2M0T8      HYLNLNLKTATDIEQQLRVPFLGEIRTFP---RRLKKLHRLV------------------
A0A2D7B7R6      NMMDQSIKSVEQAEKILQLPVLAAVPVSE---INGKPTDSRL------------------
B1ZT68          GLMDTRIKTVSHVEDALGEVLLGAVKTID---GLGEIERAHV------------------
W0J7C2          GLLDSRLRTPAQVEDSLQEPLLGVVKHMG---KLGETERARI------------------
A0A2E5K4P7      AFIDNRVKSPFDIEQVIKLPLVGVIPQIR---KLDSFKKARI------------------
A0A0R2XPB1      AAIDNRILTASELSAQFKDPLIGVIPFEV---NHDGDVNSVL------------------
A0A348NQP1      AAMDSRILTASELSAQFKDPLIGAIPFEA---SNDGDENSVL------------------
A0A357FV58      AAMDSRILTASELSAQFKDPLIGAIPFEA---SNDGDENSVL------------------
A0A2V6F9Q9      DRIDDRMASYGEFQRHFLENVVGQIPKEK---AKGKMPL---------------------
A0A2V6NZZ3      DRIDDRMASYGEFQRHFSENVVGQIPKEK---VKGTMAL---------------------
A0A2V6EBU2      DRIDDRMASYGEFQRHFSENVVGQIPKEK---VKGTMAL---------------------
A0A2V6EY06      DRIDDRMASYGEFQRHFSENVVGQIPKEK---VKGTMAL---------------------
A0A2V6ME53      DRIDDRMASYGEFQRHFSENVVGQIPKEK---VKGTMAL---------------------
A0A538NUU0      DRIDDRMASYGEFQRHFSENVVGQIPKEK---VKGTMAL---------------------
A0A2V6NIJ1      DRIDDRMASYGEFQRHFSENVVGQIPKEK---VKGTMAL---------------------
A0A2V6C292      DRIDDRMASYGEFQRHFSENVVGQIPKEK---VKGTMAL---------------------
A0A2V6D2X0      DRIDDRMASYGEFQRHFSENVVGQIPKEK---VKGTMAL---------------------
A0A2V5ZUK1      DRIDDRMASFSEFQHHFSENVLGQIPKEK---AKGRVEL---------------------
A0A2V5XFN9      DRIDDRMASFSEFQHHFSENVLGQIPKEK---TKGKVDL---------------------
A0A2V6EZC8      DRIDDRMASFSEFQHHFSENVLGQIPKEK---TKGKVDL---------------------
A0A2V6I7Z5      DRIDDRMASFSEFQHHFSENVLGQIPKEK---TKGKVDL---------------------
A0A3B9LCP2      DRIDDRMASFGEFQRQFSENVLGQIPKDK---TKGEVTL---------------------
A0A3C0R669      DRIDDRMASFGEFQRQFSENVLGQIPKDK---TKGEVTL---------------------
A0A2V6EID2      DRIDDRMASFGEFQHQFSESVLGQIPKEK---TKGKLTL---------------------
A0A2V6MHB0      DRIDDRMASFGEFQHQFSESVLGQIPKEK---TKGKLIL---------------------
A0A2W5YWL9      DRIDDRMASFSEFQHHFTENVLGQIPKEK---SKGKVQL---------------------
A0A2V5NH62      DRIDDRMASFGEFQHHFSENVLGQIPKEK---TKGRVSL---------------------
A0A2W6A620      DRIDDRMASFGEFQHQFSENVLGQIPKEK---TKGRVTL---------------------
A0A2V5PIJ4      DRIDDRMASFGEFQHQFSENVLGQIPREK---VKGDVML---------------------
A0A2V6K2G8      DRIDDRMASFSEFQHHFSENVLGQIPKEK---TKGRVDL---------------------
A0A2V5W206      DRIDDRMASFSEFQHHFSENILGQIPKEK---TKGKVDL---------------------
A0A2V6MW77      DRIDDRMASFSEFQHHFSENILGQIPKEK---TKDKVDL---------------------
A0A2G4GZN8      GTLDDRIKSAKDVEGSLGLPLIGTIPRAT---VTSGPDRALL------------------
A0A348NPT1      AFLDDRVKSAFDIEGTVGLSMLGVVPRIK---KLDSNSKAQA------------------
A0A2E1KV60      ALLDDKVKSVFDIEASIGLPMLGIIPKVK---KLDSVSKSHI------------------
A0A2D7F4D9      ALLDDKVKSVYDIEASLGLPILGIIPKVK---KLDSVSKSHI------------------
A0A3R7RBR8      ALLDDKVKSVYDIEASLGLPILGIIPKVK---KLDSVSKSHI------------------
A0A2E0NH28      AFLDDRVKSAFDIEGTIGLPLIGIIPQIK---KLDSTTKAQA------------------
A0A350AS32      AFLDDRVKSAFDIEGTIGLPMLGIVPRIK---KLDTNSKAQA------------------
A0A368BGT4      AFLDDRVKSAFDIEGTIGLPMLGVIPRIK---KLDSNAKAQA------------------
A0A2E0V4K6      LRIDNRFRTVAQVEEETALPVLAAVPVLS---AKRLS-----------------------
A0A2E6NAH3      AFLDDRVKSAFDIEGTIGLPMLGVIPRIK---KLDTSTKAQA------------------
A0A2A5VZA5      AFLDDRVKSAFDIEGTIGLPLLGVIPRIK---KLDSSTKAQA------------------
A0A424R295      AFLDDRVKSAFDIEGTIGLPLLGVIPRIK---KLDSSTKAQA------------------
B4CZV9          EYLDHTMTNLEEVEHSFRLRGLGVVPQTE---ATDMFLPATA------------------
A0A290QE54      SFIDDRIKSSWDVEHFIGVHLLGIVPDLS---GLKDDDKYSL------------------
A0A1H1SWX2      SFLDDRVKSAWDIEGFIGAHLLGIIPELG---DVPDTEKHSL------------------
A0A4Q1C9I5      SFVDDRVKSAWDIEGFIGAHLLGIIPELG---DVPDTEKHSL------------------
A0A3B9FM17      EFIDNRVKSPWDIEVFVGNDLIGGIPKIS---EVEERERPLI------------------
A0A1G3ZL71      SVVDDRIKSAWDVESYLGVHLLGIIPELA---HVATDSLHTL------------------
A0A556QP09      SFIDDRIKSAWDIEHFIGANLLGIIPDLS---SLKDSEKYKL------------------
A0A2T6DX88      SIVDDRIKSAWDVESFIGVTLLGIVPDLS---SLKDDEKYSL------------------
A0A2T6CWI7      SFIDDRIKSAWDVESFVGANLLGIVPDLG---NLKDEEKYTL------------------
A0A3E1E5C8      AFLDDRIKSAWDVESYIGANLLGIIPDLS---AVTDDDKYSL------------------
B1ZZ74          SFIDDRIKSAWDVESFIGASLLGIIPDLA---ALKDDEKYSL------------------
R7E4L8          NALNTKVRDKKDLAGLTDLPLAGELPLLS---GKERKKLPLV------------------
A0A4Q3BVY2      NLLNTSASTVPQLEQLTGLEGIGIVPMTS---KEMLEDVARS------------------
A0A4P6PCA7      DFMMNRVGSVTDLKD-LGLHVLGILPRES---KYM-------------------------
A0A0E3YV65      ELIFNRVKGWSDVENYLGLPLLAELPLLN---KIKTEFLPHL------------------
W0J900          ELIFNRVKTWTDVERYIGLPLLSEFPVLK---KLPDDKLNHL------------------
A0A2T6DSN5      GLLDTRVKSPSDVEAGLEQVLLGGIKTMK---KLSETERPNV------------------
A0A2V2SMX4      DRLDDRMASFTELQELFDEEILAQIPREG---KAREVSGLPL------------------
A0A317ZIW7      SFLDNRIFSAADITNHFDEPLLGAIPFEK---NHDGDHTMVL------------------
A0A2D7WMI4      EFIDNRIKSPWDIEVFLGRELISGIPKIS---NIIENERPLI------------------
A0A2D6VHX5      EVIDNRIKSPWDIETFVGEDLLTGIQKIS---EIDELRRPKI------------------
A0A2D8I214      ELVDNRVKSPFDVEVFIGKDLIGGIPKIS---DVEEAHRPLI------------------
A0A1Z8VL41      EFVDNRVKSPWDVDVFIGKDLIGGIPQIS---QVEETKRPLI------------------
A0A2E6TNA4      EIVDNRVKSPWDVDVFIGKDLIGGIPQIS---QVEETKRPLI------------------
A0A1Z8RG47      EFVDNRVKSPWDVEVFVGHDLIGGIPKIS---EVDERERPLI------------------
A0A1Z8RJJ5      EFVDNRVKSPWDVEVFVGHDLIGGIPKIS---EVDERERPLI------------------
A0A2D7V631      EFVDNRVKSPWDVEVFVGHDLIGGIPKIS---EVEERQRPLI------------------
A0A354RA24      EFVDNRVKSPWDVEVFVGHDLIGGIPKIS---EVEERQRPLI------------------
A0A2E9RV62      EFIDNRIKSPWDIEVFLGQDLIAGIPKIS---EVKEVDRPLI------------------
A0A2E4AY96      EFIDNRIKSPWDIQVFLGRDLISGIPKIS---NIDEQERPLI------------------
A0A3B9B9P4      EFIDNRIKSPWDIQVFLGRDLISGIPKIS---NIDEQERPLI------------------
A0A2D5Y6N6      EFIDNRVKSPWDVEVFIGRDLIAGIPKIS---EVEENQRPLI------------------
A0A2E7HSS8      EFIDNRVKSPWDVEVFIGNDLIGGIPKIS---EIEERERPLI------------------
A0A2D8VCK3      EFIDNRVKSPWDIEVFVGNDLIGGIPKIS---EVEERERPLI------------------
A0A350QVY4      EFIDNRVKSPWDIEVFVGNDLIGGIPKIS---EVEERERPLI------------------
A0A2E4ZYR7      EFIDNRIKSPWDVEVFIGRDLIAGIPKIS---TIKEADRPLI------------------
A0A2E6TCV1      EFIDNRVKSPWDIEVFIGRDLVAGIPKIS---TIKEADRPLI------------------
A0A3D4HHL8      SILDSRIISVEDVENRFDQPLMGIIP--F---QKYDGDILNP------------------
A0A366HV03      EQLNDKITSLAALEKLTGLKGLGIVPTSS---STFLESVTRG------------------
A0A6G6K911      EQLNDKITSLAALEKLTGLKGLGIVPTAN---STFLEGVTRG------------------
A0A5R8KAF2      NLMHTGVETLQQLENVTGLTAVGVIPRTT---KEVLEDIARS------------------
A0A2V2SDN0      SKLDDRFVSSTELAEDLPEKVIGQVMDIQ---LVKPEGELRR------------------
A0A1V6GL40      DRLDDRVGSFTELQDLFDENVLGQVPREK---LVASKRQPSL------------------
A0A2V5X6Z6      GLFRDDFASLAELTHQLSEEVVGQIPAIS---IKKPKRRLGV------------------
A0A2V5VGZ7      GLFRDDFASLAELTHQLSEEVVGQIPAIS---IKKPKRRLGV------------------
A0A2V5U130      GLFQDDFASLAELTNQLCEEVVGQIPAIS---IKKPRRQLGV------------------
A0A2V6C237      GLFQDDFASLAELTNQLCEEVVGQIPAIS---IKKSKGRLCV------------------
A0A3R8L982      NLIDDRIKSAWDVEHFIGANLLGIIPSLG---DIKDHDRYKLFAVGPNAADESGGGNNNS
A0A2E7HPU9      ANLDNKFHTVSQVELMSGLPILATIQHI---------DLKVL------------------
A0A388PR45      GTLDDRLKSVRDLEGGLGIPVLGTVPKVS---ETAGPDRALL------------------
A0A388QR61      GMLDDRIKSVKDIEAGLGVQVLGTVPKVA---ETTGPDRALL------------------
A0A4P5YHI0      GMLDDRIKSVKDIEAGLGVQVLGTVPKVA---ETTGPDRALL------------------
A0A2A2RS01      GSFDDRVKSAKDVEMGLGLPLLGTVPKVT---EAVGPDRALL------------------
A0A2A2Y1A7      GSFDDRVKSAKDVEMGLGLPLLGTVPKVT---EAVGPDRALL------------------
A0A388PDH9      GSFDDRVKSAKDVEMGLGLPLLGTVPKVI---EAVGPDRALL------------------
A0A2G4H1E7      GALDERIKSAADIEGSLGLPLIGTIPQVV---RASGPDRALL------------------
A0A2G4GZA6      GTLDSRIKSAKDVEGSLGLPLIGTIPRVA---NVSGPDRALL------------------
A0A388P514      GTLDSRIKSAKDVEDSLGLPLIGTVPRVA---NVSGPDRALL------------------
A0A2A2YG59      GTLDSRIKSAKDVEDSLGLPLIGTVPRVA---NVSGPDRALL------------------
A0A2G4F7D5      GTLDSRIKSAKDVEDSLGLPLIGTVPRIA---NVSGPDRALL------------------
D5EML0          ELIDGRLTSFQDVEQGSHKALLGDVRFYG-------QKKGDA------------------
A0A3C1C1M3      EILEDRVGGIDDIEIGTGVKILAVLPHVK---TRKRKEIATT------------------
A0A2E9EYJ1      EYLDTSVKSLDEVEYYLDLPVLAVIP----------KDINVL------------------
A0A258AXR6      EYMDTTVKSLDDVEHYLGVPVLAVVP----------KEVGVL------------------
A0A3D3NZQ6      EFMDTSIKSLDDVERFLGVPVLAVVP----------KNVGIL------------------
A0A1T4WVZ9      EYMDTSVKSLDDVERFLGVPVLAVVP----------KDVAVL------------------
A0A4R7SSI6      EYMDTSVKSLDDVEKFLGVPVLAVIP----------KDVAVL------------------
                                                                            

A0A4Q3AQI1      -----RRQDAEAVEAIRRPKLADESQPTSYLLDREKSTETNLIENFRVIRTN--L-LSMG
A0A4P6PD26      ---------------------------------------------MVSCASN--K-PCFL
A0A1Z8SVB5      --------------------------------------MYGKIQMNSNVRGS--------
A0A2V5W3Y0      ------------------------------------------AESYRNVRSS--I-FFMP
A0A432FAS4      -----LHPQSNS------------------------------AESFRTIRAA----ISLS
A0A660Q3A0      -----IASNSGV------------------------------AEAYRNVRSA----LIFS
A0A2V5UAD5      -----LEIDDDRHVY---------------------------AESYRNLRSA--L-LYQG
A0A258AXL1      -----LPDGKESDAKVTTHA----------------------NESFRIIRSS--L-PFYA
A0A2E6T1E0      -----IERDLQAHLHPQSNS----------------------AESFRTVRAA--I-ALSQ
A0A2D5W0Q9      ------------------------------------------AEGFRTVRAAVSL----V
A0A1Z9KB52      -----VGDDLDDSL----------------------------TESFRSMYGK--I-QM-N
A0A2V5U7A0      DDISTRGKDLIVAHNPLSIY----------------------SEAYRTIRTA--L--LLS
A0A257LYL4      -------------------------------------------------RTN--I--EFN
A0A4Q2XXY1      HKQSGMSP-----------D----------------------AEAYRILRTN--I--EFN
A0A3D4CZT6      HKQSGMSP-----------D----------------------AEAYRILRTN--I--EFN
A0A4V1S9Q4      HKQSGMSP-----------D----------------------AEAYRILRTN--I--EFN
A0A355VK99      SRNTKLFIQDEHSV-----I----------------------AECFHILRNN--VDSMLP
A0A2V6N5E0      GKVDLLQPDDARHV-----F----------------------AESYRNIRSS--I-FFMP
A0A2V6NH44      GRMALLQPDDPRHI-----F----------------------AESYRNIRSS--L-LFMP
A0A432FDF6      LDEGDESP-----------H----------------------AEAYRVLRTN--I-LFAG
A0A522ACN3      FEEGSESP-----------H----------------------AEAYRVLRTN--L-LF-S
A0A353DCA1      HKQSGMSP-----------D----------------------AEAYRILRTN--I-EF-N
A0A3C1AXQ2      HRASGFNP-----------D----------------------AEAYRILRTN--I-EF-N
A0A3D0IZR7      KGAKFLTSDDPNSR-----F----------------------AEGYRILCAK--L-N-LT
A0A520LRZ3      HRQSGLSP-----------D----------------------AEAYRILRTN--I-E-FN
A0A356FSV4      TKAQAVASNVDRH------V----------------------TETFRSIHSA--I-R-LN
A0A3D3DET9      RQPSLILPEDTRHS-----F----------------------VEAYRNLRSS--L-LYMT
A0A355SVK9      SKAQAVASNVDRH------V----------------------TETFRTIHSS--L-R-LN
A0A2E5D7I3      EMVSLARDVVFRDGLHSSLY----------------------AESYRILRAA--V-M-LL
A0A2V5NYE2      AEIKLIEPEDSRHS-----F----------------------LEAYRNLRSS--L-LYMV
A0A2V6FIP7      -----AHLHPQSNA----------------------------AEGFRTIRAA--I-AL-A
A0A353DI77      -----PEEELLKEMESIRDLPVSMKHICPTLAVPGWKTDFVHSEMFRVLRAS--I-SL-L
A0A1V6GCZ3      -----VDEGTESPH----------------------------AEAYRVLRTN--L-LF-S
A0A3C1UJT2      -----VMIESPNSTC---------------------------SEAFRSLRVN--I-ES-M
A0A2S7U0Z3      -----ILSHDPHSAN---------------------------AESIRNLRAS--V-IL-L
A0A5E6MKA7      -----THVSPDSAI----------------------------SNSFRQIRTL--L-HY-S
A0A6B3L936      -----ISSSDPNTVH---------------------------AESIRNLRAS--I-TL-L
A0A2N8IR72      -----IQDEHSVI-----------------------------AECFHILRNNVDS-ML-P
A0A2N8IV96      -----MGPD---------------------------------AEAYRILRTN--I-EF-N
R7E1V8          -----MGPD---------------------------------AEAYRILRTN--I-EF-N
A0A1T4WWY4      -----VGANVPNAL----------------------------LENFRLIRSS--I-LLNG
A0A3D3LEQ6      -----VGSKVPNAL----------------------------LENFRLIRSS--I-LLNR
A0A3D3NW23      -----VGSKVPNAL----------------------------LENFRLIRSS--I-LLNR
A0A2E0R252      -----DAEDEQSQS----------------------------AEAIRTLRAG--L-TF-L
A0A3E1EF48      -----SRKD--PHA----------------------------SEAIRTLRTG--L-TL-L
A0A2A2PVG8      -----LARDAQSKP----------------------------AESIRTLRTG--L-TF-L
A0A2E0R421      -----LNCKDTPLQ----------------------------AEAIRTLRAG--L-TF-L
A0A2E5EJ69      -----VTKAPNSSC----------------------------AEAFRTLRAS--I-SL-L
A0A2G4I5Z5      -----ISDDPQSLC----------------------------AEAFRSMRAS--L-GL-L
A0A4P5QQV6      -----LLPDDERHTF---------------------------VESMRSLRSS--I-FFLP
A0A2E7ALI1      -----SHKKKEKEDSGAEASSEKALNFSQDVVFRDGLYSSLYAESYRILRAA--V-ML-L
A0A178IDB9      -----FRLHKDDAL----------------------------AEAYRGIFSE--I-EI-R
A0A290QD69      -----FRLGKDEAL----------------------------SEAYRGVFSE--V-EI-R
A0A2E7VDS1      -----VGNELDDGL----------------------------MESFRSMFSR--I-QM-N
A0A178IFJ2      -----VLQDRDPDA----------------------------GEVVRGLYAQ--L-KL-S
A0A357FSP9      -----VASNIDRHV----------------------------TEAFRSIHSA--L-KI-S
A0A538NJ59      -----LEIDDDRHVY---------------------------AESYRNLRSA--L-LYQG
A0A3C1VFY9      -----LQPDDLRHPF---------------------------VESYRNLRSS--L-LYMA
A0A522AC27      -----IHAEDPRHQF---------------------------VEAYRNLRSS--L-LYMN
A0A2A2R174      -----ISDDPQSLC----------------------------AEAFRSMRAS--L-GL-L
A0A1H2DTI1      -----IQPGDDRHTY---------------------------SESFRNLRSA--L-MFME
A0A1V5L462      -----LRKEADDVF----------------------------AESFRALRSS--I-LLHR
A0A2A2R3V9      -----LVQDDRRHVY---------------------------AESFRNVRSS--L-LFMA
A0A3D3LGD3      -----FNPD---------------------------------AEAYRILRTN--I-EF-N
A0A350ARX4      -----QVNDSRHRF----------------------------AEACRTLRSTILL-KQSD
