BYKdb

Dataset for cluster orphancd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

237 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A7Y4QK88      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A7V3WMH6      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A7W1HKQ4      ------------------------------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      ------------------------------------------------------------
A0A290QD69      ------------------------------------------------------------
A0A6N6ZC77      ------------------------------------------------------------
A0A832M896      ------------------------------------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A2V2SMX4      ------------------------------------------------------------
A0A522AC27      ------------------------------------------------------------
A0A6M1RFD0      ------------------------------------------------------------
A0A7C3HXH0      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      ------------------------------------------------------------
A0A178IFJ2      --------------------------------------------------------MAET
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      ------------------------------------------------------------
A0A3D3NW23      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A2A2R174      ------------------------------------------------------------
A0A1H2DTI1      ----------------------------------------------------MEPIPPSA
A0A1H1MGC9      -----------------------------------------------------MDTVPKA
A0A1V5L462      ------------------------------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      -------------------------------------------------------MILSV
B5JIS2          ---------------------------------------------------------MAH
A0A7Y1UGD7      -----------------------------------------------------------M
A0A2E5K4P7      ---------------------------MDSEPPEDSSNSSYRGYR----------YYGGY
A0A842HH73      ---------------------------MSDDKSQSGSGYGGGGYGGYGSGQGYSNYGGGY
A0A2E6NAH3      ---------------------------MKNDYIRGAPDPNSGGYGGSGYG-----YGGGN
A0A2A5VZA5      ---------------------------MKNDYIKGGGDPNSGGYG-YGYG-----YSGGS
A0A424R295      ---------------------------MKNDYIKGGGDPNSGGYG-YGYG-----YSGGS
A0A1H2GQN6      ------------------------------------------------------------
A0A858RDL7      ------------------------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      ------------------------------------------------------------
A0A2A2RPW6      ------------------------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ------------------------------------------------------------
A0A3B9GA54      ------------------------------------------------------------
A0A520LEH8      ------------------------------------------------------------
A0A6B2M0T8      ------------------------------------------------------------
A0A2D7B7R6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      ------------------------------------------------------------
A0A7V3QF58      ------------------------------------------------------------
A0A832FWF3      ------------------------------------------------------------
A0A838YJR8      ------------------------------------------------------------
A0A6N4WVA3      ------------------------------------------------------------
A0A0R2XPB1      ------------------------------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ------------------------------------------------------------
A0A2G4GZN8      -----------------MPTPDPSSDNRPPEPSREGNPGYGSYGQGYGQGYGQGYGQGYG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      -----------------------MKNDYS-DNNMGNDNSY--GNYGNYAPGNQYNQYNSY
A0A2D7F4D9      -----------------------MKNDYTGDQSNMNSNHY--GGYSNNYGNPQYYNHGSY
A0A3R7RBR8      -----------------------MKNDYTGDQSNMNSNHY--GGYSNNYGNPQYYNHGSY
A0A2E0NH28      -----------------------MKNDYVRGGPDPNTS----GRYGYSSGNYGY-NGSNY
A0A368BGT4      -----------------------MKNDYVRGAPDPNSGGYGSGGYGYGSGGYGY-GNGGY
A0A317ZP96      -----------------------MKNEYVRGAPDPNAGGYA-GGYGY--GSYGY-G-GGY
A0A350AS32      -----------------------MKNDYVRGAPDPNSGGYG-GGYGYG-GGYGY-G-GGY
A0A7W8DI01      ------------------------------------------------------------
A0A6N6PLV8      ------------------------------------------------------------
A0A290QE54      ------------------------------------------------------------
A0A1H1SWX2      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A4Q1C9I5      ------------------------------------------------------------
A0A842HCC8      ------------------------------------------------------------
A0A1G3ZL71      ------------------------------------------------------------