B5JIS2          -----VRDNLDLAK----------------------------VESFMAVVAQ--L-EL-T
A0A1H2GQN6      -----LNKEPKDTPH---------------------------AESYRILRAR--I-DL-Q
A0A512M3Y3      -----GLANADVNI----------------------------GETFRIIRSS--I-PLYV
A0A4P5R5J1      -----LASNDPRHAL---------------------------LESFRTLRSS--I-IFLP
A0A4P5YK43      -----ANRLEPNSLF---------------------------AESIRGVRSA--V-MF-G
A0A2A2RPW6      -----ITDDPQSLC----------------------------AEAFRTLRAA--L-SL-L
B4D1I7          -----LMPEDERHAF---------------------------AEAFRSLRSS--I-AFLP
A0A353F286      -----MSPD---------------------------------AEAYRILRTN--I-EF-N
A0A354FSA6      -----MSPD---------------------------------AEAYRILRTN--I-EF-N
A0A3B9GA54      -----MSPD---------------------------------AEAYRILRTN--I-EF-N
A0A520LEH8      -----MSPD---------------------------------AEAYRILRTN--I-EF-N
A0A6B2M0T8      -----LDQMDPQA-----------------------------SELFRQIHSQ--I-LLKN
A0A2D7B7R6      -----VMIESPNSTC---------------------------SEAFRSLRVN--I-ES-M
B1ZT68          -----YRLHKDDGL----------------------------TESYRGIYSA--I-DI-H
W0J7C2          -----FLSHASHDL----------------------------SEAYRGIFSE--I-EV-R
A0A2E5K4P7      -----IESAKDNHV----------------------------KEAFRSIFST--L-GV-N
A0A0R2XPB1      -----LRKNDDRYVF---------------------------AEACRNLRTS--V-FFMG
A0A348NQP1      -----LRKNDDRYVF---------------------------AEACRNLRTS--V-FFMG
A0A357FV58      -----LRKNDDRYVF---------------------------AEACRNLRTS--V-FFMG
A0A2V6F9Q9      -----LQAEDPRHIF---------------------------AESYRNIRSS--I-LFMS
A0A2V6NZZ3      -----LQPDDPRHIF---------------------------AESYRNIRSS--L-LFMP
A0A2V6EBU2      -----LQPDDPRHIF---------------------------AESYRNIRSS--L-LFMP
A0A2V6EY06      -----LQPDDPRHIF---------------------------AESYRNIRSS--L-LFMP
A0A2V6ME53      -----LQPDDPRHIF---------------------------AESYRNIRSS--L-LFMP
A0A538NUU0      -----LQPDDPRHIF---------------------------AESYRNIRSS--L-LFMP
A0A2V6NIJ1      -----LQPDDPRHIF---------------------------AESYRNIRSS--I-LFMP
A0A2V6C292      -----LQPDDPRHIF---------------------------AESYRNIRSS--I-LFMP
A0A2V6D2X0      -----LQPDDPRHIF---------------------------AESYRNIRSS--I-LFMP
A0A2V5ZUK1      -----LQPDDQRHVF---------------------------AESYRNIRSS--I-FFMP
A0A2V5XFN9      -----LQPDDARHVF---------------------------AESYRNIRSS--I-FFMP
A0A2V6EZC8      -----LQPDDARHVF---------------------------AESYRNIRSS--I-FFMP
A0A2V6I7Z5      -----LQPDDARHVF---------------------------AESYRNIRSS--I-FFMP
A0A3B9LCP2      -----LQPDDARHVF---------------------------AESYRNIRSS--I-FFMP
A0A3C0R669      -----LQPDDARHVF---------------------------AESYRNIRSS--I-FFMP
A0A2V6EID2      -----LQPDDARHIF---------------------------AESYRNVRSS--I-FFMP
A0A2V6MHB0      -----LQPDDARHIF---------------------------AESYRNVRSS--I-FFMP
A0A2W5YWL9      -----LQADDPRHTF---------------------------AESYRNVRSS--I-FFMP
A0A2V5NH62      -----LQPDDARHVF---------------------------AESYRNVRSS--I-FFMP
A0A2W6A620      -----LQPDDARHVF---------------------------AESYRNIRSS--I-FFMP
A0A2V5PIJ4      -----LQQDDARHVL---------------------------SESFRNVRSS--I-FFMP
A0A2V6K2G8      -----LQPDDMRHVF---------------------------AESYRNIRSS--I-FFMP
A0A2V5W206      -----LQPDDARHVF---------------------------AESYRNIRSS--I-FFMP
A0A2V6MW77      -----LQPDDARHVF---------------------------AESYRNIRSS--I-FFMP
A0A2G4GZN8      -----ARQDKDRIA----------------------------TEAVRSIYSA--L-KV-N
A0A348NPT1      -----VASNIDRHV----------------------------TEAFRSIHSA--L-KI-S
A0A2E1KV60      -----VASSSDRHV----------------------------IENFRSMLSY--L-KI-S
A0A2D7F4D9      -----VTSTTNRHV----------------------------TENFRSMLSY--L-KI-N
A0A3R7RBR8      -----VTSTTNRHV----------------------------TENFRSMLSY--L-KI-N
A0A2E0NH28      -----VASNVDRHV----------------------------TETFRSIHSA--I-RL-N
A0A350AS32      -----VASNVDRHV----------------------------TETFRSIHSA--L-KL-N
A0A368BGT4      -----VASNVDSHV----------------------------TETFRSIHSA--L-KL-N
A0A2E0V4K6      -----AAEKSNKERQGEGASRDEEHLWDSGIVFRPGLQSSLYAESYRILRAS--V-VL-L
A0A2E6NAH3      -----VASNVDRHV----------------------------TETFRSIHSA--L-KL-S
A0A2A5VZA5      -----VAANVDRHV----------------------------TETFRSIHSS--L-KL-N
A0A424R295      -----VAANVDRHV----------------------------TETFRSIHSS--L-KL-N
B4CZV9          -----VASDDTTKHGL--------------------------VENFRVIRTN--I-LSMG
A0A290QE54      -----VLKNREAPG----------------------------VESFLSVYSS--A-KI-H
A0A1H1SWX2      -----VNSNRTSPG----------------------------SEAFLSVYSA--V-KI-Q
A0A4Q1C9I5      -----VNSNKASPG----------------------------SEAFLSVYSA--V-KI-Q
A0A3B9FM17      -----VGNDLDDGL----------------------------TEAFRSMYSR--I-QM-N
A0A1G3ZL71      -----AILSKATPG----------------------------VESFLSVYSA--V-KI-Q
A0A556QP09      -----VLDNKNTSG----------------------------VEPFLGVYSS--V-KI-H
A0A2T6DX88      -----VRRSEEAPG----------------------------TESFLSIYSS--V-KI-H
A0A2T6CWI7      -----MLTEKQVQG----------------------------AESFLSVYSS--I-KI-H
A0A3E1E5C8      -----LLKGPQTPG----------------------------AEAFLSVYSS--V-KI-H
B1ZZ74          -----LLSGKQAPG----------------------------VEAFLSVYSS--V-KI-H
R7E4L8          -----VTNGRSFM-----------------------------EECFHILRNNAEL-MLLP
A0A4Q3BVY2      -----PAQGASVPNYL--------------------------LECFRVIRAN--I-IMHP
A0A4P6PCA7      -----TRADIAKSGIVDSFGPM--------------------VEVFVGINGY--I-LS-E
A0A0E3YV65      -----LTRAADQDA----------------------------AETIRNLYGQ--L-KA-G
W0J900          -----VLQDTDPDA----------------------------GEIIQTLYSQ--L-RL-N
A0A2T6DSN5      -----FRLGKDDSL----------------------------SEAYRGVFSE--I-EI-R
A0A2V2SMX4      -----ITQNGSPHSF---------------------------VEAYRNLRSS--L-LY-M
A0A317ZIW7      -----LRKSDERYIF---------------------------AEACRNLRTS--V-FFMG
A0A2D7WMI4      -----VGNDLDDGL----------------------------GESFRSMFSK--I-QM-Y
A0A2D6VHX5      -----VGDDLDDSL----------------------------TESFRSMYGK--I-QM-N
A0A2D8I214      -----VGNDLDDGL----------------------------TESFRSMFSR--I-QM-N
A0A1Z8VL41      -----VGNDLDDGL----------------------------TESFRSMYSR--I-QM-N
A0A2E6TNA4      -----VGNDLDDGL----------------------------TESFRSMYSR--I-QM-N
A0A1Z8RG47      -----VGNDLDDGL----------------------------TESFRSMYSR--I-QM-N
A0A1Z8RJJ5      -----VGNDLDDGL----------------------------TESFRSMYSR--I-QM-N
A0A2D7V631      -----VGNDLDDGL----------------------------TESFRSMYSR--I-QM-N
A0A354RA24      -----VGNDLDDGL----------------------------TESFRSMYSR--I-QM-N
A0A2E9RV62      -----VGNELDDGL----------------------------TEAFRSMYSR--I-QM-N
A0A2E4AY96      -----VGNDLDDGL----------------------------AESFRSMFSK--I-QV-N
A0A3B9B9P4      -----VGNDLDDGL----------------------------AESFRSMFSK--I-QV-N
A0A2D5Y6N6      -----VGNDLDDGL----------------------------TESFRSMFSR--I-QM-N
A0A2E7HSS8      -----VGNDLDDGL----------------------------TESFRSMYSR--I-QM-N
A0A2D8VCK3      -----VGNDLDDGL----------------------------TEAFRSMYSR--I-QM-N
A0A350QVY4      -----VGNDLDDGL----------------------------TEAFRSMYSR--I-QM-N
A0A2E4ZYR7      -----VGNELDDSL----------------------------MESFRSMFSR--I-QM-N
A0A2E6TCV1      -----VGNELDDSL----------------------------MESFRSMFSR--M-QM-N
A0A3D4HHL8      -----IKADDDRIIF---------------------------AEACRNLRSS--V-LFGG
A0A366HV03      -----IESDPRKPNHV--------------------------LECYRVLRAH--L-GLQL
A0A6G6K911      -----IETDPRKPNHV--------------------------LECYRVLRAH--L-GLQL
A0A5R8KAF2      -----PSIGAKSPNHL--------------------------LESFRLIRSH--I-LLHP
A0A2V2SDN0      -----EALAAQRFEF---------------------------LESFRNIRSC--L-WFMH
A0A1V6GL40      -----ILPEDTRHSF---------------------------VEAYRNLRSS--L-LYMT
A0A2V5X6Z6      -----EALEKQRFEF---------------------------LEAFRSIRSS--L-LFMS
A0A2V5VGZ7      -----EALEKQRFEF---------------------------LEAFRSIRSS--L-LFMS
A0A2V5U130      -----EALEKQRFEF---------------------------LEAFRSIRSS--L-LFMS
A0A2V6C237      -----EGLEKQRFEF---------------------------LEAFRSIRSS--L-LFMS
A0A3R8L982      EGAPDRRRDPERDPHTNDGQGEHA------------------TEAFLSIFSA--V-KI-H
A0A2E7HPU9      -----AQLKDEKEKQLKVSDPPGIELWDSRLIFRPALLQTLYTEAYRILRAS--V-TL-L
A0A388PR45      -----ARQDKDRQA----------------------------TEAVRAIYSA--M-KI-N
A0A388QR61      -----ARQDKDRLA----------------------------TESVRAIYSA--M-KI-N
A0A4P5YHI0      -----ARQDKDRLA----------------------------TESVRAIYSA--M-KI-N
A0A2A2RS01      -----ARQDKDKVA----------------------------TEAVRAIYSA--M-KV-S
A0A2A2Y1A7      -----ARQDKDKVA----------------------------TEAVRAIYSA--M-KV-S
A0A388PDH9      -----ARQDKDKVA----------------------------TEAVRSIYSA--M-KV-S
A0A2G4H1E7      -----ARQESDRIA----------------------------TEAIRSIYSA--L-KV-N
A0A2G4GZA6      -----ARQDKDRIA----------------------------TEAVRSIYSA--L-KV-N
A0A388P514      -----ARQDKDRIA----------------------------TEAVRSIYSA--L-KV-N
A0A2A2YG59      -----ARQDKDRIA----------------------------TEAVRSIYSA--L-KV-N
A0A2G4F7D5      -----ARQDKDRIA----------------------------TEAVRSIYSA--L-KV-N
D5EML0          -----VYQAVLQKD----------------------------ADLLESFRSI--Y-SS-I
A0A3C1C1M3      -----SLTHQFGEL----------------------------AEAFAGLRSV--L-DS-P
A0A2E9EYJ1      -----XXEXGLSPD----------------------------AEAYRILRTN--X-EF-N
A0A258AXR6      -----HRSSGFNPD----------------------------AEAYRILRTN--I-EF-N
A0A3D3NZQ6      -----HRATGFNPD----------------------------AEAYRILRTN--I-EF-N
A0A1T4WVZ9      -----HRTSGFNPD----------------------------AEAYRILRTN--I-EF-N
A0A4R7SSI6      -----HRASGFNPD----------------------------AEAYRILRTN--I-EF-N
                                                                            

A0A4Q3AQI1      ALTKAPHV-----IMVTSALPREGKTVVSSNLSISFAQTGARTLLMDTDLRRGRLHRLFG
A0A4P6PD26      RGGSHRGA-----FAVLSSGAGEGKSTTCFNLAFVCAQQGEKVLLIDADLRRPVQHTILG
A0A1Z8SVB5      ------RS-----ILVTSAIPSEGKSLISANYAHTCANHGSKTILIDFDLRRPGLHNFCN
A0A2V5W3Y0      YEGPRPKT-----MLVTSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALREAFG
A0A432FAS4      QRAGDLQV-----MAVTSTIPAEGKSLVASNHAIVMAQTGAKTLLVDFDLRRPSVHKAFQ
A0A660Q3A0      GAEEYTKA-----LVVTSAVPLEGKTTTCLNVGISLGQAGSRVLLVDADLRRGTMHKFFG
A0A2V5UAD5      TDGQRPRV-----LLVTSAVPNEGKSTVAANLARILALGGSRVLLVDGDLRKGALHELMG
A0A258AXL1      LPDNPKQV-----IMVTSARPNDGKTTVAAHLAKSFSDSGERVLLIDADLRRGTLHKAFN
A0A2E6T1E0      RAGD-LHL-----MAVTSTVPSEGKSLVASNHAIVMAQTGVKTLLVDFDLRRPSVHKAFQ
A0A2D5W0Q9      HKSDKFKV-----LSMTSTIPSEGKSLVASNLAIVTAQTGVKTLLIDADLRRPSMHKAFQ
A0A1Z9KB52      SHATGSKS-----ILVTSAIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLHNFCD
A0A2V5U7A0      QPGGNRKV-----ILLTSPSPGEGKTATTLNLGIALAQDGYRILIIDADLRRGSCHSRIG
A0A257LYL4      RKNPEDNA-----ITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDGDLRRPRLHTFFD
A0A4Q2XXY1      RKSADANA-----ITVVSGGAGEGKSTTLVNLAYICAQGGYNTLMIDGDLRRPKLHTFFD
A0A3D4CZT6      RNNPEDNS-----ITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFD
A0A4V1S9Q4      RKNPEDNA-----ITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFFD
A0A355VK99      RPEQGGHV-----ILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDLRKSSLTRRLG
A0A2V6N5E0      YDGPRPKS-----FLVTSAVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALRETFG
A0A2V6NH44      YQGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARILLIDGDLRRGALREQFG
A0A432FDF6      RQSEKQTT-----FSVVSGGAGEGKTTTMFNLAVVFAQQGDRVLVVDSDLRRPSMHRFFK
A0A522ACN3      RKDDKLNS-----IAIVSAGAGEGKSTTVMNLATVFAQADSRVVVVDSDLRRPTLHKMLG
A0A353DCA1      RKNPEDNS-----ITVVSGGAGEGKSTTLVNLAYVCSQGGYTTLMVDADLRRPRLHSFFD
A0A3C1AXQ2      RRNPDANC-----ITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFD
A0A3D0IZR7      GARASART-----ITVLSGGPGEGKSTTTFNLGWVCAQSGMKVLLIDGDIRRPNMHNALQ
A0A520LRZ3      RKTADANS-----MTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFFN
A0A356FSV4      EESKNAKV-----FLTTSTVPSEGKSFVSSNLALTFANNGDKTLLLDGDLRLPNIARSLQ
A0A3D3DET9      EAGNRPKT-----ILVTSSVPNDGKSITAANLAITMANAGSRVLLVDADLRKGTLHRLFG
A0A355SVK9      EESKNAKI-----LVTTSTVPGEGKSFVSSNLALTFANHGERTLLLDADLRLPNVAKSLQ
A0A2E5D7I3      GDEKKRKI-----SAFSXALPGEGKTTTSVNYALALASQGKKTLLMDMDLRKPKVHRQFN
A0A2V5NYE2      KASERPRT-----LLVTSSEPNEGKSLTSANLAITMANSGSRVLLVDADLRKGVLHTLFG
A0A2V6FIP7      PKSDQYHL-----LAITSTIPAEGKSLVASNLAIVTAQTGLKTLLVDADLRRPSVHKVFR
A0A353DI77      GDTNQRKI-----TMITSSVPGEGKTFCAANLALAYAKQGTRTLLVDFDLRKPAVHKIFN
A0A1V6GCZ3      RKDDKLNT-----IAIVSAGAGEGKSTTVFNLAAVFAQSGQRTIIVDSDLRRPTLHKMLR
A0A3C1UJT2      TRKKSHKV-----VLFTSSIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVGPEFK
A0A2S7U0Z3      GKHDNNKV-----LLVTSAIPGEGKTTVAAELAAAFAMNKERTLLVDLDLRRPALSGTFP
A0A5E6MKA7      IPDGRPQV-----MMFTSSQMGEGKSSTCVNTATVLGQQGT-VLLIDADLRRPSLHKTLG
A0A6B3L936      GRKENNKV-----LVVTSAMPGEGKTTTAAELAELFALEGERTVLIDFDLRKPRVHELYP
A0A2N8IR72      RPEQGGHV-----ILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLG
A0A2N8IV96      KKGLEEIS-----LTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYE
R7E1V8          KKGLEEIS-----LTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYE
A0A1T4WWY4      SPKGDGRV-----IMLTSARPSEGKTTVSSNVAWAFSSLGEKTLLIDCDLRRGRVHEVIG
A0A3D3LEQ6      SPMGEARV-----IMLTSARPGEGKTTVSANVAWAFSSMGEKTLLIDCDLRRGRVHNVAG
A0A3D3NW23      SPMGEARV-----IMLTSARPGEGKTTVSANVAWAFSSMGEKTLLIDCDLRRGRVHNVAG
A0A2E0R252      GTSEERRT-----FLITSAVPGEGKSWVASNLALSFASQGDRTLLIDGDLRKPVQSQVFD
A0A3E1EF48      GDSEERRI-----FVVTSSLPGEGKSWISANLACGFAQQGERTVLIDADLRKGVLHSTFN
A0A2A2PVG8      GTAEERCT-----FLIASSVPGEGKSWVASNLAHSFALQGDRTLLIDADMRRPVQGEVFG
A0A2E0R421      GTPESKRT-----FLITSSVPNEGKSWVASNLALAFAKQNERTLLIDGDLRRPRIHKIFG
A0A2E5EJ69      GREEERRV-----ILFTSAVPSEGKTFCSVNYAIANASQGKKTLIMDFDLRRPSVGDTFH
A0A2G4I5Z5      GRDEDRKV-----VFFTSAVPSEGKSFCCVNYAVCYAQQGRRTLIIDFDLRKPTLAESFG
A0A4P5QQV6      VEGPPPRT-----FLVTSAVPNEGKSTVALNFAITMAMFDVRVLLVDGDLRRGELHHALD
A0A2E7ALI1      GDEKERKI-----TAFSSALPGEGKTTTSINYALATASQGKKTLLLDMDLRKPKVHRQFN
A0A178IDB9      SPVPFPKR-----ILITSSVPGEGKSLTASNMAAVFAAHGRRTLLVDCDFRRPSLRRYFG
A0A290QD69      SIVPYPKR-----ILFTSSIPSEGKSLTASNMAAVFAAHGKKTLLVDCDFRRPTLRRYFG
A0A2E7VDS1      STADGPKS-----ILITSAIPSEGKSLLAANLAYSCANHGRRTILLDFDLRRPGLHKFCG
A0A178IFJ2      SRLDAPKT-----LLVTSTIPGEGKSFVASNLATAFAAHGLRTLIIDGDLRRPVQHRLAD
A0A357FSP9      EESKNAKV-----IVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQ
A0A538NJ59      TDGQRPRV-----LLVTSAVPNEGKSTVAANLARILALGGSRVLLVDGDLRKGALHELMG
A0A3C1VFY9      ETGTRPHT-----LLITSAVPNDGKSVTAANLAITLATGGSRVLLVDGDLRKGSLHSRFK
A0A522AC27      EGGNKRRT-----LLVTSSVPNDGKSMTAANLAITLAITGSRTLLVDADLRKGLLHARFG
A0A2A2R174      GREEDRKV-----VFFTSAVPSEGKSFCCVNYAVAYAQQGKRTLIIDFDLRKPTLAESFG
A0A1H2DTI1      VDGARPRT-----ILFTSASPDEGKTTVATNFAITLAMLEGRVLLVDADLRRGGLNRLLD
A0A1V5L462      QDSKEPRQ----VFLVTSCAPAEGKSTVSSNLAVTLAYSGAKTLLIDCDLRRGHLHNKFG
A0A2A2R3V9      IDGTRPKT-----LLITSAIPNEGKSTFASNLAITMAFAGSRVLLVDADLRRGRIHDAFS
A0A3D3LGD3      RKNRDANC-----ITVTSGGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMHTHFD
A0A350ARX4      AVHTSSQS-----ILITSATPSEGKSTISANLAIALSHLGKRVLLIDADMRRGGVHHLFS
B5JIS2          SKQEGPKS-----FVVTSTTTSEGKSTIAANVASGFVQIKRKTIIIDGDLRRPCLHQFNR
A0A1H2GQN6      AHSGPGNT-----LTMISGGPGEGKSTTLFNLAHVCAEAGQSVIILDADLRRPSQHTILD
A0A512M3Y3      PGENKCQV-----IMVTSSRPSEGKTMVSSLLARSFADADQKTLLIDADMRRGRVHRVFD
A0A4P5R5J1      IEGARPKT-----ILVTSATPGEGKTTIAANLAITFAFSGARTLLVDADLRLGRIAKAFK
A0A4P5YK43      TQSKKKQV-----MVITSALPGDGKTTFSVNFASTLANAGLKVLLIDSDLRRGTVSNYFN
A0A2A2RPW6      GRDEDRKV-----VLFTSAVPSEGKSFTGANYAVAHAQQGKKTLIIDLDLRKPSLSETFG
B4D1I7          VAGAPPKV-----ILITSAVPNEGKSTVAVNFAITLALAGSRVLLVDGDLRRGELHRSFG
A0A353F286      RKNPDNNS-----ITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFD
A0A354FSA6      RKNPDNNS-----ITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFD
A0A3B9GA54      RKNPENNS-----ITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFD
A0A520LEH8      RKNPENNS-----ITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFD
A0A6B2M0T8      KKLQPGHT-----FVVTSALPKEGKSFFSINLAASFGRHHYKTLLIDCDFRRPSIGERM-
A0A2D7B7R6      TRKKSHKV-----VLFTSSIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVGPEFK
B1ZT68          STEPFPKA-----IISTSSMPGDGKSLTASNLAAAFAAHGRRTLLVDCDLRRPVLHRYFG
W0J7C2          SPLAFPKA-----LLVTSSVPAEGKSLLCCNLAAVFASHKRRTLLVDCDLRRPTLHRLFG
A0A2E5K4P7      DASKDAQV-----ILNTSTIPGEGKSFVSTNLAFTYAESGNRVLLLDCDLRLPNIAKSLQ
A0A0R2XPB1      DEHVKPSV-----FAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQ
A0A348NQP1      DEHEKPSV-----FAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQ
A0A357FV58      DEHEKPSV-----FAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQ
A0A2V6F9Q9      YEGPRPKT-----ILVTSAIPNEGKSTVSANLAIALALSGARVLLIDGDLRRGTLREQFN
A0A2V6NZZ3      YEGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFG
A0A2V6EBU2      YEGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFG
A0A2V6EY06      YEGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFG
A0A2V6ME53      YEGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFG
A0A538NUU0      YEGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFG
A0A2V6NIJ1      YEGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFG
A0A2V6C292      YAGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLREQFG
A0A2V6D2X0      YAGPRPKT-----ILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLREQFG
A0A2V5ZUK1      YEGPRPKS-----FLITSAVPSEGKSTVSSNLAITMALSGAKVLLIDCDLRRGAIREAFG
A0A2V5XFN9      YEGPRPKS-----FLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFG
A0A2V6EZC8      YEGPRPKS-----FLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFG
A0A2V6I7Z5      YEGPRPKS-----FLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFG
A0A3B9LCP2      YEGPRPKT-----LLVTSAVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALREAFG
A0A3C0R669      YEGPRPKT-----LLVTSAVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALREAFG
A0A2V6EID2      YEGPRPKT-----LLVTSAVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALREAFG
A0A2V6MHB0      YEGPRPKT-----LLVTSAVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALREAFG
A0A2W5YWL9      YDGPRPKT-----LLITSAVPSEGKSTISANLAITMALSGARTLLIDGDLRRGALREQFG
A0A2V5NH62      YEGPRPKT-----MLVTSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALREAFG
A0A2W6A620      YEGPRPKT-----LLITSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALRESFG
A0A2V5PIJ4      YEGPRPKT-----FLVTSAIPNEGKSTVSANLSITMALAGARTLLIDGDLRRGALRDAFG
A0A2V6K2G8      YEGPRPKS-----FLVTSAVPSEGKSTVSANLAITMALSGARTLLIDCDLRRGALREAFG
A0A2V5W206      YDGPRPKS-----FLVTSAVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALRETFG
A0A2V6MW77      YDGPRPKS-----FLVTSAVPSEGKSTISANLAITMALSGARTLLIDCDLRRGGLREAFG
A0A2G4GZN8      PAVSKTRV-----FLVTSTRPSEGKTFVATNLALLFAQHSERVLVIDADLRLPNVGPSLG
A0A348NPT1      EESKNAKV-----IVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQ
A0A2E1KV60      EHSKNSNV-----FLITSTTPSEGKSFISSNLALSFSAHGEKVLLLDADLRLPNVAKSLQ
A0A2D7F4D9      DQTKNSNV-----FLLTSTVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVAKSLQ
A0A3R7RBR8      DQTKNSNV-----FLLTSTVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVAKSLQ
A0A2E0NH28      EESKNAKV-----FLTTSTVPSEGKSFVSSNLALTFANNGDKTLLLDGDLRLPNIARSLQ
A0A350AS32      DESKNAKV-----IVTTSTVPGEGKSFVSSNLALTFANHGEKTLLLDGDLRLPNVARSLQ
A0A368BGT4      DQSKNAKI-----ILATSTVPGEGKSFVSSNLSLTFANHGEKTLLIDGDLRLPNVARSLQ
A0A2E0V4K6      GDEKERKV-----SLFFSALPGEGKTTTSINYALATASQGRKTLLLDMDLRKPRVHRQLG
A0A2E6NAH3      DHSKNAKV-----ILTTSTVPGEGKSFVSSNLSLTFANHGEKTLLLDCDLRLPNVARSLQ
A0A2A5VZA5      DESKNAKI-----ILATSTVPSEGKSFVSSNMALTFANHGERTLLLDADLRLPNIASSLQ
A0A424R295      DESKNAKV-----ILATSTVPSEGKSFVSSNMALTFANHGERTLLLDADLRLPNIASSLQ
B4CZV9          ELSKPPHV-----VMVTSAMPKEGKTVVSSNLAASFALTGAKTLLIDTDLRRGRLHRLFG
A0A290QE54      SKLDYPKS-----ILVTSTIPGEGKTLVSSNLAASFARHGKRTLLIDCDLRRPMVHRHFN
A0A1H1SWX2      SKLDFPKS-----ILVTSTIPGEGKTMISCNLAGSFARHGKKVLLIDCDMRRPMLHRHFK
A0A4Q1C9I5      SKLDFPKS-----ILVTSTIPGEGKTMISCNLAASFARHGKRVLIIDCDMRRPMLHRHFQ
A0A3B9FM17      SQTDYPKL-----ILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCN
A0A1G3ZL71      SKIDYPKV-----ILVTSTIPGEGKTLVSCNLAGSFARHGRSTLIIDCDMRRPMLHRHFK
A0A556QP09      SKLDFPKS-----ILVTSTIPGEGKTLISSNLAGSFARHGKSVLLIDCDLRRPMMHRHFE
A0A2T6DX88      SKLDFPKA-----ILVTSTIPGEGKTLVSCNLAASFARHGKSTLIVDCDLRRPMLHRRFG
A0A2T6CWI7      SKLDFPKS-----VLVTSTIPGEGKTLISCNVAGCFARHGKKTLLIDCDLRRPMLHRHFK
A0A3E1E5C8      SKLDFPKS-----ILITSTIPGEGKTLIACNLAGSFARHGKRTLLIDCDLRRPMLHRNFK
B1ZZ74          SKLDFPKT-----VLVTSTIPGEGKTLISCNLAGSFARHGKNTLLIDCDLRRPMLHRHYK
R7E4L8          NPEEAPRI-----LFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFYG
A0A4Q3BVY2      NRRNRSQV-----VLVTSARPQEGKTTQATNLAWAFQSMGEKTLLLDCDLRRGRIHGVVD
A0A4P6PCA7      KYKEQSRV-----LMISSAGPGEGKTISSCNLAISLARNGLKTLLIDADLRRPQIGNIFE
A0A0E3YV65      SRLDLPKI-----LLVTSTLPGEGKSFVASNLAASFASHGIKTLLVDTDFRRPTLHRYYG
W0J900          SRLDAPKT-----LIVTSTVPGEGKSFVASNLATAFAAHGMRTLIIDGDLRRPVQHRLAG
A0A2T6DSN5      SVVPFPKR-----LLVTSSVPSEGKSLTASNLAAVFAAHGRRTLLVDCDFRRPTLRRYFG
A0A2V2SMX4      GNGSRPRT-----LLITSSAPGEGKSLTAENLGAILANTGSRVLLVDGDLRKGVLHSRFG
A0A317ZIW7      DESWKPSV-----FAVTSAVPSEGKSTVSANLAVALSFSHSKVLLVDADLRRGRLHKLMN
A0A2D7WMI4      SKTDYPKI-----ILVTSAIPSEGKSLISANLAYTCANHGKNTILIDFDLRRPGLHKFAG
A0A2D6VHX5      SHVTGSKS-----ILVTSAIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLHNFCD
A0A2D8I214      SQTEYPKT-----ILITSAIPSEGKSLISANLAYSCANHGRRTVLVDFDLRRPGLHKFCG
A0A1Z8VL41      SNADYPKI-----ILVTSAIPSEGKSLISANLAXSCANHGRKTILIDFDLRRPGLHKFCS
A0A2E6TNA4      SNADHPKI-----ILVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHKFCS
A0A1Z8RG47      SNADYPKV-----LLVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHNLCN
A0A1Z8RJJ5      SNADYPKV-----LLVTSAIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHNLCN
A0A2D7V631      SNSDYPKV-----LLVTSAIPSEGKSLISANLAYSCANHGRKTILIDFDLRRPGLHNFCN
A0A354RA24      SNSDYPKV-----LLVTSAIPSEGKSLISANLAYSCANHGRKTILIDFDLRRPGLHNFCN
A0A2E9RV62      SKTDYPKT-----ILITSAIPSEGKSLLAANLAYSCANHGRKTILVDFDLRRPGLHKFCG
A0A2E4AY96      SLVDFPKV-----ILVTSAIPSEGKSLISTNLAFTCANHGKKTILIDFDLRRPGLHKFVG
A0A3B9B9P4      SLVDFPKV-----ILVTSAIPSEGKSLISTNLAFTCANHGKKTILIDFDLRRPGLHKFVG
A0A2D5Y6N6      SLNDYPKT-----ILVTSAIPSEGKSLISANLAYSCANHGKKTILIDFDLRRPGIHKFCN
A0A2E7HSS8      SLSDYPKL-----ILVTSAIPSEGKSLISANLAHSCANHGRKTILIDFDLRRPGLHKFCN
A0A2D8VCK3      SQTDYPKL-----ILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCN
A0A350QVY4      SQTDYPKL-----ILVTSAIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCN
A0A2E4ZYR7      SHVEYPKS-----MLITSAIPSEGKSLLAANLAYSCANHGRRTILIDFDLRRPGLHKFCG
A0A2E6TCV1      SHIDYPKS-----MLITSAIPSEGKSLLAANLAYSCANHGRRTILIDFDLRRPGLHKFCG
A0A3D4HHL8      DENEAHQV-----VAVTSSVPGEGKSTMAANLAVTLAFAGKKTLLLDADLRRGVLHNAFN
A0A366HV03      GNREGAKV-----VMFTSARPSEGKTVTAANLAWTLQSIGAKTLLVDLDFRKGRVHNLFG
A0A6G6K911      GNREGAKV-----VMFTSARPSEGKTVTAANLAWTLQSIGVKTLLVDLDFRKGRVHNLFG
A0A5R8KAF2      NSKGKSQV-----IMVTSARPSEGKTSQAANLAWAFQSMGSRTLLIDCDLRRGRVHQVLD
A0A2V2SDN0      QNGNKPKS-----LLIGSSVPQEGKSTVALYLAATMAIGGSKVLLIDGDMRRAKLHRHFG
A0A1V6GL40      EAGNRPKT-----ILVTSSVPNDGKSITAANLAITMANAGSRVLLVDADLRKGTLHRLFG
A0A2V5X6Z6      NGGTKPKT-----IVVASSVPEEGKSTVALYLAATLAKGNSRVLLIDADMRRTALHKFFG
A0A2V5VGZ7      NGGTKPKT-----IIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFG
A0A2V5U130      NGGTKPKT-----IIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFG
A0A2V6C237      NGGTKPKT-----IIVASSVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFG
A0A3R8L982      SRLDFPKS-----ILVTSTIPGEGKTLISCNLAGAFARHGRRTLLIDCDLRRPTIHRHFG
A0A2E7HPU9      GKEDERKV-----SLFTSSIPGEGKTTTSSNFAIAAAQQGKKTILVDFDLRKPAVHKAFG
A0A388PR45      PASAAGRV-----FLVTSTRPGEGKTFVATNLALAFAQHAERVIVVDADLRLPNVGPSLG
A0A388QR61      PATAAGRV-----FLVTSTRPGEGKTFVATNLALTFAQHSERVIVVDADLRLPNVGPSLG
A0A4P5YHI0      PATAAGRV-----FLVTSTRPGEGKTFVATNLALTFAQHSERVIVVDADLRLPNVGPSLG
A0A2A2RS01      PATANSRV-----FLVTSTRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVGPSLG
A0A2A2Y1A7      PATANSRV-----FLVTSTRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVGPSLG
A0A388PDH9      PATANSRV-----FLVTSTRPGEGKTFVATNLALSFAQHAERVLVIDADLRLPNVGPSLG
A0A2G4H1E7      PAVSKARV-----FLLTSTRPSEGKTFVATNLAMIFAQHSERVLIIDADLRLPNVGPTLG
A0A2G4GZA6      PAVSKARV-----FLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLG
A0A388P514      PAVSKARV-----FLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLG
A0A2A2YG59      PAVSKARV-----FLVTSTRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLG
A0A2G4F7D5      PAVSKARV-----FLVTSTRPSEGKTFIATNLALIFAQHSERVLIIDADLRLPNVGPSLG
D5EML0          RMRADLSAKRKASFVITSSVPNEGKSMVACNLSAVIAKHNYRVLLVDCDLRNPSLHRAHG
A0A3C1C1M3      LYRDHSQI-----VLVASSLPEEGKTTTSCNLATACALNGQKTLLIDFDLRRPRVGNIFP
A0A2E9EYJ1      RKNADAXA-----ITLVSGGAGEGKSTTLVXLAYVCAQGGYNTLMIDGDLRRPQLHTFFN
A0A258AXR6      RKTPDANC-----LSVVSGGAGEGKSTTMVNLAYVCAQGGYNVLLIDADLRRPSLHTHFD
A0A3D3NZQ6      RKNRDANC-----ITVTSGGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMHTHFD
A0A1T4WVZ9      RKNPDANC-----ITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFD
A0A4R7SSI6      RRNPDANC-----ITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFD
                                      :**:      .          :::* *:*         

A0A4Q3AQI1      YRK-------SPGLSNVLLGE-CTLDEAL-------RPTV-SENLTVLS---AGKHLD--
A0A4P6PD26      VSN-------RFGLTNVLLRD-VPVEEAI-------KATS-VPNLHFLP---SGRLPR--
A0A1Z8SVB5      ESN-------DAGVMTILNTP-NATEEQISEKIEKCLCNI-HPNLFLLP---SGGKTR--
A0A2V5W3Y0      VSS-------KIGFSEVLKQE-VNWQEVV-------VPTS-YPNLFLLP---RGKTLG--
A0A432FAS4      LQS---P---R-GLSSYLLGKIDSIEEIV-------HHAE-VPNLDVIC---CGAVPN--
A0A660Q3A0      VEA---D---R-GLTDILVGRAKP-EAVI-------QRTP-IPNVDFIG---SGPYPP--
A0A2V5UAD5      MNH---E---P-GLSEMLRCP-EDLEKI--------IQTNSLPNFFFVS---SGGRLS--
A0A258AXL1      LGN---K---NLGLMEILADR-VKWNDA--------VRSSGVENLDFIS---RGNDSA--
A0A2E6T1E0      LQS---P---R-GLSSYLLGK-VDSIDAI-------VHQTEVPNLDVIC---CGAVPN--
A0A2D5W0Q9      MQS-------PIGLSAYLTGQITDPSEIT-------QTTE-VPNLDLIC---CGAVPN--
A0A1Z9KB52      ESN---D---E-GVMTILNTP-NATEEEVTDKLKKVLCSI-HPNLFLLP---SGGKTR--
A0A2V5U7A0      LRN---H---R-GLSNVLGGE-MPIEQLI-------QPTS-IAGLSLVT---RGVCPP--
A0A257LYL4      INN---S---V-GLTNYLTTE-LMLEDVI-------LQTP-VDNLYFMP---SGILPA--
A0A4Q2XXY1      INN---S---V-GLTNYLTTA-LQLEDVI-------LQTP-VENLYFMP---SGILPA--
A0A3D4CZT6      INN---S---V-GLSNYLTTD-LMLEDVI-------LQTP-VDNLYFLP---SGILPA--
A0A4V1S9Q4      INN---S---V-GLTNYLTTE-LMLEDVI-------LQTP-VDNLYFMP---SGILPA--
A0A355VK99      GSG---R---K-GLTSILLRQ-NPDTAGV-------IRPV-GEDTRGMDVLYTGPTVP--
A0A2V6N5E0      ISS---K---I-GFSEVLKQE-VNWREVV-------VPTA-YETLFVLP---RGKTLS--
A0A2V6NH44      SDS---R---L-GFSEVLQQE-VPWQEVV-------MPTT-YPSLFLLT---RGKALP--
A0A432FDF6      LSN---K---I-GLTNYLLGQ-ATIEEVI-------QTTE-LPSLHFIP---SGKLPS--
A0A522ACN3      VSN---S---L-GLTNYLLKQ-NKLEEVI-------QHSN-VANLDFLP---SGKLPS--
A0A353DCA1      INN---S---V-GLTNYLTTD-LALEDVI-------LQTP-VDNLYFLP---SGILPA--
A0A3C1AXQ2      VSN---S---V-GLTNFLTTN-VQLEEVV-------VRTP-VENLYFLP---SGMLPA--
A0A3D0IZR7      IEN---T---L-GLGEYLAGQ-ASLDELI-------QSTA-IPNLEILT---AGSLGP--
A0A520LRZ3      INN---S---V-GLTNYLTTD-LALEDVI-------LQTA-YENLFFMP---SGILPS--
A0A356FSV4      VSN---D---N-GLIDYIDHD-VDINAVI-------VNEV-YPHLDVLP---AGGKSK--
A0A3D3DET9      VSP---E---P-GLSDVLAKG-TAWETTV-------SATK-IANLHILP---AGTFTA--
A0A355SVK9      LEN---D---Y-GLLNHVDKG-VSLDELI-------IKEV-YPNLDVLP---TGGKSK--
A0A2E5D7I3      LRR---GDLET-GMSEVLSNQ-CDASEAV---------TK-TPGIERLDAIFAGGKAP--
A0A2V5NYE2      LPS---G---P-GLSEALSQG-LNWSEAV-------QATR-TPNLFLLP---RGAITH--
A0A2V6FIP7      LQS---P---V-GLSSYLMEKVSRVDEFI-------HTTE-VPHLDVVC---CGAVPS--
A0A353DI77      EERA--A---RPGIVNVLNGT-AAANQAI-------TVYPGLDTLSVIY---SGPKSP--
A0A1V6GCZ3      VTN---A---I-GLTNYLLRQ-NTLEEVI-------QTTS-LPTLDFLS---SGKLPS--
A0A3C1UJT2      LGE---E---YVGVSDLLQSE-----DKLGQFPDLAIYEA-TEKLFVLH---GGSHIS--