A0A556QP09      ------------------------------------------------------------
A0A2T6DX88      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A3E1E5C8      ------------------------------------------------------------
B1ZZ74          ------------------------------------------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A7W1VQ11      ------------------------------------------------------------
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ------------------------------------------------------------
A0A2V6EBU2      ------------------------------------------------------------
A0A2V6EY06      ------------------------------------------------------------
A0A2V6ME53      ------------------------------------------------------------
A0A538NUU0      ------------------------------------------------------------
A0A2V6NIJ1      ------------------------------------------------------------
A0A2V6C292      ------------------------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      ------------------------------------------------------------
A0A7W1MVB5      ------------------------------------------------------------
A0A7W1U7H7      ------------------------------------------------------------
A0A2V5XFN9      ------------------------------------------------------------
A0A2V6EZC8      ------------------------------------------------------------
A0A2V6I7Z5      ------------------------------------------------------------
A0A3B9LCP2      ------------------------------------------------------------
A0A3C0R669      ------------------------------------------------------------
A0A2V6EID2      ------------------------------------------------------------
A0A2V6MHB0      ------------------------------------------------------------
A0A7V9V4N8      ------------------------------------------------------------
A0A838I5D7      ------------------------------------------------------------
A0A2W5YWL9      ------------------------------------------------------------
A0A2V5NH62      ------------------------------------------------------------
A0A2W6A620      ------------------------------------------------------------
A0A2V5PIJ4      ------------------------------------------------------------
A0A2V6K2G8      ------------------------------------------------------------
A0A2V5W206      ------------------------------------------------------------
A0A2V6MW77      ------------------------------------------------------------
A0A838MZM0      ------------------------------------------------------------
A0A838DHH0      ------------------------------------------------------------
A0A838FJZ1      ------------------------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ---------------------------------------------------------MAE
B4CZV9          ------------------------------------------------------------
A0A7X1AX64      ------------------------------------------------------------
A0A3B9FM17      ------------------------------------------------------------
A0A7W7YGS1      ------------------------------------------------------------
A0A2D7WMI4      ------------------------------------------------------------
A0A2D6VHX5      ------------------------------------------------------------
A0A2D8I214      ------------------------------------------------------------
A0A1Z8VL41      ------------------------------------------------------------
A0A2E6TNA4      ------------------------------------------------------------
A0A1Z8RG47      ------------------------------------------------------------
A0A1Z8RJJ5      ------------------------------------------------------------
A0A2D7V631      ------------------------------------------------------------
A0A354RA24      ------------------------------------------------------------
A0A2E9RV62      ------------------------------------------------------------
A0A2E4AY96      ------------------------------------------------------------
A0A3B9B9P4      ------------------------------------------------------------
A0A2D5Y6N6      ------------------------------------------------------------
A0A2E7HSS8      ------------------------------------------------------------
A0A2D8VCK3      ------------------------------------------------------------
A0A350QVY4      ------------------------------------------------------------
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ------------------------------------------------------------
R7E4L8          ------------------------------------------------------------
A0A4P6PCA7      -------------------------MFSGNEPPPVYGASHTPPPVDPANPYGAAHQP---
A0A2T6DSN5      -----------------------------MAKASKTTPSKRNEAQSPTKGFNFSPRS---