A0A2S7U0Z3      DLD---G---GPGIVEVLAGQ-ASIQDVF-------SDTE-IENLTVVC---SGAKAP--
A0A5E6MKA7      LRP---H---P-GLSELLTNQ-APLEQAV-------QATA-LPNVWAIG---AGRTPC--
A0A6B3L936      KLK---G---QPGTVDVLIGH-AQFDDVV-------APTR-VEGLFVVP---SGKKPP--
A0A2N8IR72      GSG---R---K-GLTSILLQQTTDTTGIIRP-----LGEN-SRGMDILY---TGPMVP--
A0A2N8IV96      LDN---E---V-GLTSYLLED-YPLEEVI-------FQTP-IENLYVMP---AGPTPF--
R7E1V8          LDN---E---V-GLTSYLLED-YPLEEVI-------FQTP-IENLYVMP---AGPTPF--
A0A1T4WWY4      ASN---A---V-GMTDLLTGR-ASLSECV-------QKVE-AENLWAIT---RGMVVP--
A0A3D3LEQ6      VPN---L---P-GLTRLLTGQ-ATLEECL-------VKSP-AENLWLLP---RGQVIA--
A0A3D3NW23      VPN---L---P-GLTRLLTGQ-ATLEECL-------VKSP-AENLWLLP---RGQVIA--
A0A2E0R252      YDK---E---HPGLSDHLSLN-RPLKEVV-------MKTRESENLFIMP---AGSRSA--
A0A3E1EF48      LSR---E---APGVTNLLSRT-SSLAEVI-------HQT-EIENLWFVP---GGGKSA--
A0A2A2PVG8      YGR---E---PKGLADVLSLG-TPLKEVI-------LRSEVSEDLFLIP---AGSWSA--
A0A2E0R421      FDR---D---EAGLSDHLSLR-TPLNKVV-------KPTDKSGKLYVLL---AGSPSA--
A0A2E5EJ69      IDR---K---TPGVTDLLLAN-KTLDEVA-------LKTD-FENLTLIP---AGSTVP--
A0A2G4I5Z5      VEG---E---HFGVSDVLLGK-VPLDQCV-------QKTR-FDNLFLLT---AGTMVP--
A0A4P5QQV6      LPN---G---A-GFGDVLNGD-CALQSAV-------QQTR-VPGLSLLS---RGSTVQ--
A0A2E7ALI1      LRRSELE---K-GMSEVLSNQ-CTPEEAL-------TKTPGIETLDAIF---AGGKAP--
A0A178IDB9      TAP---G---T-GLLSWLRAHPDDGADTPLDLATLGIATV-ENNLHLLP---AGHAIK--
A0A290QD69      TQS---G---V-GLLPWLRENGSNAA-AQVETQKMGIVTI-APGLDLLP---AGDAIK--
A0A2E7VDS1      VSN---D---K-GLLTLINEI---HGEHGTEPERNALTEI-YPNLYVLP---SGGKTR--
A0A178IFJ2      APN---T---H-GLLRWLDKG-GKSGGPLANDPDLDLLRP-APNLFVLR---AGGTSR--
A0A357FSP9      LEN---D---F-GMLDHIEKE-VALDEVI-------MKAV-YPNLDVLP---SGGKSK--
A0A538NJ59      MNR---E---P-GLSEMLRCP-EDLEKII-------QTNS-LPNFFFVS---SGGRLS--
A0A3C1VFY9      IQA---D---T-GLSESLAQG-MDWHKAV-------KETT-VGNLFLLP---RGASTQ--
A0A522AC27      LKP---E---T-GLSEVLLAK-KDWRNCI-------CKTG-VANLDLLP---RGGTTQ--
A0A2A2R174      IKE---D---HFGVSDVLLNK-AQLEQAV-------QTTR-FDNLFLLT---AGTTVP--
A0A1H2DTI1      IDA---P---L-GFTDVLLHG-ADWRKAV-------VPSK-HKNLSVMV---CGKYTS--
A0A1V5L462      IDR---D---P-GLAELLEHPEMDVQDVIL------VGDQELGNLSVIS---AGRPQE--
A0A2A2R3V9      VSN---Q---R-GLSDVLSNQ-MNWRDAI-------QESA-AYHFHIIP---RGPTPP--
A0A3D3LGD3      AGN---T---T-GLTNFLTTN-VRMEDVV-------VRTA-VENLYFLP---SGLLPA--
A0A350ARX4      LSA---E---N-GLSDLLSCE-SDFDGYV-------QQTQ-HAKLDLIA---NGRSLL--
B5JIS2          IKK---S---G-GLIRWAEEG-YPMDDIYGEDSPLGIQKL-KGGAYLLP---AGGVFP--
A0A1H2GQN6      IAS---G---P-GLADHLIRG-VPIADLI-------RETA-IPNLHIIP---AGEDAH--
A0A512M3Y3      MEP---G---I-GLSGFLAGEVSQLTDAV-------IKTD-SPKLEVLS---RGKNSA--
A0A4P5R5J1      IES---E---L-GLSDVLRQR-THWREVI-------VPSS-TPNLSILP---RGKTLP--
A0A4P5YK43      QPR---T---P-GFSEVLAGD-RPWQQSV-------RETP-IPTLHLLT---TGQLIA--
A0A2A2RPW6      VSS---N---QIGATDVMLGR-EPFEKGV-------QTTR-FENLFLMT---AGKMVP--
B4D1I7          LTN---D---A-GFGDVLSGR-KSLDDAI-------QLTL-VPGLMLLS---RGRGVP--
A0A353F286      INN---S---V-GLTNYLTTD-LALEDVI-------LQTP-VDNLYFMP---SGILPA--
A0A354FSA6      INN---S---V-GLTNYLTTD-LALEDVI-------LQTP-VDNLYFMP---SGILPA--
A0A3B9GA54      INN---S---V-GLTNYLTTD-VALEDVI-------LQTP-VDNLYFMP---SGILPA--
A0A520LEH8      INN---S---V-GLTNYLTTD-LALEDVI-------LQTP-VDNLYFMP---SGILPA--
A0A6B2M0T8      ------E---E-DLVKLLEQREDPEKPLVL-----------SEGLHILP---FENSTV--
A0A2D7B7R6      LGE---E---YVGVSDLLQSE-----DKLGQFPDLAIYEA-TEKLFVLH---GGSHIS--
B1ZT68          VDL---S---N-GWIRALATSAAGGQPPP---LPTTIA-F-SENLDLLP---SGGVAK--
W0J7C2          VKP---D---T-GWVDWLETDPA--QRPT---LPVGIVPV-ADHLDLLP---AGRSLG--
A0A2E5K4P7      LEL---T---T-GLLDYVQGT-ATLEEVI-------VPGV-FTNLDILP---AGGRSR--
A0A0R2XPB1      LNR---E---N-GFSDILEGS-LTLDSAV-------QSSS-YEHLDFVS---IGGYPD--
A0A348NQP1      LNR---E---N-GFSDILDGN-LTLDNAV-------QSTS-YKHLDFVS---IGGYPD--
A0A357FV58      LNR---E---N-GFSDILDGN-LTLDNAV-------QSTS-YKHLDFVS---IGGYPD--
A0A2V6F9Q9      SNS---R---L-GFSEVLRQE-VPWSEVV-------MPTA-YHSLSLLT---RGKPLT--
A0A2V6NZZ3      SNS---R---V-GFAEVLQQE-VPWQEVV-------MPTA-YPSLLLVT---RGKTLA--
A0A2V6EBU2      SNS---R---I-GFAEVLQQE-VPWQEVV-------MPTA-YPSLLLVT---RGKTLA--
A0A2V6EY06      SNS---R---I-GFAEVLQQE-VPWQEVV-------MPTA-YPSLLLVT---RGKTLA--
A0A2V6ME53      SNS---R---V-GFAEVLQQE-VPWQEVV-------MPTT-YPSLFLVT---RGKTLP--
A0A538NUU0      SNS---R---V-GFAEVLQQE-VPWQEVV-------MPTT-YPSLFLVT---RGKTLP--
A0A2V6NIJ1      SNS---R---V-GFAEILQQE-VPWQEVV-------MPTV-YPSLFLLT---RGKALT--
A0A2V6C292      SNS---R---V-GFSEVLQQE-VPWQEVV-------MPTA-YPSLFLLM---RGKALA--
A0A2V6D2X0      SNS---R---V-GFSEVLQQE-VPWQEVV-------MPTA-YPSLFLLM---RGKALA--
A0A2V5ZUK1      IDS---K---I-GFSEVLKGE-VNWREVV-------VPTA-YETLFVLP---RGKTLG--
A0A2V5XFN9      ITS---K---I-GFSEVLKQE-VNWREVV-------VPTA-VPTLFVLP---RGKPLS--
A0A2V6EZC8      ITS---K---I-GFSEVLKQE-VNWREVV-------VPTA-VPTLFVLP---RGKPLS--
A0A2V6I7Z5      ITS---K---I-GFSEVLKQE-VNWREVV-------VPTA-VPTLFVLP---RGKPLS--
A0A3B9LCP2      ISS---E---I-GFSEVLKQE-VNWQEVV-------VPTF-YPSLFVLP---RGKISA--
A0A3C0R669      ISS---K---I-GFSEVLKQE-VNWQEVV-------VPTF-YPSLFVLP---RGKISA--
A0A2V6EID2      ISS---K---L-GLSEVLKQE-VNWQEVV-------VPTS-YPSLFILP---RGKSLS--
A0A2V6MHB0      ISS---K---L-GLSEVLKQE-VNWQEVV-------VPTS-YPSLFILP---RGKSLS--
A0A2W5YWL9      VSS---R---I-GFAEALKQE-VNWREVV-------VPTS-CSNLSLLP---RGKTVA--
A0A2V5NH62      ISS---K---I-GFSEVLKQE-VNWQEVV-------VPTT-YENLFVLP---RGKTLG--
A0A2W6A620      VSS---K---I-GFSEVLKQE-VNWQEVV-------VPTS-YPNLYLMP---RGKTLG--
A0A2V5PIJ4      VSS---K---I-GFSEVLQQE-VNWRQVV-------VPTS-YPNLFLMP---RGKTIG--
A0A2V6K2G8      ITS---K---I-GFSEVLKQE-VNWREVV-------VPTA-VSTLFVLP---RGKTLG--
A0A2V5W206      ISS---K---I-GFSEVLKQE-VNWREVV-------VPTA-YETLFVLP---RGKTLS--
A0A2V6MW77      ISS---K---I-GFSEVLKQE-VNWREVV-------VPTA-YETLFVLP---RGKTLS--
A0A2G4GZN8      FTG---D---G-GLSKWFNAE-MTLDDAI-------VRDV-APGLDVLP---VGLSCK--
A0A348NPT1      LEN---D---F-GMLDHIEKE-VALDEVI-------MKAV-YPNLDVLP---SGGKSK--
A0A2E1KV60      LEN---D---S-GVIDFINGD-DSISNFI-------VKDV-YPNFDVLP---SGGKSK--
A0A2D7F4D9      LEN---E---S-GVLDYIQGE-GTFDSYI-------AKEV-YPNLDILA---SGGKAK--
A0A3R7RBR8      LEN---E---S-GVLDYIQGE-GTFDSYI-------AKEV-YPNLDILA---SGGKAK--
A0A2E0NH28      VSN---D---N-GLIDYIDHD-VDINAVI-------VNEV-YPHLDVLP---AGGKSK--
A0A350AS32      LEN---D---F-GLLDHVDKD-VAIDEVI-------IKEV-YPNLDVLP---SGGKSK--
A0A368BGT4      LKN---D---L-GLLDHVEKG-VSLEDII-------IKDV-CPNLDVLP---TGGKSK--
A0A2E0V4K6      RRRSEQG---K-GMAEILARQ-CPPEEAV-------CQDVGHGNLDAVF---AGGKVR--
A0A2E6NAH3      IEN---D---L-GMLDYVENG-VSLDEVI-------VKEV-YPNLDVLS---TGGKSK--
A0A2A5VZA5      LPN---E---F-GLLDHIEQG-SRLDDMI-------VSEV-YPNLDVLP---SGGKSK--
A0A424R295      LPN---E---F-GLLDHIEQG-SRLDDMI-------VSEV-YPNLDVLP---SGGKSK--
B4CZV9          YRK---E---P-GLSNVLLGE-CTLEDAFRPSG--------QENLTVLS---AGRHLD--
A0A290QE54      QPN---D---N-GLITWFEHG-ASLDGDLTENQHLGITRL-SENFSLLC---SGGRSK--
A0A1H1SWX2      LTN---E---A-GLIAWFEAG-AKIPADPFTDASLGFTKV-DENLFLLR---SGGRSK--
A0A4Q1C9I5      LPN---E---A-GLLAWFEAG-AKIPEDPFTDASLGLTKA-EENLFLLR---SGGRSK--
A0A3B9FM17      LEN---S---K-GLLSLVNDV-GKPGQDVQNCISESLTEV-HPNLFLLP---SGGKTR--
A0A1G3ZL71      MEN---D---A-GLLAWAEAG-ASLDGDLTTDPKLGLARI-ADNLMLLR---SGGRSK--
A0A556QP09      LAN---E---A-GLITWYEKG-ASLDGDLTINPSLGITSI-GENLSLLS---SGGRSK--
A0A2T6DX88      KEN---E---A-GLLTWFEKG-GKVEGDLANDPTLGIVKL-EDNLSLLR---SGGRSK--
A0A2T6CWI7      QEN---K---N-GLITWFESG-AMLDSNLTTHPSLGIVPV-AENLWLLC---SGGRSK--
A0A3E1E5C8      QEN---L---H-GLITWFEGG-AKLDGDLSTDPSLGIIKL-ADNLSLLC---SGGRAK--
B1ZZ74          QQN---N---A-GLITWFEAG-SPLDGELASTPALGIIKI-SENLSLLC---SGGRSK--
R7E4L8          GKN---A---R-GLVHLLMNPQVSPDSVL-------QSGKRFPGFDLVT---AGPVPP--
A0A4Q3BVY2      IDK---A---P-GMTRLLLGE-CTLEQAI--------HSMGQGGFDVIP---RGPVIA--
A0A4P6PCA7      IPA---E---HPSLLEWLSSGSSELERSE-----LVSRNV-IEHLDVIT---SRPLKNV-
A0A0E3YV65      QSN---D---A-GLLRWLDTK-SKTEPALLRDPALGITAF-GPSLHLLR---SGGTTR--
W0J900          APN---T---H-GLLRWLDKG-GRSDGPLAGDPDLGLLRP-APNLFVLR---AGGISR--
A0A2T6DSN5      ATA---G---V-GLLPWLREN-AHRPDVQIDAHKMGIMNI-GPAFDLLP---AGDAIK--
A0A2V2SMX4      LDA---M---P-GLTEVLADG-KPVRDVI-------RETT-IPNLWLLP---RGSTTH--
A0A317ZIW7      LDF---D---G-GLTDVLEGR-KEMEEVI-------QRST-YDNLDFVS---IGGHPD--
A0A2D7WMI4      LDN---E---S-GIITLVNE-MSQNPNFIDSGLKKHLKNI-HPNLNMLT---SGGKTR--
A0A2D6VHX5      ESN---D---E-GVMTILNT-PNATEEEVTDKLKKVLCSI-HPNLFLLP---SGGKTR--
A0A2D8I214      IEN---K---T-GLVSLVN--VASSKENLKNSINDSVQEI-HPNLYILP---SGGKTR--
A0A1Z8VL41      ITN---D---N-GLLTLINE-AKNGVENLRELTDKTLHPI-HDNLYILP---SGGKTR--
A0A2E6TNA4      ISN---D---K-GLLTLINE-AKNGVENLHELADKTLHPI-HDNLYILP---SGGKTR--
A0A1Z8RG47      ITN---E---K-GIVTLVNE-VVKGSKDIDTHIQESLHET-HPNLHVLP---SGGKTR--
A0A1Z8RJJ5      ITN---E---K-GIVTLVNE-VVKGSKDIDTHIQESLHET-HPNLHVLP---SGGKTR--
A0A2D7V631      ITN---E---K-GIVSLVNE-VVKGSSDIDEQIKSCLHEI-HPNLHVLP---SGGKTR--
A0A354RA24      ITN---E---K-GIVSLVNE-VVKGSSDIDEQIKSCLHEI-HPNLHVLP---SGGKTR--
A0A2E9RV62      VNN---D---R-GLLTLINETVANPTPNYNFWDSGTLVEI-YPNLLILP---SGGKTR--
A0A2E4AY96      LEN---E---G-GLIPIINK-SAEQPNYIKENLDSELHDI-HPNLKMLT---SGGKTR--
A0A3B9B9P4      LEN---E---G-GLIPIINK-SAEQPNYIKENLDSELHDI-HPNLKMLT---SGGKTR--
A0A2D5Y6N6      ITN---E---K-GLLSLINS-EKTDLKELQELAQSTVTQI-HPNLLVLP---SGGKTR--
A0A2E7HSS8      MEN---E---R-GLLSLVNE-VSQKGGDIDQSVTETLTEI-HPNLFVLP---SGGKTR--
A0A2D8VCK3      LEN---S---K-GLLSLVND-VGKPGQDVQNCISESLTEV-HPNLFLLP---SGGKTR--
A0A350QVY4      LEN---S---K-GLLSLVND-VGKPGQDVQNCISESLTEV-HPNLFLLP---SGGKTR--
A0A2E4ZYR7      VSN---D---R-GLLTLVNE-I--NGEHDTEAERNALTEI-YPNLYVLP---SGGKTR--
A0A2E6TCV1      VSN---D---R-GLLTLVNE-I--NGEHGTEAERNALTEI-YPNLYVLP---SGGKTR--
A0A3D4HHL8      VPN---D---K-GLSDVIRER-ISFDDAI-------QRPG-IENLDFVA---HGTTTK--
A0A366HV03      VDR---Y---P-GFCQALTGE-LVLEDVV-------RHTH-LANFHYCT---RGNTSA--
A0A6G6K911      VNR---S---P-GFCQALTGE-LALEDVI-------QHTH-LTNFHFCT---RGNTSA--
A0A5R8KAF2      VAN---D---I-GITQLLLNR-FPVQEAV-------LKTS-NPLLDVIP---RGPIIT--
A0A2V2SDN0      VAS---S---P-GLAEILNQE-TYPNYGI-------VTTA-LENLSFLP---AGAPTL--
A0A1V6GL40      VSP---E---P-GLSDVLAKG-TAWETTV-------SATK-IANLHILP---AGTFTA--
A0A2V5X6Z6      AAS---S---P-GLAEVLNEE-ISFAEAI-------VPTG-LENLALLP---AGEARQ--
A0A2V5VGZ7      TAS---S---P-GLAEILNEE-ISFKEAI-------VPTG-LENLALLP---AGEANR--
A0A2V5U130      TAP---R---P-GLAEILNEE-ISFAEAI-------VPTG-LENLALLP---AGEANR--
A0A2V6C237      TAS---S---P-GLAEILNEE-ISFKEAI-------VPTG-LENLALLP---AGEANR--
A0A3R8L982      IEN---N---A-GLLAWFEAG-APFDDLLPENPHLGVIKI-GENFDLLR---SGGRSR--
A0A2E7HPU9      LKRRDLP---T-GLTEVLTGK-ATLAEAI-------QEQAGQENFSIIF---AGQKAP--
A0A388PR45      FAG---D---G-GVSRWFNGE-MTLDEAI-------VKDV-APGLDVLP---VGLSCR--
A0A388QR61      FAG---D---G-GVSRWYNGE-MTLDEAI-------VKDV-APGLDVLP---VGMSCR--
A0A4P5YHI0      FAG---D---G-GVSRWYNGE-MTLDEAI-------VKDV-APGLDVLP---VGMSCR--
A0A2A2RS01      FSG---D---G-GVSRWFNGE-MTLDEAI-------VRDV-APGLDVLP---VGMSCR--
A0A2A2Y1A7      FSG---D---G-GVSRWFNGE-MTLDEAI-------VRDV-APGLDVLP---VGMSCR--
A0A388PDH9      FSG---D---G-GVSRWFNGE-MTLDEAI-------VRDV-APGLDVLP---VGMSCR--
A0A2G4H1E7      FTG---D---A-GLSKWFNGE-IPLDDAI-------IREV-APGLDVLP---VGLSCK--
A0A2G4GZA6      FTG---D---G-GLSKWFNAE-MSLDEAI-------VHDV-SPGLDVLP---VGLSCK--
A0A388P514      FTG---D---G-GLSKWFNGE-MSIEEAI-------VHDV-SPGLDVLP---VGLSCK--
A0A2A2YG59      FTG---D---G-GLSKWFNGE-MSIDEAI-------VHDV-SPGLDVLP---VGLSCK--
A0A2G4F7D5      FTG---D---G-GLSKWFNGE-MSIDEAI-------VHDV-ASGLDVLP---VGLSCK--
D5EML0          VED---D---A-GLCPWFDSGSTDMEDLL-------GNES-LGILKLSP---SLSLLRAG
A0A3C1C1M3      RPE---A---VCGLLEYLDSDQMKPEEIV-------YASE-CRNLSVIS---SRVVGRS-
A0A2E9EYJ1      INN---S---V-GLTNYLTTD-LXLEDVI-------LQTA-YENLYFMP---SGIL-PA-
A0A258AXR6      VSH---A---T-GLTNFLTTD-IRLEDVV-------LRTQ-VENLFFLP---SGLL-PA-
A0A3D3NZQ6      AGN---T---T-GLTNFLTTN-VRMEDVV-------VRTA-VENLYFLP---SGLL-PA-
A0A1T4WVZ9      VSN---A---V-GLTNYLTTN-VTLEEVV-------VRTP-VENLYFLP---SGML-PA-
A0A4R7SSI6      VSN---A---V-GLTNYLTTN-VQLEEVV-------VRTP-VENLYFLP---SGML-PA-
                            .                                               

A0A4Q3AQI1      ----TGTELLGSPRFTEIMQTLRERFDRIVMDTPPVLGLSDTSVMQSQVDGVLFVIWSAH
A0A4P6PD26      ----TSLGVLDPKRIGELISSLKSKYDVVLIDTPPLVGISDSSIIAKETDGAIIVVQYRK
A0A1Z8SVB5      ----AATEIIEKKEFELLLAAXKKMADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGK
A0A2V5W3Y0      ----QPSEHLLRDSTDALLADLYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFVVWLSY
A0A432FAS4      ----NPSELAGSQRMKDFIEEIRSKYDKIMFDCPPVSAVSDPLMIAAATDGIIFVSKFNK
A0A660Q3A0      ----NPAELLMRPELSAFLDYARRTYDRVMFDCPPVLAVSEAAILCTLVDGVIFVVWAGQ
A0A2V5UAD5      ----NPGDLFLNPALSQVLAWARQHFDYVLIDSSPVFAADDTATLAPMVDGTLFVVRNRF
A0A258AXL1      ----RGHDLLSSSRFKEFLDALKHHFDRIIVDTPPLLGLADSLLISKAVDGLIFVIRADQ
A0A2E6T1E0      ----NPSELSGSQRMRDFVEEVRTKYQKIVFDCPPVSAVSDPLIIAAATDGIIFVNKFNK
A0A2D5W0Q9      ----NPSELVGSKRMGELLDSLRDRYDRIFVDCPPVSAVSDPLMVGARTDGMVFVSKFNK
A0A1Z9KB52      ----AATEIIEKKEFELLLTCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGK
A0A2V5U7A0      ----NPSELLGTRKMKELVMDLRESYDFILLDTPPAIAVSDPAILSSVADGIILVFHARK
A0A257LYL4      ----DAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRK
A0A4Q2XXY1      ----DAAGILNSRRMSELIADVKNRFDLVLIDSPPILGVSDASVLASEVDLTMIVIQHRK
A0A3D4CZT6      ----DAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRK
A0A4V1S9Q4      ----DAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRK
A0A355VK99      ----NPVTLLSHPLLGQILSILKKQYDAVIIDAPPYGILADTAILASLSDITLYTVRSGK
A0A2V6N5E0      ----QPSEHLLRESTEALLKEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVVRLSY
A0A2V6NH44      ----QPSEHLLRDSTDQFLKEIYHQYDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSH
A0A432FDF6      ----SSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQYRK
A0A522ACN3      ----SSLGILSSNQMKDLISGLKQRYDYVFLDSPPIMGVSDASILASEVDITLQVIQYRR
A0A353DCA1      ----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRK
A0A3C1AXQ2      ----DSAGVLNSQRMSELIADAKSRFDLVLIDSPPILGVSDASVLANEADLTLIVVQHRK
A0A3D0IZR7      ----EELGGFSRSRLATLMEACRPNYDVILVDSPPVLGISDASVISQEVDVSLLLIQHRR
A0A520LRZ3      ----DAAGILNSRRMSELIADVKSRFDLVLVDSPPILGVSDASVLASEVDLTIIVIQHRK
A0A356FSV4      ----NPTQILNSAKYSSLLGSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVIKFNT
A0A3D3DET9      ----RSSELFISEATQRFLRDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVLRAAF
A0A355SVK9      ----NPTQVLNSAKFEAMLADLRERYDRIVIDSPPLGAVSDALNLLPLVDGVIYVVKFNT
A0A2E5D7I3      ----NPGELLREEAISKLFAWAREHYDHIVIDSAPILPVPDTRIIFPLVDNPCLVIRANV
A0A2V5NYE2      ----KSSEFFIGEVTERFLRDAAAKYDYVMIDTAPVMAADDVTSLAPHLDGVLFVIRAER
A0A2V6FIP7      ----SPSELAGSKRMRQFLEEVRNRYDRVILDCPPVSAVSDPLIIASLSDGVAFVTKFNK
A0A353DI77      ----NPGELLEPGRLRDLVEMFSSNFDHIVIDSAPLLPVPDTRILAPLVDNLALVIRAEH
A0A1V6GCZ3      ----SSLGILSSTQMKDLIGELKQRYDFVFFDSPPIMGVSDASILASEVDMTIQVIQYRR
A0A3C1UJT2      ----NPSEHISGSAIEELILKARQNFDRIVIDSAPLGPIGDTLSVARLADMLCLVVRSGK
A0A2S7U0Z3      ----NPSELLNEGEFNSLLEDLIPEFDRIILDSAPVLPVADSRLLAKHAHAVILVVRTRK
A0A5E6MKA7      ----HPADLLGAAAMAYLCQWARSHFGYVLLDCPPLTGMPDAAVVGTLADGAVLVIRDGY
A0A6B3L936      ----NPLGLLQPDEIMELVDEASKEFDRVIIDSPPVLPVSDTRLVAQHAHKVILVVRALK
A0A2N8IR72      ----NPVTLLSHPLLGHILGILKKQYDAVIIDAPPYGILADTAILASLSDITLYAVRSGK
A0A2N8IV96      ----DPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQPRK
R7E1V8          ----DPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQPRK
A0A1T4WWY4      ----GTTELLNSGVFAAILEELKKKYDRIILDTPPVLGLSETAFLQHHADGVAIVVRCGK
A0A3D3LEQ6      ----GTTELLNTEVFSQLLDTLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVVRSAS
A0A3D3NW23      ----GTTELLNTEVFSQLLDSLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVVRSAS
A0A2E0R252      ----NPSELLAGKGLKGAIGALEEYFDRIIIDSAPLVPVSDSLPLAKLAESVVLVCRVGK
A0A3E1EF48      ----NPAELLGGRHLGTFLADLCRDFDRVVIDTAPLVPVSDTLPIAKRAQSVIMVYRMGK
A0A2A2PVG8      ----NPAELLSGKSLRPLLEKLSEYFDRIVIDSAPLVPVSDSIPIAKLVQSVVLVVRMGS
A0A2E0R421      ----SPSELLASKALPALVDKLGKYFDRIIIDSAPIVSVSDTYPLAKIAQSVVLVCRMSM
A0A2E5EJ69      ----NPSELIASDHVKKLIDDVVGKYDQVVIDNAPVTAVSDTLLILEYVQTICMVTRAAK
A0A2G4I5Z5      ----NPAELLSGQWTAKLIQEASAKFDHVVLDNAPINAVSDALLIVKEAQTVCLVANAGK
A0A4P5QQV6      ----NPGELFLSTDTDRFLRAADAQYDYVIMDSAPVTAADDTSSLAPKVHATLFVFRFAT
A0A2E7ALI1      ----NPGELLREGMIEKLFDWAREHYDHVVIDTAPVLAVPDTRIIXPLVSNPXLVVRANV
A0A178IDB9      ----NPTEIIDQIAHSELFNKLSKSYEVIIIDTPPAAVFPDALLLSRFCAELVYVCRFRT
A0A290QD69      ----NPTEVIDQLAHCDLFNKLSKIYDLVIIDTPPAAVFPDALLLSRFCTEMIYVCRFKT
A0A2E7VDS1      ----AATEMLARPDFDILLSNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLCVIRYGK
A0A178IFJ2      ----RISELLDNEKLKGLFEQARREFDILVIDTPPAGIFPDAFDLVPFASELVYVVRFNH
A0A357FSP9      ----NPTQVLNSAKFEAMLADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNT
A0A538NJ59      ----NPGDLFLNPALSQVLAWARQQFDYVLIDSSPVFAADDTATLAPMVDGTLFVVRNRF
A0A3C1VFY9      ----HSSELFLGPVMGKFLQETIKEYDYVLIDTAPVMAADDVTSLAPRVDGVIFVVRAEF
A0A522AC27      ----RSSELFVHQDTKDFLKAAAAEYDCVVVDTAPVMAADDVTSLAPLIDGTIFVIRAGE
A0A2A2R174      ----NPAELLSGQWTSKLIKEASAKFDHVVLDNAPINAVSDALMIVKEAQTVCLVANARK
A0A1H2DTI1      ----QGAELFLSPITDGILREMYNEFDYIIFDTSPVMAADDATSLAPKIDGTIFVLRASM
A0A1V5L462      ----NPGDLFLNERMDAILEACRKQYDFVILDTAPILAVDDTIGLLRRADDVIFVVKSGQ
A0A2A2R3V9      ----NPGELFLSSLVPSIFQEMRDEYDYVVVDSAPILATDDTASLAPKLDGTIFLMRTSY
A0A3D3LGD3      ----DSAGILNSQRMSDLIEDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVVQHRR
A0A350ARX4      ----NSGELLLSERMDNLLEWARERYTYVIVDAPPILAVNDTIGLSNKTDSMMFVVRASQ
B5JIS2          ----LPSKLLVSTKIDALLRKLEETFEVIIVDTPPVGLYPDALIFAKSVGETLLVARESK
A0A1H2GQN6      ----DAISRFDNQVLREIIVELKEKYQVIFIDSPPALGVSDASVIAHEVDKVVMVIQHRR
A0A512M3Y3      ----PRFEILSAARFVNTINDLRKQYDRIIIDTPPLLGLADSIMVSKCVDGAIFVIRAEQ
A0A4P5R5J1      ----HPAEHFLGKVTDQLLQEVYAEFDYIIFDSPPVMAADDVLSLSPKIDGTIFVVRFST
A0A4P5YK43      ----NPGELLMGEVAHKVISEARQFYDHVIIDCPPITAIDDTFCLIPITDGLLFVVKSGQ
A0A2A2RPW6      ----NPAELLAGPWAKQLIEEASKRYDKVVLDNAPVNAVSDTLLICKEAQTICLVMHSRR
B4D1I7          ----NPGELYLGRSADEFLKTVHAEFDYVVLDSSPVMAADDTTSLAPKADAAVFVFRFTS
A0A353F286      ----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRK
A0A354FSA6      ----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRK
A0A3B9GA54      ----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRK
A0A520LEH8      ----DAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRK
A0A6B2M0T8      ----EATELIESPAFRQSIEKFQEQYDIIIIDTAPAGLFPDAGLIGNYAQNFIFLTQLNK
A0A2D7B7R6      ----NPSEHISGSAIEELILKARQNFDRIVIDSAPLGPIGDTLSVARLADMLCLVVRSGK
B1ZT68          ----NPTETLERFVTSGMLKRLLERYDLVILDTPPVAVFPDALLLSRYCKELIFVCKYGS
W0J7C2          ----RPTELLDQLSRRETLQPLLDNYDLILFDTPPAAVFPDALMLARCCHEMIYVCRYRT
A0A2E5K4P7      ----TPMTIFNNEYFPFLMNEIRQYYDKIIIDSPPLAAVSDALNIVPFVDGILFVVKYNT
A0A0R2XPB1      ----HPAELLMSKYMDQFIRDARAQYDFVIFDTAPILATDDTCGFAAKMDAVLFTIRCAH
A0A348NQP1      ----HPAELLMSEYMDQFISEARERYDFVIFDTAPILATDDTSGFAAKVDAVLFTIRCAH
A0A357FV58      ----HPAELLMSEYMDQFISEARERYDFVIFDTAPILATDDTSGFAAKVDAVLFTIRCAH
A0A2V6F9Q9      ----QPSEHLLRDSTDQFLKEIYHQYDYIIIDSSPVLAADDTTSLAPKVDATLLVVRLSH
A0A2V6NZZ3      ----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSY
A0A2V6EBU2      ----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSY
A0A2V6EY06      ----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSY
A0A2V6ME53      ----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSY
A0A538NUU0      ----QPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSY
A0A2V6NIJ1      ----QPSEHLLRDSTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSY
A0A2V6C292      ----QPSEHLLRESTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSY
A0A2V6D2X0      ----QPSEHLLRESTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSY
A0A2V5ZUK1      ----QPSERLLHETTDVLLREIYQHYDYVIIDSSPVLAADDTTSLAPKIDATLFVVRLAY
A0A2V5XFN9      ----QPSEHLLRESTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSY
A0A2V6EZC8      ----QPSEHLLRASTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSY
A0A2V6I7Z5      ----QPSEHLLRESTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSY
A0A3B9LCP2      ----QPSEHLLRDSTDAILKEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFVVRLSH
A0A3C0R669      ----QPSEHLLRDSTDAILKEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFVVRLSH
A0A2V6EID2      ----QPSEHLLRDSTDVLLKEMYKHYEYILIDSSPVLAADDTASLAPKIDATLFVVRLSY
A0A2V6MHB0      ----QPSEHLLRDSTDVLLKEMYKHYEYILIDSSPVLAADDTASLAPKIDATLFVVRLSY
A0A2W5YWL9      ----QPSEHLLRDSTDQMLKDMYQQYDYILIDSSPVLAADDTTSLAPKIDATLFVVRLGY
A0A2V5NH62      ----QPSEHLLRDSTDALLRDMYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFVVRLSY
A0A2W6A620      ----QPSEHLLRESTDQLLKEMYNHYDYILIDSSPVLAADDSTSLAPKIDATLFVVRLSY
A0A2V5PIJ4      ----QPSEFLLRESTDALLREINTFFDYIIIDSAPVLAADDATSLAPKIDATLFVVRLSH
A0A2V6K2G8      ----QPSEHLLRESTEALLKEIYQDYDYVIIDSSPVLAADDTTSLAPKIDATLFVVRLSY
A0A2V5W206      ----QPSEHLLRESTEALLKEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVVRLSY
A0A2V6MW77      ----QPSEQLLRDSTEALLKELYQHYDYVIIDSSPVLAADDTTSIAPKIDATIFVVRLSY
A0A2G4GZN8      ----NPTQVINNPKFLAMIEELRGRYDRIFIDSPPIGAVSDALHILPKTDGVIYVVRYNV
A0A348NPT1      ----NPTQVLNSAKFEAMLADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNT
A0A2E1KV60      ----NPTAVLSDEKYQSMMLELRDRYDKIIVDSPPLAAVSDALNVVPYIDAVLFVIKYDS
A0A2D7F4D9      ----NPTAILNDSKFESMLLQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVIKYDS
A0A3R7RBR8      ----NPTAILNDSKFESMLLQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVIKYDS
A0A2E0NH28      ----NPTQILNSAKYSSLLGSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVIKFNT
A0A350AS32      ----NPTQVLNSAKFEAMFADLRDRYDRIVVDSPPLAAVSDALNLLPLADGVLYVIKFNT
A0A368BGT4      ----NPTQVLNSAQFEEMLAVLRDRYDRIVIDSPPLAAVSDALNLLPLVDGVIYIIKFNT
A0A2E0V4K6      ----NPGELLKPGAIRELLQWAREHYDHVVIDTAPVLAVPDTRIILPQADNRCLVIRANV
A0A2E6NAH3      ----NPTQVLNSAQFEAMFSDLRNRYDRIVVDSPPLAAVSDALNLLPMVDGILYVIKFNT
A0A2A5VZA5      ----NPTQVLVSAQFEAMLADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVIKFNT
A0A424R295      ----NPTQVLVSAQFEAMLADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVIKFNT
B4CZV9          ----HGTELLGSAQFSELLNSLRGRFDRIVIDTPPVLGLSETSIMQSLVDGVLFVIWTGQ
A0A290QE54      ----TPTEILENPAFGQLLARLKKHFDLIIVDSPPMGAVTDSLLIAERTDEVVYVCRFNK
A0A1H1SWX2      ----SPTELLETAVFGQFIEAMKQHFDLIVVDSPPMGAVTDSLLIAERTDEVIYVCRFNR
A0A4Q1C9I5      ----SPTEFLENPIFGQFIEAMKQHFDLIVVDSPPMGAVTDSLLISERTDEVIYVCRFNR
A0A3B9FM17      ----AATEMLEQNDFSTVIDLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGK
A0A1G3ZL71      ----VPTELLEKPEFGELILQLKKRFDLIVIDSPPLGAVTDSLLIAEQTDEVIYVCRFNR
A0A556QP09      ----SPTQLLESPIFGQLLEKLKKHYDLIVVDSPPLGAVTDSLLIAERVDEVIYVCRFNR
A0A2T6DX88      ----IPTELLEDPRFGQLIAKLKNQYDLVVVDSPPMGAVTDAMLVAERTDEVVYVCRFNH
A0A2T6CWI7      ----SPTELLENPVFGQLLERLKKEFDLVIVDSPPLGAVTDSVLIAERVDEIVYVCRFNR
A0A3E1E5C8      ----SPTELLENPAFGQLLEKLKKDYDLVVVDSPPLGAVTDSLLIAERTDEVIYVCRFNC
B1ZZ74          ----SPTEFLENPVFGQLLERLKREYDLVIIDSPPLGAVTDSMLIAERTDEIIYVCRFNR
R7E4L8          ----NPVALLTQGRLEELLRYWRARYDRIILDGCPYEAVADASLMARHADLVLYVIRCGM
A0A4Q3BVY2      ----GTTELLCQDVFSNMLEHFRKTYDRIVIDAPPVLGLSESSSLQKVVDGTVLVVRAEV
A0A4P6PCA7      ----NPAEMLGRKELAELIKWARDEYDRVIIDTPPIGPVGDGVILASYVDSVIVVSRVGK
A0A0E3YV65      ----RSTEILDSAAFRDLLDFLHKQYDAVIIDTPPAGVFSDAMVLAEQAGELVFVVRYNY
W0J900          ----RISELLESKKLKALIEQAQREFDILLIDTPPAGIFPDALSLAPFANELIYVVRFNY
A0A2T6DSN5      ----NPTEVIDQIASCDLFNKLSKHYDIIVIDTPPSAVFPDALLLSRFCSEMVYVCRFKT
A0A2V2SMX4      ----HSSELFISQAAADFLKNAAMQYDYVIMDTAPVMAADDVASLAPNMDSTIFLVRAEH
A0A317ZIW7      ----HPAELLMSDSMEQFIKHAREHYDFIVFDTAPILATDDTTSFAPFVDAVLFTVRCSY
A0A2D7WMI4      ----SVTELIERKEFGILLDKLKAESDVIVVDSPPIGLFPDALAFSKIADDIIFVTRYGK
A0A2D6VHX5      ----AATEIIEKKEFELLLTCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGK
A0A2D8I214      ----AATEMLEQKEFDIVHNELKEMFDVIIVDSPPIGLFPDSLAIARKVDDVLFVTRYGK
A0A1Z8VL41      ----AATEILESAEFEMVTNHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVTRYGK
A0A2E6TNA4      ----AATEILESTEFEMVTNHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVTRYGK
A0A1Z8RG47      ----AATEMLERAEFDLVMNKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVTRYGK
A0A1Z8RJJ5      ----AATEMLERTEFDLVMNKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVTRYGK
A0A2D7V631      ----AATEMLERSEFDYVMNKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVTRYGK
A0A354RA24      ----AATEMLERSEFDYVMNKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVTRYGK
A0A2E9RV62      ----AATEMLEKPEFDKMLFSLRQNAEIIIIDSPPIGLFPDSLAMARKVDEVIFVTRYGK
A0A2E4AY96      ----SVTELIEKNQFHELLGKLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVTRYGK
A0A3B9B9P4      ----SVTELIEKNQFHELLGKLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVTRYGK
A0A2D5Y6N6      ----AATELLESNSFDRIHKILRTIADVIIIDSPPIGLFPDSLAMARKVEEVLFVTRYGK
A0A2E7HSS8      ----AATEMLEHNDFSVVIDSLKRHAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGK
A0A2D8VCK3      ----AATEMLEQNDFSTVIDLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGK
A0A350QVY4      ----AATEMLEQNDFSTVIDLLRTNAEVVIIDSPPIGLFPDSLAIARKVDEVLFVTRYGK
A0A2E4ZYR7      ----AATEMLERPDFDILLNNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLFVTRYGK
A0A2E6TCV1      ----AATEMLERPDFDHLLNNLKKLCDILIIDSPPLALFPDSMAMARKVDEVLFVTRYGK
A0A3D4HHL8      ----RPGELLSGVYFATMLEGLRKRYDFIVFDLPPVLATDDTPGFVQKVDGVLFVVRSNT
A0A366HV03      ----GSAELLCRLSLEENVAIWRQQYDWIILDTPPVLGLSETTNLQRVADAVVLVVKAEK
A0A6G6K911      ----GSAELLCRLGLEESINIWRQQYDWIILDTPPVLGLSETTNLQRVADAVVLVVKAEK
A0A5R8KAF2      ----GTTELLCQKGFVDLVERFRGEYDQIVIDTPPVLGLSETAALRIVVDGVIMVVRAEK
A0A2V2SDN0      ----EPGELVLRSQFSSLLSDVYSRFDYIIIDSPPVLAADDAATLAPKVDGVLFVVRGSH
A0A1V6GL40      ----RSSELFISEATQRFLRDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVLRAAF
A0A2V5X6Z6      ----NPGELALSPVWLSFLAEAKSQFDYVLVDTPPVLAADDAATLAPKVDGVLFVVRGSF
A0A2V5VGZ7      ----NPGELVLSQVWPGFLAEAKPQFDYILVDTPPVLATDDAGSLAPKVDGVLFVVRGSF
A0A2V5U130      ----NPGELVLSQVWPGFLAEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVVRGSF
A0A2V6C237      ----NPGELVLSPVWPGFLAEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVVRGSF
A0A3R8L982      ----TPTEFLESAAFTQLLTKLKKHYDLVIVDSPPLGAVSDSLLIAERTDEVLYVCRFNR
A0A2E7HPU9      ----NPGELLTTEGVVAVLKELKQEFDVIVIDSAPLLAVPDTRLLVPEVDNFCLVVRAEH
A0A388PR45      ----NPTQVINHPRFGEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKVDGVVYVVRFNV
A0A388QR61      ----NPTQVINNPKFAEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKADGVVYVVRFNV
A0A4P5YHI0      ----NPTQVINNPKFAEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKADGVVYVVRFNV
A0A2A2RS01      ----NPTQVINNPKFLAMLDEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVVRFNL
A0A2A2Y1A7      ----NPTQVINNPKFLAMLDEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVVRFNL
A0A388PDH9      ----NPTQVINNPKFLAMLDEMKTRYDRVFIDSPPIGAVSDALHLVPKVDGVIYVVRFNL
A0A2G4H1E7      ----NPTQVINHPKFLAMIDGFRERYDRIFIDSPPLGAVSDSLHLLPKVDGVIYIVRYNA
A0A2G4GZA6      ----NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKVDGVLYVVRYNT
A0A388P514      ----NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNT
A0A2A2YG59      ----NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNT
A0A2G4F7D5      ----NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNT
D5EML0          GGCEHPTELLGDLRVSALFSKLKDLYDIVVFDTPPIGLFSDATIVADSADSCVMVARQFA
A0A3C1C1M3      ----RPAELVGGAKVAALLAWARAHFDRIVLDVPPLGIVSDALSLAHLSDCVLVMARPAT
A0A2E9EYJ1      ----DAAGILNSRRMSELIAXVKSRFDLVFIDSPPILGVSDASVISSXVDLTIIVIQHRK
A0A258AXR6      ----DSAGLLNSQRMVDLIAEVKSRFDLVLIDSPPILGVSDASVLANLADMTMIVVQHRK
A0A3D3NZQ6      ----DSAGILNSQRMSDLIEDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVVQHRR
A0A1T4WVZ9      ----DSAGVLNSQRMTELIEDAKSRFDIVLIDAPPILGVSDASVLANEADLTIIVVQHRK
A0A4R7SSI6      ----DSAGVLNSQRMSELIADAKSRFDLVLIDSPPILGVSDASVLANEADLTLIVVQHRK
                                            :..*  *     :   .           .   

A0A4Q3AQI1      TPIRTMKAAVEMLQTNGANFYGFVLNRL-----------DLNATTN--------------
A0A4P6PD26      YPRDMLVKAKAMIETLGVNVVGAVLNNI-----------NVMRDDY--------------
A0A1Z8SVB5      VSRHVVKRLIGDLKITGANILGVILNDL-----------PSKKATG--------------
A0A2V5W3Y0      TSARLVRKSLELLYNRQVNVPGIILNYV-----------DTSLPEY--------------
A0A432FAS4      VRREHARKTVQRIQDAGIYIAGICINDL-----------DFEGKDS--------------
A0A660Q3A0      TSRKLSQLAVQTLRERGANILGCVLNNL-----------DFSRIGY--------------
A0A2V5UAD5      SRPRPAREALELLFQRQAKVLGLVFNRA-----------DASARSH--------------
A0A258AXL1      TTQRDVATASEILHQSGAQVYGFVLNCV-----------NLRRLEN--------------
A0A2E6T1E0      IRREHARKTVQRIQDAGINIVGVCINDL-----------DFEGKDS--------------
A0A2D5W0Q9      IRREHARKTVQRIQDAGIYILGTVINDI-----------DFEGKDS--------------
A0A1Z9KB52      VSRQVVKRLIGDLKATGANILGVILNDL-----------PSKKATG--------------
A0A2V5U7A0      TTVHSARQVKERFDAVRGPILGVILNGI-----------NVEDPD---------------
A0A257LYL4      LPRNMLMRVKQAVENVGGHVIGVVLNNV-----------DVRSDSQ--------------
A0A4Q2XXY1      LPRTMLMRVKQAIENVGGNLLGVVLNNV-----------DVRSDSQ--------------
A0A3D4CZT6      LPRNMLVRVKQAVENVGGHVIGVVLNNV-----------DVRSDSQ--------------
A0A4V1S9Q4      LPRNMLLRVKQAVENVGGNVIGVVLNNV-----------DVRSDSQ--------------
A0A355VK99      IDKRYLTQIQQLADQGKLPNMAYIINGV-----------NFKSASY--------------
A0A2V6N5E0      TSARLTKKALELLYGRQVNIPGVILNFV-----------DTSLPEY--------------
A0A2V6NH44      TSARLTKKALESLYSRQVNVPGIILNYV-----------DTSLPEY--------------
A0A432FDF6      YPQLMTQRAKDMVTKVGGELVGVVLNNI-----------NISQDSY--------------
A0A522ACN3      YPQPMNIRAKQLIEKVGGNLVGIVLNNI-----------NMSQDES--------------
A0A353DCA1      LPRNMLLRVKQAVENVGGQVIGVVLNNV-----------DVRSDSQ--------------
A0A3C1AXQ2      LPRHMLMRVKQTVENVGGTVLGVVLNNV-----------DLRSDSQ--------------
A0A3D0IZR7      YPRNVSQRAKRVIEDVGGKLFGVILNNV-----------NIKTDDN--------------
A0A520LRZ3      LPRGMLIRVKQAIENVGGKALGVVLNNV-----------DVRSDNQ--------------
A0A356FSV4      VKRKTAVMNVRRLWESNTPVFGSVLNNV------------STALSS--------------
A0A3D3DET9      TSARVARASLESLYQRQVRLLGLVFNAV-----------RPSSED---------------
A0A355SVK9      VKRKTAMVNARRMAESNTPVFGAILNNI------------SSTLSS--------------
A0A2E5D7I3      VPKPAVFRALDVMEEDGSRIVGVVLNGY-----------RETRRLX--------------
A0A2V5NYE2      TSARVGRAALELLYHRQVSVLGLVFNGV-----------RPSSVDY--------------
A0A2V6FIP7      IRRDHASRTIQRIQDAGIHILGVVLNDI-----------DFEGKDS--------------
A0A353DI77      TPVKSIQRAFDMLEDDGVFSSGVILNDF----------TENRLQGG--------------
A0A1V6GCZ3      YPQPMNIRAKQLIEKVGGNLVGIVLNNI----------NMSQDESY--------------
A0A3C1UJT2      TTSKVVLRIIDYLHRHGHTPSGIVLNFL-----------RNNNNKG--------------
A0A2S7U0Z3      TPIGAMIRACDLLKASGAKLGGVVVNGM-------------KRTGG--------------
A0A5E6MKA7      VDRSEARRVVETLLGVNTRILGAVLNRV------------QTSARS--------------
A0A6B3L936      TPVGAVLRAKDLLLGAKLDLAGVVVNAL------------KARHSG--------------
A0A2N8IR72      IDKRYLLQIQQLADQGKLPNMAYIINGV------------NFKSAS--------------
A0A2N8IV96      LPLKALLRQKQVIESVGGNLAGVVMNNV-----------DITSDHQ--------------
R7E1V8          LPLKALLRQKQVIESVGGNLAGVVMNNV-----------DITSDHQ--------------
A0A1T4WWY4      TLRKDVEDAVQSLQKLGAHFYGFILNGV----------DFSKRVNH--------------
A0A3D3LEQ6      TPRSDVTAAFQQLEKLGGHFFGFVLNRV----------DFSKRSNH--------------
A0A3D3NW23      TPRSDVTAAFQQLEKLGGHFFGFVLNRV----------DFSKRSNH--------------
A0A2E0R252      TPRGAIKRAIRVLEANHSAPVGVVANGL-----------PRTRTKG--------------
A0A3E1EF48      TPRKALFRGLKTLRSNHAEPVGIVANLL-----------PRVAGRG--------------
A0A2A2PVG8      TPKGAIKRAIRVLSDNGSHPVGIVANGL-----------PQTRTAG--------------
A0A2E0R421      TSRSSIMRALRILKVNQSDPVGIVANGL-----------PVAKTKT--------------
A0A2E5EJ69      TSYRLIGRALELVRRSGKNVSGLVLNFV-----------PEKRRAG--------------
A0A2G4I5Z5      TSYRVVLRALEMLRRAGAKPSGVVLNFL-----------PQSAGSG--------------
A0A4P5QQV6      SSMRISQKALDTLRERQVNVLGLVCNDV------------DESLQD--------------
A0A2E7ALI1      VPKPAVFRALEMLEEDGSRVVGIILNGY----------RESRRLXGXXYSYGS-------
A0A178IDB9      VRRKLIKKTLSKFTESGISILGVVLNRM-----------PHASIMN--------------
A0A290QD69      VRKAVIRKALEKFQESGITILGVVLNCM-----------PHASVMN--------------
A0A2E7VDS1      VSRKVVKNLLAKVDETGANVLGVVLNDL-----------PEKKTPG--------------
A0A178IFJ2      VSRPQVHRVTERFRSTGLEMPGIVLNMM-----------PSGRGSA--------------
A0A357FSP9      VKRKTAVVNVRRLWESNTPIFGAILNNI------------SSTLAS--------------
A0A538NJ59      SRPRPAREALELLFQRQAKVLGLVFNRA-----------DASARSH--------------
A0A3C1VFY9      TSARVVRASLDMLYQRKARVLGLVFNAV-----------RMSVGGY--------------
A0A522AC27      TSGRVARAALELLYQRNVPVLGLVFNAV-----------QTGSGDY--------------
A0A2A2R174      TSYRAVLRALEMLRRAGAKPSGVVLNFL-----------PQSAGSG--------------
A0A1H2DTI1      TSARAARNALDQLYHRQVNVLGLVLNSV------------NALLPD--------------
A0A1V5L462      TNFRQVKISLERLSVTKTKVWGFVMNYV------------KAGGND--------------
A0A2A2R3V9      TSARLSRNAMDLLYQRQVNILGLVMNFV------------DTNLPE--------------
A0A3D3LGD3      LPRQTLMRVKQTVENVGGTVLGVVLNNV-----------DLRADSQ--------------
A0A350ARX4      TSTRQVQSSLERLSSRTSKIMGLVFNCA-----------PATGVDY--------------
B5JIS2          APISQIRQVIGDIDSTGAPVLGLVLNDY-----------------S--------------
A0A1H2GQN6      YPREISIRTKKAIEEVQGNLVGVALNSV-----------ATNSDEG--------------
A0A512M3Y3      TTQRDIATAMEVLVGTRTPIYGFVLNGV-----------DLSRMEN--------------
A0A4P5R5J1      SSARRSRTAINLLVQRQANLLGIVCNDV------------RLAESE--------------
A0A4P5YK43      TSMRFAKSALGALRHRGAEILGVVLNGI------------TSDNPH--------------
A0A2A2RPW6      TPVRVVSRALEMLRRAGGKPSGVVLNFL-----------PGSAGAG--------------
B4D1I7          SSTRASRKALELLRERQTNVIGIVCNDV------------SEAMQD--------------
A0A353F286      LPRNMLMRVKQAVENVGGQVIGVVLNNV-----------DVRSDSQ--------------
A0A354FSA6      LPRNMLMRVKQAVENVGGQVIGVVLNNV-----------DVRSDSQ--------------
A0A3B9GA54      LPRNMLMRVKQAVENVGGQVIGVVLNNV-----------DVRSDSQ--------------
A0A520LEH8      LPRNMLMRVKQAVENVGGQVIGVVLNNV-----------DVRSDSQ--------------
A0A6B2M0T8      HRKATLKAILGRLSQSKAEILGVVVNKV--------SRSKSRNLGT--------------
A0A2D7B7R6      TTSKVVLRIIDYLHRHGHTPSGIVLNFL-----------RNNNNKG--------------
B1ZT68          VRLNSVRKTLARVHETGIKVLGLVINQM-----------PESRFRA--------------
W0J7C2          VRPAIIRKVIDRFHGTGISLLGVVLNRL-----------PQSKARS--------------
A0A2E5K4P7      VKRNTASLTVRKLAEAGKPIFGVILNNM------------ASKSAE--------------
A0A0R2XPB1      TQVRQIKPAMARLRERKIDISGLILNYV------------DTTQPG--------------
A0A348NQP1      TQVRQIKPAMARLRERNIEISGLILNFV------------DTTQPG--------------
A0A357FV58      TQVRQIKPAMARLRERNIEISGLILNFV------------DTTQPG--------------
A0A2V6F9Q9      TSARLTKKALELLYSRQVNVPGIILNFV------------DTSLPE--------------
A0A2V6NZZ3      TSARLTKKALELLYNRQVGVPGVILNCV------------DTSLPE--------------
A0A2V6EBU2      TSARLTKKALELLYNRQVGVPGVILNCV------------DTSLPE--------------
A0A2V6EY06      TSARLTKKALELLYNRQVGVPGVILNCV------------DTSLPE--------------
A0A2V6ME53      TSARLTKKALELLYNRQVNVPGVILNFV------------DTSLPE--------------
A0A538NUU0      TSARLTKKALELLYNRQVNVPGVILNFV------------DTSLPE--------------
A0A2V6NIJ1      TSARLTKKALELLYSRQVNVPGIILNYV------------DTSLPE--------------
A0A2V6C292      TSARLTKKAFELLYSRQVNVPGVILNFV------------DTSLPE--------------
A0A2V6D2X0      TSARLTKKAFELLYSRQVNVPGVILNFV------------DTSLPE--------------
A0A2V5ZUK1      TSARLTKKALELLYSRQVNVPGVILNFV------------DTSLPE--------------
A0A2V5XFN9      TSARLTKKALELLYGRQVNVPGVILNFV------------DTSLPE--------------
A0A2V6EZC8      TSARLTKKALELLYGRQVNVPGVILNFV------------DTSLPE--------------
A0A2V6I7Z5      TSARLTKKALELLYGRQVNVPGVILNFV------------DTSLPE--------------
A0A3B9LCP2      TSARLARKGLELLYDRQVNVPGIILNFV------------DTSLPE--------------
A0A3C0R669      TSARLARKGLELLYDRQVNVPGIILNFV------------DTSLPE--------------
A0A2V6EID2      TSARLIRKGLELLYGRQVNVPGIILNFV------------DTSLPE--------------
A0A2V6MHB0      TSARLIRKGLELLYGRQVNVPGIILNFV------------DTSLPE--------------
A0A2W5YWL9      TSARLTRKALELLYSRQVNVAGVILNYV------------DTSLPE--------------
A0A2V5NH62      TSARLTRKSLELLYNRQVNVPGVILNYV------------DTSLPE--------------
A0A2W6A620      TSARLTRKSLELLYNRQVNVPGVILNYV------------DTSLPE--------------
A0A2V5PIJ4      TSARLTRKSLELLYNRQVNVPGVILNQV------------DTSLSE--------------
A0A2V6K2G8      TSARLTKKALELLYNRQVNVPGVILNFV------------DTSLPE--------------
A0A2V5W206      TSARLTKKALELLYGRQVNIPGVILNFV------------DTSLPE--------------
A0A2V6MW77      TSARLTKKALELLYGRQVNIPGVILNFV------------DTSLPE--------------
A0A2G4GZN8      VNARNAVSCISRLRDAHAPILGVVLNSM------------SIRMAS--------------
A0A348NPT1      VKRKTAVVNVRRLWESNTPIFGAILNNI------------SSTLAS--------------
A0A2E1KV60      VKKSLVNSCVRRLWESKKPVLGAILNNV------------SSGLSS--------------
A0A2D7F4D9      VKKSLANSCIRRLWESKTPLLGAVLNNV------------SLGLSH--------------
A0A3R7RBR8      VKKSLANSCIRRLWESKTPLLGAVLNNV------------SLGLSH--------------
A0A2E0NH28      VKRKTAVMNVRRLWESNTPVFGSVLNNV------------STALSS--------------
A0A350AS32      VKRKTAVVNVRRLWESNTPVFGAILNNI------------TSTLSS--------------
A0A368BGT4      VKRKTAVLNVRRLWESNTPVFGAILNNI------------TSSLSS--------------
A0A2E0V4K6      VPKPAVFRAIDLLEEDGVKLAGVVMNGY----------RESRRLLGYNYSYGA-------
A0A2E6NAH3      VKRKTAVINVRRLWESNTPVYGAILNNI------------TSVLSS--------------
A0A2A5VZA5      VKRKTAVANVRRLWESNTPVFGAILNNI------------TTSLSS--------------
A0A424R295      VKRKTAVANVRRLWESNTPVFGAILNNI------------TTSLSS--------------
B4CZV9          TPVRCVKSAIETLRANRANFYGFVLNRL-----------DLNATQN--------------
A0A290QE54      AYRKHIKLYIRALHNGKNDILGIVLNGL-----------STRRIEY--------------
A0A1H1SWX2      AYRKHIRLYIKQLKESKNELLGIVLNGL-----------SPRRIEY--------------
A0A4Q1C9I5      AYRKHIRLYIKQLRESKNELLGVVLNGL-----------SPRRIEY--------------
A0A3B9FM17      VSRKIVKTLIESINDTGANLLGVVLNDL-----------PQKKTPG--------------
A0A1G3ZL71      ALRKHIKVFVRTLREGKNAFLGIVLNGL-----------TARRIAY--------------
A0A556QP09      AFRKHIRLYIKALRSGKNEILGVVLNGL-----------SPRRIEY--------------
A0A2T6DX88      AARKHIRLYIRALQSGKNEILGIVMNGM-----------STRRIEY--------------
A0A2T6CWI7      AYRKHIRLYMRTLRQGKNEVLGIVLNGL-----------SPRRIEY--------------
A0A3E1E5C8      AAKKHVRLYMKTLRNGKNEVLGVVLNGL-----------SPRRIEY--------------
B1ZZ74          AYRKHIRLYMKALRDAKNEVLGVVLNGL-----------SPRRIEY--------------
R7E4L8          IEKQYVPVIQGLADKGEFRSGAVILNAE--------------------------------
A0A4Q3BVY2      TGRKDVLDALALLRRSQAHFFGFVLNAV-----------DLSKLGN--------------
A0A4P6PCA7      TKMRGLKTMLSRLLEVDALVLGCIANDV-----------P--------------------
A0A0E3YV65      TSRPGVRRLIETFKRSQIDLAGIVLNRM-----------PAGTHSD--------------
W0J900          VSRPQVHRVTERLRSTGLELPGIVLNMM-----------PSGRGSS--------------
A0A2T6DSN5      VRKALIKKTLHKFAESGIHVLGVVLNCV-----------PSSSVRN--------------
A0A2V2SMX4      TSARVARAALDILYQRRVKVMGLVFNAV------------RPTTAD--------------
A0A317ZIW7      THLRQIKPAIARLKERSTNVDGIILNYV------------DTAQPG--------------
A0A2D7WMI4      VARRVAKNLLYSIEESGTNILGVVLNDL-----------PQKRSTG--------------
A0A2D6VHX5      VSRQVVKRLIGDLKATGANILGVILNDL-----------PSKKATG--------------
A0A2D8I214      VSRKIAKNLVENLEETGVNVLGVVLNDL-----------PQKKAPG--------------
A0A1Z8VL41      VSRKVAKNLIENIEETGANILGVVLNDL-----------PQKKTPG--------------
A0A2E6TNA4      VSRKVAKNLIENIEETGANILGVVLNDL-----------PQKKTPG--------------
A0A1Z8RG47      VSRKVAKSLLENIEETGANVLGVVLNDL-----------PQKKTPG--------------
A0A1Z8RJJ5      VSRKVAKSLLENIEETGANVLGVVLNDL-----------PQKKTPG--------------
A0A2D7V631      VSRKVAKSLLENIEETGANVLGVVLNDL-----------PQKKTPG--------------
A0A354RA24      VSRKVAKSLLENIEETGANVLGVVLNDL-----------PQKKTPG--------------
A0A2E9RV62      VARKVAKNLIESLEETGANMLGVVLNDL-----------PEKKTPG--------------
A0A2E4AY96      VARRAAKGLLSNLEESGSNILGVVLNDL-----------PSKKSTG--------------
A0A3B9B9P4      VARRAAKGLLSNLEESGSNILGVVLNDL-----------PSKKSTG--------------
A0A2D5Y6N6      VSRKIAKSLLENLDETGAKILGVVLNDL-----------PQKKAPG--------------
A0A2E7HSS8      VSRKVVKSLIASIKETGANLLGVVLNDL-----------PQKKTPG--------------
A0A2D8VCK3      VSRKIVKTLIESINDTGANLLGVVLNDL-----------PQKKTPG--------------
A0A350QVY4      VSRKIVKTLIESINDTGANLLGVVLNDL-----------PQKKTPG--------------
A0A2E4ZYR7      VARKVVKNLLMRMDETGANTLGVVLNDL-----------PEKKTPG--------------
A0A2E6TCV1      VARKVVKNLLTRVDETGANILGVVLNDL-----------PEKKTPG--------------
A0A3D4HHL8      TRVKQAKSAFHILMFRRAKILGIVLNAF-----------DVRGPG---------------
A0A366HV03      THGRDVTEAVEQLMRAGAPMAGFVLNNI-----------DMSKVSN--------------
A0A6G6K911      THGRDVTEAIEQLMRAGAPMAGFVLNNI-----------DMSKVSN--------------
A0A5R8KAF2      TTRRDVSDAVALLRKTDAHFFGMVLNDL-----------DLNKAKN--------------
A0A2V2SDN0      TSARMVREGLDTLRQRRARVLGVIFNRA--------------VSSS--------------
A0A1V6GL40      TSARVARASLESLYQRQVRLLGLVFN-A--------------VRPS--------------
A0A2V5X6Z6      TSARMARGALDALRQRRVHVLGLIFNRA--------------ASSP--------------
A0A2V5VGZ7      TSARMARGALDALRQRHVRVLGLIFNRT--------------VSSP--------------
A0A2V5U130      TSARMARGALDALRQRHVHVLGLIFNRA--------------ASSP--------------
A0A2V6C237      TSARMARGALDALRQRHVRVLGLIFNRT--------------VSSP--------------
A0A3R8L982      ALRKHIKLYIKALRAGKNEILGVVLNGL-----------TARRIEY--------------
A0A2E7HPU9      TPKGAVAKCLDMLRDDDNEPAGIVVNDY-----------QERGGFARKYLYKYGGYGGYG
A0A388PR45      VSARNAAACLARLRDAGAPMLCAVLNQM-----------SVRLASV--------------
A0A388QR61      VSARNAAACIGRLREAGVPMLCAVLNQM-----------SVRMASV--------------
A0A4P5YHI0      VSARNAAACIGRLREAGVPMLCAVLNQM-----------SVRMASV--------------
A0A2A2RS01      VHMRNAGSCLGRLAETGVPILGAVLNRM-----------SIRMASV--------------
A0A2A2Y1A7      VHMRNAGSCLGRLAETGVPILGAVLNRM-----------SIRMASV--------------
A0A388PDH9      VHMRNAGACLARLAETGVPILGAVLNRM-----------SIRMASV--------------
A0A2G4H1E7      VNLRHATSCLARLREAQAPLLGVILNAM-----------SLRMASA--------------
A0A2G4GZA6      VNLRNATSCLARLREAQAPLLGVVLNAM-----------SLRMASA--------------
A0A388P514      VNLRNATSCLARLREAQAPLLGVVLNAM-----------SLRMASA--------------
A0A2A2YG59      VNLRNATSCLARLREAQAPLLGVVLNAM-----------SLRMASA--------------
A0A2G4F7D5      VNLRNATSCLARLREAQAPLLGVVLNAM-----------SLRMASA--------------
D5EML0          VKRTKFQHSVNQMERSTAPVVGVVFNGIKDVNAAVGFGRNGVSHYG--------------
A0A3C1C1M3      SRKRAVRHTIQRFQAAGMANLAVVMNDV-----------E-HSKFT--------------
A0A2E9EYJ1      LPRGMLXRVKQAIQNVGGTAXGVVLNNV-----------DVRSDNX--------------
A0A258AXR6      LPRHMLMRVKQGVENVGGKVVGVVLNNV-----------DLRSDAQ--------------
A0A3D3NZQ6      LPRQTLMRVKQTVENVGGTVLGVVLNNV-----------DLRADSQ--------------
A0A1T4WVZ9      LPRHMLLRVKQTIENVGGTVLGVVLNNV-----------DLRSDSQ--------------
A0A4R7SSI6      LPRHMLLRVKQTVENVGGTVLGVVLNNV-----------DLRSDSQ--------------
                                         *                                  

A0A4Q3AQI1      -----------------YYQY-----------YYYSNDY------YYHTQLENA------
A0A4P6PD26      -----------------YYYY-----------HSYYSDY------YHSSQSEVLDESGS-
A0A1Z8SVB5      -----------------YYYSGY--YGYGYYRYKYYSKY------YSPDXA---------
A0A2V5W3Y0      -----------------YYYQ--------------YSEY------YNTPLAVEEPDDVAA
A0A432FAS4      -----------------YYYSYY------YYQNRYYASH------YKSDKPGGKDEETNS
A0A660Q3A0      -----------------YYYSTY------Y---GYYDYD------YRY------------
A0A2V5UAD5      -----------------YY-----------------------------------------
A0A258AXL1      -----------------NYYYGH------YYSRYYEPTY------YNNPKEGGEAA----
A0A2E6T1E0      -----------------YYYSYY------YYQNRYYASH------YKSDKSDSEHGKEEE
A0A2D5W0Q9      -----------------YYYSYY------YYQNRYYASY------YSNEKKLGSKKGEGA
A0A1Z9KB52      -----------------YYYSGY--YGYGYYRYKYYSKY------YSPTEDT--------
A0A2V5U7A0      -----------------YAYYRH------------YYGSDYGTVAAAENGNGGEHADVEV
A0A257LYL4      -----------------YQYYTS------------YYTY------YAPAESQSAAQLGPV
A0A4Q2XXY1      -----------------YQYYTS------------YYTY------YSPTNIEK-ARPRPA
A0A3D4CZT6      -----------------YQYYTS------------YYTY------YAPSADSDPVPTVGA
A0A4V1S9Q4      -----------------YQYYTS------------YYTY------YAPAESQIGPPVAAA
A0A355VK99      -----------------SYYGYG------------YGYQ------YGYGAKDPQQTARKR
A0A2V6N5E0      -------------------YYYQ------------YSEY------YSTPTSVPDGEAVAP
A0A2V6NH44      -------------------YYYQ------------YSEY------YNRPVAPPESAAAV-
A0A432FDF6      -----------------YYYYSG------------YYYD------YYYKSREK-------
A0A522ACN3      -----------------YYYYSG------------YYHD------YYSKNEDS-------
A0A353DCA1      -----------------YQYYTS------------YYTY------YAPSSLEETGTPQQM
A0A3C1AXQ2      -----------------YQYYTS------------YYTY------YSPDNM---------
A0A3D0IZR7      -----------------YYYYAG------------YSTQ----YGYKKRAPRAAQRSKAT
A0A520LRZ3      -----------------YQYYTS------------YYTY------YSPSNIDPNQKISSD
A0A356FSV4      -----------------Y-YYSH------------YSDKSYQDY-YINNEDDFEDQLVES
A0A3D3DET9      -----------------Y-YYYR------------YKDY------YRPYPSGGTKAAESV
A0A355SVK9      -----------------Y-YYYS------------YSDKSYSDY-YVHHDVESEQDLGKG
A0A2E5D7I3      -----------------G-YNYS------------YGSYRYGKYGYSQYGYGGYGSYGSY
A0A2V5NYE2      -----------------Y-YYYK------------YKDY------YKAYPTSPSQSAATA
A0A2V6FIP7      -----------------YYYNYY------YYQNRYYSSH------YNPRPDKPLKDKSEE
A0A353DI77      -----------------KYGYGY------------GYGH------YGDDT----------
A0A1V6GCZ3      -----------------YYYSGY------------YHDY------YYRSEEQEPVVKEGA
A0A3C1UJT2      -----------------SYYYYYSSDKDKTYSKSGYQKK------QVTNSPMEVGASAED
A0A2S7U0Z3      -----------------SNYLGY--KGHGEYGGEEYGYY------GGDK-----------
A0A5E6MKA7      -----------------YYAYHY--------------AY------RLPEEQKREQSLKAP
A0A6B3L936      -----------------SGYFGY-----RDYGEYGHDSY------YGQED----------
A0A2N8IR72      -----------------YSYYGY--------GYGYQYGY------GTKEPQQTSRKQNK-
A0A2N8IV96      -----------------YQYYTT------------YYSY------YSADGASSGENADAS
R7E1V8          -----------------YQYYTT------------YYSY------YSADGGSSGENADAS
A0A1T4WWY4      -----------------YYYYYY------------SASY------YDANW----------
A0A3D3LEQ6      -----------------YDYYYY------------SSNY------YDSNW-EEEKEEREA
A0A3D3NW23      -----------------YDYYYY------------SSNY------YDSNWEEEEKEDREA
A0A2E0R252      -----------------AYGYYY-----SYYGGGNYANY--------SDAK---------
A0A3E1EF48      -----------------AYGYYY-----GYHGGGAIDGY------VSNDSK---------
A0A2A2PVG8      -----------------AHGYYY-----SYSSGGSYSGY------SSNEK----------
A0A2E0R421      -----------------GHDYYY-----SYPGSGSYGSG------NNSDTEKIKTTRVRV
A0A2E5EJ69      -----------------YNYYYY-----------TDKKY------YGYGEDKR-------
A0A2G4I5Z5      -----------------YYYYYS------------GNKY------YGQKGVYGASTPRS-
A0A4P5QQV6      -----------------YYYYRY-------------SEY------YGSQKKDAGKKQAAR
A0A2E7ALI1      -----------------YRYGKYGYSQYGYGGYGSYGSY------GSDDDED--------
A0A178IDB9      -----------------YGYDGY-----GAYGSDYYKAY------QEEEAAAVK------
A0A290QD69      -----------------YGYDGY-----GAYKADYYKSY------QGEKAESK-------
A0A2E7VDS1      -----------------YYYAGY--YGYGYFRYKYYNKY------YGENEPQEHGKAKAG
A0A178IFJ2      -----------------AYYSGY-----GYYGSKHYSSY------YKEGQLAARSG----
A0A357FSP9      -----------------YYYSSY--------SDKAYQDY------YISQDVELEDELAGS
A0A538NJ59      -----------------YY-----------------------------------------
A0A3C1VFY9      -----------------YNYYRY-------------QDY------YSTHPGK--------
A0A522AC27      -----------------YYYYRY-------------KDY------YKPYPAKPA------
A0A2A2R174      -----------------YYYYYS------------GNKY------YGQKGVYGATSSKG-
A0A1H2DTI1      -----------------YYYYYR------------YYEY------YRPKDEVIEGAPGTP
A0A1V5L462      -----------------YYYYGR------------YKSY------RYQHKESGDSGNEEI
A0A2A2R3V9      -----------------YYYYQY-------------KEY------YNRGAKAS-------
A0A3D3LGD3      -----------------YQYYTN------------YYTY------YSPDNRPAAEGGKPK
A0A350ARX4      -----------------YYNYRH------------YDSY------HQQPDAKQKRERS--
B5JIS2          -----------------FGSLNPRLAYGGKGKYKYHNNI------KKHAKGAGRVKSKSM
A0A1H2GQN6      -----------------YYYYGA------------YADY------YNNPKNRKKKKKGSS
A0A512M3Y3      -----------------YYYYSS-----------YYPKY------YDPSYVLQHADA---
A0A4P5R5J1      -----------------YGYGNY----------YQYSAY------RENADSEPLEPLPR-
A0A4P5YK43      -----------------YYYNNY------------YHAY------YGKQAQHAATAPTPI
A0A2A2RPW6      -----------------YYYYYS------------GNKY------YGSKGVYGASSSKG-
B4D1I7          -----------------YYYYRY-------------PDY------YATAKSDQAGV----
A0A353F286      -----------------YQYYTS------------YYTY------YSPSNMEENQKPQAM
A0A354FSA6      -----------------YQYYTS------------YYTY------YSPSNMEENQKPQAM
A0A3B9GA54      -----------------YQYYTS------------YYTY------YSPSNMEENQKPQAM
A0A520LEH8      -----------------YQYYTS------------YYTY------YSPSNMEENQKPQAM
A0A6B2M0T8      -----------------YKYVDY----------GKYKSY------YPQKSEKTR------
A0A2D7B7R6      -----------------SYYYYYSSDKDKTYSKSGYQKK------QVTNSPMEVGASAED
B1ZT68          -----------------SGYEGY-----GAYGQDYYQAY------AKTSAAQ--------
W0J7C2          -----------------YGYHGY-----GTQSAAYYKAY------EEQTPA---------
A0A2E5K4P7      -----------------YYYSEY--------YTGQYKKY------YTSQGAPEVSLGETS
A0A0R2XPB1      -----------------YYYYKY-------------SEY------YTDPKNGVQSTSQQT
A0A348NQP1      -----------------YYYYKY-------------SEY------YTDPKNSEQSLSQQT
A0A357FV58      -----------------YYYYKY-------------SEY------YTDPKNSEQSLSQQT
A0A2V6F9Q9      -----------------YYYYQY-------------SEY------YNRSVAVLESEATAQ
A0A2V6NZZ3      -----------------YYYYQY-------------SEY------YNRPVAPSESEA---
A0A2V6EBU2      -----------------YYYYQY-------------SEY------YNRPVAPSESEA---
A0A2V6EY06      -----------------YYYYQY-------------SEY------YNRPVAPSESEA---
A0A2V6ME53      -----------------YYYYQY-------------SEY------YNRPIAPPESEA---
A0A538NUU0      -----------------YYYYQY-------------SEY------YNRPIAPPESEA---
A0A2V6NIJ1      -----------------YYYYQY-------------SEY------YNRPVASSESEA---
A0A2V6C292      -----------------YYYYQY-------------SEY------YNRPVTSSASDA---
A0A2V6D2X0      -----------------YYYYQY-------------S-----------------------
A0A2V5ZUK1      -----------------YYYYQY-------------SEY------YSTPS-VPETDAQPV
A0A2V5XFN9      -----------------YYYYQY-------------SEY------YSTPA-APDGEA---
A0A2V6EZC8      -----------------YYYYQY-------------SEY------YSTPA-APDGEA---
A0A2V6I7Z5      -----------------YYYYQY-------------SEY------YSTPA-APDGEA---
A0A3B9LCP2      -----------------YYYYQY-------------SEY------YNAPASAPEGET---
A0A3C0R669      -----------------YYYYQY-------------SEY------YNAPASAPEGET---
A0A2V6EID2      -----------------YYYYQY-------------AEY------YNPPASVTDDEA---
A0A2V6MHB0      -----------------YYYYQY-------------AEY------YNPPASVTDDEA---
A0A2W5YWL9      -----------------YYYYQY-------------SEY------YNTPAEPAE------
A0A2V5NH62      -----------------YYYYQY-------------SEY------YNTPVPVEEHDD---
A0A2W6A620      -----------------YYYYQY-------------SEY------YNTPVPVEEHDE---
A0A2V5PIJ4      -----------------YYYYQY-------------AEY------YNTPEPVDERAA---
A0A2V6K2G8      -----------------YYYYQY-------------SEY------YSTPT-VPDAET---
A0A2V5W206      -----------------YYYYQY-------------SEY------YSTPTSVPDGEA---
A0A2V6MW77      -----------------YYYYQY-------------SEY------YSTPTSVPDGEA---
A0A2G4GZN8      -----------------AYTDTY-------DS--SYRKY------YVDEPR---------
A0A348NPT1      -----------------YYYSSY-------SD-KAYQDY------YISQDV---------
A0A2E1KV60      -----------------YYYSQY-------SS-EKYSQY------YLQDSYL-DLNESNA
A0A2D7F4D9      -----------------YYYSQY-------SANKKYSAY------YMQESYLGNMDESEA
A0A3R7RBR8      -----------------YYYSQY-------SANKKYSAY------YMQESYLGNMDESEA
A0A2E0NH28      -----------------YYYSHY-------SD-KSYQDY------YIN------------
A0A350AS32      -----------------YYYSHY-------SD-KAYQDY------YIH------------
A0A368BGT4      -----------------YYYSNY-------SD-KAYKNY------YTNRGEELDQGEELV
A0A2E0V4K6      -----------------YRTGRYGYRQYGYGGYGSYGAY------GSDDEED--------
A0A2E6NAH3      -----------------YYYSNY--------SDKAYQDY------YINQEEELEEELVGD
A0A2A5VZA5      -----------------YYYSQY--------TDKAYQDY------YIGQEDEMEDELAAS
A0A424R295      -----------------YYYSQY--------TDKAYQDY------YIGQEDEMEDELAAS
B4CZV9          -----------------YYQYYY-----------YSHDY------YYQHAIEST------
A0A290QE54      -----------------YSNYRY---------YRSYKKY------YGTQT----------
A0A1H1SWX2      -----------------YSNYRY---------YRSYKKY------YGSQS----------
A0A4Q1C9I5      -----------------YSNYRY---------YRSYKKY------YGSQS----------
A0A3B9FM17      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKSDAEEKRKKKQA
A0A1G3ZL71      -----------------YTNYRY---------YRSYKKY------YGTQG----------
A0A556QP09      -----------------YSNYRY---------YRSYKKY------YGTQD----------
A0A2T6DX88      -----------------YSNYRY---------YRSYKKY------YGTQA----------
A0A2T6CWI7      -----------------YSNYRY---------YRSYKKY------YGAQT----------
A0A3E1E5C8      -----------------YSNYRY---------YRSYKKY------YGTQS----------
B1ZZ74          -----------------YSNYRY---------YRSYKKY------YGSQS----------
R7E4L8          ---------------------NF-----KNSRFHYYDEY------SETDG----------
A0A4Q3BVY2      -----------------YYNYYY-----------YSAPY------YDQMESEEEPAAMVQ
A0A4P6PCA7      -----------------YSLAGKFSGAEGYGYGHSYKSY------VSDTAETAN------
A0A0E3YV65      -----------------AYYSSY-----GHYGSKYAADY------IREEKA---------
W0J900          -----------------GYYSGY-----GYYGSRYYASY------YKEEQLAGQSG----
A0A2T6DSN5      -----------------YGYDGY-----GSYESDYYKSY------QSEKVSS--------
A0A2V2SMX4      -----------------YYYSKY---------SEYYRTY------PGKG-----------
A0A317ZIW7      -----------------YYYYRY-------------SEY------YTSTQKPEDSVKSVG
A0A2D7WMI4      -----------------YYYSGY--YGYGYYRYKYYNKY------YGKNQDS--------
A0A2D6VHX5      -----------------YYYSGY--YGYGYYRYKYYSKY------YSPTEDT--------
A0A2D8I214      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKEKKSEA------
A0A1Z8VL41      -----------------YYYSGY--YGYGYFRYKYYNKY------YGSEKDTSTKIEV--
A0A2E6TNA4      -----------------YYYSGY--YGYGYFRYKYYYKY------YGSEKDTSSKIEA--
A0A1Z8RG47      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKEKDEKAPVEKLT
A0A1Z8RJJ5      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKEKDEKAPVEKLT
A0A2D7V631      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKDKDEKPPVEKLT
A0A354RA24      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKDKDEKPPVEKLT
A0A2E9RV62      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKQGAEKAQ----G
A0A2E4AY96      -----------------YYYSGYYGYGYGYYRYKYYNKY------YGGSKSNTG------
A0A3B9B9P4      -----------------YYYSGYYGYGYGYYRYKYYNKY------YGGSKSNTG------
A0A2D5Y6N6      -----------------YYYSGY--YGYGYFRYKYYNKY------YGRERDDEPSSPTVQ
A0A2E7HSS8      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKSDAEEKR----K
A0A2D8VCK3      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKSDAEEKR----K
A0A350QVY4      -----------------YYYSGY--YGYGYFRYKYYNKY------YGKPDAEEKR----K
A0A2E4ZYR7      -----------------YYYAGY--YGYGYFRYKYYNKY------YGGRGEDEKA----E
A0A2E6TCV1      -----------------YYYAGY--YGYGYFRYKYYNKY------YGGKEGAESE----L
A0A3D4HHL8      ---------------------YY------YHR---YGEY------YTRREEPSPKVSKKM
A0A366HV03      -----------------YYY-YY------YSSSYYYQAF------EEDDVAGRSAPVSA-
A0A6G6K911      -----------------YYY-YY------YSSSYYYQAF------EEDDMPGRSAPASA-
A0A5R8KAF2      -----------------YYNYYY------YSA-----SY------YEDLEGVGAGGKAVV
A0A2V2SDN0      -----------------FEY-HH------YQR---YKDD------YRWQPNVTTAA----
A0A1V6GL40      -----------------SED-YY------YYR---YKDY------YRPYPSGGTKTAESA
A0A2V5X6Z6      -----------------CER-QY------YQR---YRRA------YRWEPQKSGRV-ALA
A0A2V5VGZ7      -----------------YEH-DY------YQR---YRRA------YHWEPKETRCATALA
A0A2V5U130      -----------------YGH-DY------YQR---YRRA------YRWEPKETRRATALA
A0A2V6C237      -----------------YEH-DY------YQR---YRRA------YHWEPKETRCATALA
A0A3R8L982      -----------------YSNYRY------YRS---YKKY------YGPRAA---------
A0A2E7HPU9      GYGGYGGYGGYGQYGGGYGS-GS------YGS---YGSY------GADEEEDD-------
A0A388PR45      -----------------YTD-TY------DPS---AGKY------YVGESGAGPKA----
A0A388QR61      -----------------YTD-TY------DPT---AGKY------YASDAGGPPSP----
A0A4P5YHI0      -----------------YTD-TY------DPT---AGKY------YASDAGGPPSP----
A0A2A2RS01      -----------------YTD-SY------DPA---NKKY------YIDSEGSDSSG----
A0A2A2Y1A7      -----------------YTD-SY------DPA---NKKY------YIDSEGSDSSG----
A0A388PDH9      -----------------YTD-SY------DPA---NKKY------YIDAQDSDSSS----
A0A2G4H1E7      -----------------YTD-SY------DSS---YRKY------YVDERGASSSPGPPK
A0A2G4GZA6      -----------------YTD-TY------DSS---YRKY------YVDETRSQAGADSTK
A0A388P514      -----------------YTD-TY------DSS---YRKY------YVDEPRGQSDAGSAK
A0A2A2YG59      -----------------YTD-TY------DSS---YRKY------YVDEPRGQSGAGSEK
A0A2G4F7D5      -----------------YTD-TY------DSS---YRKY------YVDEPRGQSGAGSEK
D5EML0          -----------------Y---GY------EKDPEKYKAY------YRRSRSA--------
A0A3C1C1M3      -----------------Y---HS------YGP---YYHY------QKHYGAY--------
A0A2E9EYJ1      -----------------Y---QY------YTS---YYTY------YAPRNLDPDMESGSI
A0A258AXR6      -----------------Y---QY------YTS---YYTY------YSPTNSPNGGTGGKS
A0A3D3NZQ6      -----------------Y---QY------YTN---YYTY------YSPDNRP-AAEGGKP
A0A1T4WVZ9      -----------------Y---QY------YTS---YYTY------YSPNNTA-APAGTRP
A0A4R7SSI6      -----------------Y---QY------YTS---YYTY------YSPNNTA-APAGHKP
                                                                            

A0A4Q3AQI1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      AHRHHQPRQIQSS-----------------------------------------------
A0A432FAS4      KKPEKESSAA--------------------------------------------------
A0A660Q3A0      --PSGETGSA--------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      FDSKKTKKKAV-------------------------------------------------
A0A2D5W0Q9      KDGELVQGGKAGKDDEPSKA----------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2V5U7A0      LMAHDSFEKDPWPKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARNRFP
A0A257LYL4      APQGSAVAPAPRS--QPAAKGDSELY----------------------------------
A0A4Q2XXY1      ASASTPATAGSRSGGKSSPKDDKDDY----------------------------------
A0A3D4CZT6      TASATSGSALESKVVANDSEEDEGLTY---------------------------------
A0A4V1S9Q4      TSSSPAKPQAQSPSRGNDSE-----LY---------------------------------
A0A355VK99      D-----------------------------------------------------------
A0A2V6N5E0      VRRQRPKPIETT------------------------------------------------
A0A2V6NH44      --QHRTGQAQSS------------------------------------------------
A0A432FDF6      -EESADEAQDGKK-----DAKLLAKADIGGEDEKPKY-----------------------
A0A522ACN3      -MTEGEHKGDAKK---------------AKVEIKPKY-----------------------
A0A353DCA1      TAAPASSKTEEKK--------------SERSSSEDLY-----------------------
A0A3C1AXQ2      -AAPADKKPERRKKPTPAGQPSPGAAASSNAPRGDLF-----------------------
A0A3D0IZR7      ATVAAVEIPAATPAASVDEVVEHPLDTPEASAPKVTFIRPPRGQDRF-------------
A0A520LRZ3      KPKAPQSEESKSSSEEVSIEDKF-------------------------------------
A0A356FSV4      TASGDEDTSEIARET---------------------------------------------
A0A3D3DET9      RTEQT-------------------------------------------------------
A0A355SVK9      ALKPELQGKS--------------------------------------------------
A0A2E5D7I3      GSDDXED-----------------------------------------------------
A0A2V5NYE2      SPKREQAHRA--------------------------------------------------
A0A2V6FIP7      VKKAG-------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ESGGKDKLDIKQKY----------------------------------------------
A0A3C1UJT2      EPVKS-------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      SQPS--------------------------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      SMKKVERSGKAKELAATQSHDSEDLY----------------------------------
R7E1V8          SMKKAERSGKAKELAATQSHDSEDLY----------------------------------
A0A1T4WWY4      DVKPAKKET---------------------------------------------------
A0A3D3LEQ6      DERPGRKKRRGSSQSA--------------------------------------------
A0A3D3NW23      DERPGRKKRRGSSQAA--------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      PLFQNILNLGSKMKDHDFFSKKQKRPRRRNRRRPSRR-----------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      A-----------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      ------------------------------------------------------------
A0A290QD69      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      ------------------------------------------------------------
A0A357FSP9      VEPEMEPRA---------------------------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A522AC27      ------------------------------------------------------------
A0A2A2R174      ------------------------------------------------------------
A0A1H2DTI1      RRGKDGSKL---------------------------------------------------
A0A1V5L462      RKKTGRLSPKEK------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3D3LGD3      KRRKAAGETAPARTPGGDLF----------------------------------------
A0A350ARX4      ------------------------------------------------------------
B5JIS2          VGKLMAEDVEDDDNLEAVEANGKVAETAKSKLKSTPLKLNNKNSGSKSLIGKLMSEQEKK
A0A1H2GQN6      LQPRPAPPLPPGTTPPPTPPSQPDEF----------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      PAAVHRATPPNRPITLAVATAVPPKSAQDFKLRRATQRKANLTLPGATAARPARDVTVTR
A0A2A2RPW6      ------------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      TARKSSKSEPKGSSSSDTSNDDLY------------------------------------
A0A354FSA6      TARKSSKSEPKGSSSSDTSNDDLY------------------------------------
A0A3B9GA54      TARKSSKSEPKSSSVSDTSNDDLY------------------------------------
A0A520LEH8      TARKSSKSEPKGSSSSDTSNDDLY------------------------------------
A0A6B2M0T8      ------------------------------------------------------------
A0A2D7B7R6      EPVKS-------------------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
A0A2E5K4P7      NSHPKPARKMNLEQGSEAQA----------------------------------------
A0A0R2XPB1      TASS--------------------------------------------------------
A0A348NQP1      TA----------------------------------------------------------
A0A357FV58      TA----------------------------------------------------------
A0A2V6F9Q9      RQPTR-------------------------------------------------------
A0A2V6NZZ3      ---IA-QRSSG-------------------------------------------------
A0A2V6EBU2      ---IA-QRSSG-------------------------------------------------
A0A2V6EY06      ---IA-QRSSG-------------------------------------------------
A0A2V6ME53      ---TA-QHSSG-------------------------------------------------
A0A538NUU0      ---TA-QHSSG-------------------------------------------------
A0A2V6NIJ1      ---TT-QHHPTSQAQSS-------------------------------------------
A0A2V6C292      ---IA-Q-HSSDQAQSF-------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      APPVR-RQRPRPIETQI-------------------------------------------
A0A2V5XFN9      VTSVG-REHPKPIETA--------------------------------------------
A0A2V6EZC8      VTPVG-REHPKPIETA--------------------------------------------
A0A2V6I7Z5      VTPVG-REHPKPIETA--------------------------------------------
A0A3B9LCP2      VAAPH-REQAKPVETS--------------------------------------------
A0A3C0R669      VAAPH-REQAKHVQTS--------------------------------------------
A0A2V6EID2      LTAPP-PREPAKQPS---------------------------------------------
A0A2V6MHB0      LTAPP-PREPAKQPS---------------------------------------------
A0A2W5YWL9      ------RPATHQVQPS--------------------------------------------
A0A2V5NH62      VAAAHRHHQPRQIQSS--------------------------------------------
A0A2W6A620      VAATTLHPQPKQIQSS--------------------------------------------
A0A2V5PIJ4      PAALH-HREPKQIQSS--------------------------------------------
A0A2V6K2G8      VTPVR-RERPKPIETA--------------------------------------------
A0A2V5W206      VAPVR-RQRPKPIETT--------------------------------------------
A0A2V6MW77      VAPVR-RQRSKPMETT--------------------------------------------
A0A2G4GZN8      ------------------------GATDSDSAKS--------------------------
A0A348NPT1      ----------ELEDELAGSVEPEMEPRA--------------------------------
A0A2E1KV60      TKSLDSSTANDQSAGVDTAVAESDTNTDTDKLDS--------------------------
A0A2D7F4D9      EES-------NQAIVADTFTETKTDSDSEDKLDS--------------------------
A0A3R7RBR8      EES-------NQAIVADTFTETKTDSDSEDKLDS--------------------------
A0A2E0NH28      NED-------DFEDQLVESTASGDEDTSEIARET--------------------------
A0A350AS32      NDE-------EFEEELAGSVEPTVDSKS--------------------------------
A0A368BGT4      QGE-------ELEDELVGDIETELESKS--------------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A2E6NAH3      IETELESKS---------------------------------------------------
A0A2A5VZA5      TEPEEKVES---------------------------------------------------
A0A424R295      TEPEEKVES---------------------------------------------------
B4CZV9          ------------------------------------------------------------
A0A290QE54      ------------------------------------------------------------
A0A1H1SWX2      ------------------------------------------------------------
A0A4Q1C9I5      ------------------------------------------------------------
A0A3B9FM17      VS----------------------------------------------------------
A0A1G3ZL71      ------------------------------------------------------------
A0A556QP09      ------------------------------------------------------------
A0A2T6DX88      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A3E1E5C8      ------------------------------------------------------------
B1ZZ74          ------------------------------------------------------------
R7E4L8          ------------------------------------------------------------
A0A4Q3BVY2      TRS---------------------------------------------------------
A0A4P6PCA7      ------------------------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------------------------------------
A0A2T6DSN5      ------------------------------------------------------------
A0A2V2SMX4      ------------------------------------------------------------
A0A317ZIW7      GV----------------------------------------------------------
A0A2D7WMI4      ------------------------------------------------------------
A0A2D6VHX5      ------------------------------------------------------------
A0A2D8I214      ------------------------------------------------------------
A0A1Z8VL41      ------------------------------------------------------------
A0A2E6TNA4      ------------------------------------------------------------
A0A1Z8RG47      S-----------------------------------------------------------
A0A1Z8RJJ5      S-----------------------------------------------------------
A0A2D7V631      T-----------------------------------------------------------
A0A354RA24      T-----------------------------------------------------------
A0A2E9RV62      KNAKLS------------------------------------------------------
A0A2E4AY96      ------------------------------------------------------------
A0A3B9B9P4      ------------------------------------------------------------
A0A2D5Y6N6      GKESVS------------------------------------------------------
A0A2E7HSS8      SVSS--------------------------------------------------------
A0A2D8VCK3      KKQAVS------------------------------------------------------
A0A350QVY4      NKQAVS------------------------------------------------------
A0A2E4ZYR7      KKAQAS------------------------------------------------------
A0A2E6TCV1      PREKAS------------------------------------------------------
A0A3D4HHL8      QAVSKT------------------------------------------------------
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A5R8KAF2      ------------------------------------------------------------
A0A2V2SDN0      ------------------------------------------------------------
A0A1V6GL40      RTGQA-------------------------------------------------------
A0A2V5X6Z6      GNLSPNTTDR--------------------------------------------------
A0A2V5VGZ7      GHSAPDATDG--------------------------------------------------
A0A2V5U130      GHSAPDATGG--------------------------------------------------
A0A2V6C237      GHSAPDATDG--------------------------------------------------
A0A3R8L982      ------------------------------------------------------------
A0A2E7HPU9      ------------------------------------------------------------
A0A388PR45      ------------------------------------------------------------
A0A388QR61      ------------------------------------------------------------
A0A4P5YHI0      ------------------------------------------------------------
A0A2A2RS01      ------------------------------------------------------------
A0A2A2Y1A7      ------------------------------------------------------------
A0A388PDH9      ------------------------------------------------------------
A0A2G4H1E7      S-----------------------------------------------------------
A0A2G4GZA6      S-----------------------------------------------------------
A0A388P514      S-----------------------------------------------------------
A0A2A2YG59      S-----------------------------------------------------------
A0A2G4F7D5      S-----------------------------------------------------------
D5EML0          ------------------------------------------------------------
A0A3C1C1M3      ------------AQAVPPSLTPTGK-----------------------------------
A0A2E9EYJ1      GSPKPG------SKLASXDQNNLSAEDKF-------------------------------
A0A258AXR6      RRRKIKAETTATALGSSQSVSRLDGDDVF-------------------------------
A0A3D3NZQ6      KKRRK-------AAGETAPARTPGG-DLF-------------------------------
A0A1T4WVZ9      EKRKKQIPPSRPGQATVASSSAPRG-DLF-------------------------------
A0A4R7SSI6      EKRKKQVAPGQVAKAVSAPSNGSRG-DLF-------------------------------
                                                                            

A0A4Q3AQI1      -----------------------------------
A0A4P6PD26      -----------------------------------
A0A1Z8SVB5      -----------------------------------
A0A2V5W3Y0      -----------------------------------
A0A432FAS4      -----------------------------------
A0A660Q3A0      -----------------------------------
A0A2V5UAD5      -----------------------------------
A0A258AXL1      -----------------------------------
A0A2E6T1E0      -----------------------------------
A0A2D5W0Q9      -----------------------------------
A0A1Z9KB52      -----------------------------------
A0A2V5U7A0      KNRLHELFDRICEEILDDKLKNDFQQSMQEELRVL
A0A257LYL4      -----------------------------------
A0A4Q2XXY1      -----------------------------------
A0A3D4CZT6      -----------------------------------
A0A4V1S9Q4      -----------------------------------
A0A355VK99      -----------------------------------
A0A2V6N5E0      -----------------------------------
A0A2V6NH44      -----------------------------------
A0A432FDF6      -----------------------------------
A0A522ACN3      -----------------------------------
A0A353DCA1      -----------------------------------
A0A3C1AXQ2      -----------------------------------
A0A3D0IZR7      -----------------------------------
A0A520LRZ3      -----------------------------------
A0A356FSV4      -----------------------------------
A0A3D3DET9      -----------------------------------
A0A355SVK9      -----------------------------------
A0A2E5D7I3      -----------------------------------
A0A2V5NYE2      -----------------------------------
A0A2V6FIP7      -----------------------------------
A0A353DI77      -----------------------------------
A0A1V6GCZ3      -----------------------------------
A0A3C1UJT2      -----------------------------------
A0A2S7U0Z3      -----------------------------------
A0A5E6MKA7      -----------------------------------
A0A6B3L936      -----------------------------------
A0A2N8IR72      -----------------------------------
A0A2N8IV96      -----------------------------------
R7E1V8          -----------------------------------
A0A1T4WWY4      -----------------------------------
A0A3D3LEQ6      -----------------------------------
A0A3D3NW23      -----------------------------------
A0A2E0R252      -----------------------------------
A0A3E1EF48      -----------------------------------
A0A2A2PVG8      -----------------------------------
A0A2E0R421      -----------------------------------
A0A2E5EJ69      -----------------------------------
A0A2G4I5Z5      -----------------------------------
A0A4P5QQV6      -----------------------------------
A0A2E7ALI1      -----------------------------------
A0A178IDB9      -----------------------------------
A0A290QD69      -----------------------------------
A0A2E7VDS1      -----------------------------------
A0A178IFJ2      -----------------------------------
A0A357FSP9      -----------------------------------
A0A538NJ59      -----------------------------------
A0A3C1VFY9      -----------------------------------
A0A522AC27      -----------------------------------
A0A2A2R174      -----------------------------------
A0A1H2DTI1      -----------------------------------
A0A1V5L462      -----------------------------------
A0A2A2R3V9      -----------------------------------
A0A3D3LGD3      -----------------------------------
A0A350ARX4      -----------------------------------
B5JIS2          E----------------------------------
A0A1H2GQN6      -----------------------------------
A0A512M3Y3      -----------------------------------
A0A4P5R5J1      -----------------------------------
A0A4P5YK43      T----------------------------------
A0A2A2RPW6      -----------------------------------
B4D1I7          -----------------------------------
A0A353F286      -----------------------------------
A0A354FSA6      -----------------------------------
A0A3B9GA54      -----------------------------------
A0A520LEH8      -----------------------------------
A0A6B2M0T8      -----------------------------------
A0A2D7B7R6      -----------------------------------
B1ZT68          -----------------------------------
W0J7C2          -----------------------------------
A0A2E5K4P7      -----------------------------------
A0A0R2XPB1      -----------------------------------
A0A348NQP1      -----------------------------------
A0A357FV58      -----------------------------------
A0A2V6F9Q9      -----------------------------------
A0A2V6NZZ3      -----------------------------------
A0A2V6EBU2      -----------------------------------
A0A2V6EY06      -----------------------------------
A0A2V6ME53      -----------------------------------
A0A538NUU0      -----------------------------------
A0A2V6NIJ1      -----------------------------------
A0A2V6C292      -----------------------------------
A0A2V6D2X0      -----------------------------------
A0A2V5ZUK1      -----------------------------------
A0A2V5XFN9      -----------------------------------
A0A2V6EZC8      -----------------------------------
A0A2V6I7Z5      -----------------------------------
A0A3B9LCP2      -----------------------------------
A0A3C0R669      -----------------------------------
A0A2V6EID2      -----------------------------------
A0A2V6MHB0      -----------------------------------
A0A2W5YWL9      -----------------------------------
A0A2V5NH62      -----------------------------------
A0A2W6A620      -----------------------------------
A0A2V5PIJ4      -----------------------------------
A0A2V6K2G8      -----------------------------------
A0A2V5W206      -----------------------------------
A0A2V6MW77      -----------------------------------
A0A2G4GZN8      -----------------------------------
A0A348NPT1      -----------------------------------
A0A2E1KV60      -----------------------------------
A0A2D7F4D9      -----------------------------------
A0A3R7RBR8      -----------------------------------
A0A2E0NH28      -----------------------------------
A0A350AS32      -----------------------------------
A0A368BGT4      -----------------------------------
A0A2E0V4K6      -----------------------------------
A0A2E6NAH3      -----------------------------------
A0A2A5VZA5      -----------------------------------
A0A424R295      -----------------------------------
B4CZV9          -----------------------------------
A0A290QE54      -----------------------------------
A0A1H1SWX2      -----------------------------------
A0A4Q1C9I5      -----------------------------------
A0A3B9FM17      -----------------------------------
A0A1G3ZL71      -----------------------------------
A0A556QP09      -----------------------------------
A0A2T6DX88      -----------------------------------
A0A2T6CWI7      -----------------------------------
A0A3E1E5C8      -----------------------------------
B1ZZ74          -----------------------------------
R7E4L8          -----------------------------------
A0A4Q3BVY2      -----------------------------------
A0A4P6PCA7      -----------------------------------
A0A0E3YV65      -----------------------------------
W0J900          -----------------------------------
A0A2T6DSN5      -----------------------------------
A0A2V2SMX4      -----------------------------------
A0A317ZIW7      -----------------------------------
A0A2D7WMI4      -----------------------------------
A0A2D6VHX5      -----------------------------------
A0A2D8I214      -----------------------------------
A0A1Z8VL41      -----------------------------------
A0A2E6TNA4      -----------------------------------
A0A1Z8RG47      -----------------------------------
A0A1Z8RJJ5      -----------------------------------
A0A2D7V631      -----------------------------------
A0A354RA24      -----------------------------------
A0A2E9RV62      -----------------------------------
A0A2E4AY96      -----------------------------------
A0A3B9B9P4      -----------------------------------
A0A2D5Y6N6      -----------------------------------
A0A2E7HSS8      -----------------------------------
A0A2D8VCK3      -----------------------------------
A0A350QVY4      -----------------------------------
A0A2E4ZYR7      -----------------------------------
A0A2E6TCV1      -----------------------------------
A0A3D4HHL8      -----------------------------------
A0A366HV03      -----------------------------------
A0A6G6K911      -----------------------------------
A0A5R8KAF2      -----------------------------------
A0A2V2SDN0      -----------------------------------
A0A1V6GL40      -----------------------------------
A0A2V5X6Z6      -----------------------------------
A0A2V5VGZ7      -----------------------------------
A0A2V5U130      -----------------------------------
A0A2V6C237      -----------------------------------
A0A3R8L982      -----------------------------------
A0A2E7HPU9      -----------------------------------
A0A388PR45      -----------------------------------
A0A388QR61      -----------------------------------
A0A4P5YHI0      -----------------------------------
A0A2A2RS01      -----------------------------------
A0A2A2Y1A7      -----------------------------------
A0A388PDH9      -----------------------------------
A0A2G4H1E7      -----------------------------------
A0A2G4GZA6      -----------------------------------
A0A388P514      -----------------------------------
A0A2A2YG59      -----------------------------------
A0A2G4F7D5      -----------------------------------
D5EML0          -----------------------------------
A0A3C1C1M3      -----------------------------------
A0A2E9EYJ1      -----------------------------------
A0A258AXR6      -----------------------------------
A0A3D3NZQ6      -----------------------------------
A0A1T4WVZ9      -----------------------------------
A0A4R7SSI6      -----------------------------------
                                                   

© 1998-2021Legal notice