A0A317ZIW7      -----------------------------------MSDLFNDDNQAGKVDY---------
A0A7C4PPT4      ------------------------------------------------------------
A0A7C4QZX4      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      ----------------------------------MTAPPTKSPRYDDVEPKIEWSEL---
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A832HT83      ------------------------------------------------------------
A0A5R8KAF2      ----------------------------------------MDTTKKKFDFAAAVGNA---
A0A7C4LRZ6      ---------------------------------------MSEPANANAKTVVSFDTP---
A0A351MR11      ------------------------------MPSSYILRQRDDGNTSYSGGYGGYGGY---
A0A388PR45      ----------------------------MDTPSPKPGQPPEDPSRG-PRGYGSYGSY---
A0A388QR61      ----------------------------MDAPAPKPGQPQDDAQRG-PRGYGSYGNY---
A0A4P5YHI0      ----------------------------MDAPAPKPGQPQDDAQRG-PRGYGSYGNY---
A0A2A2RS01      ---------------------------MAEKTQKPEDDQDDSAARG--RGYGSYGNYGNY
A0A2A2Y1A7      ---------------------------MAEKTQKPEDDQDDSAARG--RGYGSYGNYGNY
A0A388PDH9      ---------------------------MAETPQKPEDNQDDSASRA--RGYGSYGNY---
A0A2G4H1E7      ----------------------------MANPEPSSDNRPPEPARGGNRGYGSYGSY---
A0A2G4GZA6      ----------------------------MPNPDPLSDNRPPEPARGGNRGYGSYGSY---
A0A388P514      ----------------------------MATPEPSSDNRPPEPARGGNRGYGSYGSY---
A0A2A2YG59      ----------------------------MATPEPSSDNRPPEPARGGNRGYGSYGSY---
A0A2G4F7D5      ----------------------------MATPEPSSDNRPPEPARGGNRGYGSYGSY---
A0A7V4IDX4      --------------------------------------------MNDAPAPAPENRS---
A0A2V2SDN0      ---------------------------MENQNHNEPAKANNQLTTPALDLMAPPDHF---
A0A4Q3BVY2      -----------------------------------MSNSSDKPKFDPLRLI---------
A0A8A7W4D3      ------------------------------------------------------------
A0A3R8L982      -----------------------------------MPDTTNNRPPPSAKLHSGDDDL---
A0A6N6QBS9      ------------------------------------MKYPYSSHNTPLPGY--GTSM---
A0A2V5X6Z6      ------------------------------------MNNNNHPNAAAVDLFAPADRF---
A0A2V5VGZ7      ----------------------------------MNDNNHNQPNTPAVDLFAPANRF---
A0A2V5U130      ------------------------------------MNNNNHPNAAAVDLFAPADRF---
A0A2V6C237      ------------------------------------MNNNNHPNAAAVDLFAPADRF---
A0A2E7HPU9      -----------------------------------MRRKKYYEHDEELDLL---DEE---
D5EML0          ---------------------------------------------MGKDDFT--IEA---
A0A1V6GL40      ------------------------------------------MNDQPVQSFH--DRP---
A0A7X7VL75      ------------------------------------------MNDQPVQRFH--DRP---
A0A7C4PPJ4      ------------------------------------MSNNSSPEARGVDSFD--TPL---
A0A3C1C1M3      MTQPNFPPSNLPPASGQPPGAPIYYGGGDPYSGGMPMDSGPLQSLNPMRLL---------
A0A2S7U4L6      -------------------------------MQPNNSLNTSDATLHAVDYL---------
A0A2E9EYJ1      ------------------------------------MAKQSETKLHALDYW---------
A0A258AXR6      -----------------------------------MNESGTELQKHAMDTW---------
A0A7W7YD86      -----------------------------------MNESGNELQKHAMDTW---------
A0A3D3NZQ6      -----------------------------------MSEASPDLQNHALDSW---------
A0A1T4WVZ9      -----------------------------------MRETSNELQQQALDSW---------
A0A4R7SSI6      -----------------------------------MRDTGNELQQQAIDSW---------
A0A7W8DNH5      -----------------------------------MRDTGNELQQQAMDSW---------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A258AXL1      -------------------------------------EKLALLAK---------------
A0A2V5UAD5      ------------------------------------------------------------
A0A7Y4QK88      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A7V3WMH6      ------------------------------------------------MRIAIEKDVSDV
A0A2S7U0Z3      -----------MDIDPFADDDKEYRSTGAEEPVVSNRIGISNVRQALSRWWIMLIFGVLG
A0A2E6T1E0      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A7W1HKQ4      ------------------------------------------------------------
A0A6B3L936      -------MKKEIDPFDDTLAEGDAHDEGARVSNRSAAGLLRVALE---RWWLILIFMVLG
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A2E0R252      -------------MNEVDPPQNGYGNEAPASNGKGIKDYVRWFLR---RFWIFLITCLGG
A0A3E1EF48      ------------------------------MATKTFADYLNWLKR---YAWIAVLTTITG
A0A2A2PVG8      ----------------MSRSYAPDSDANETGQSRGLQDYLRWFLR---RFWIFLIAVVGG
A0A2E0R421      --------------MIDHHQQPLEENLHSNPQARGLQDYVRWFIH---RFWILPITIVSG
A0A2E5EJ69      ---------------MDFPESHDLGQQTQVEKEFSLRDSVDVVLD---HAWLIILIFAAC
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ----------------------------------------MLLRK---YWWVVAFGVALG
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      -MSKPVQAQTRSTAHRSAARVPDQAQAGGNLAHFSPRNLLNMFLE---RWWIGLIAGAAI
A0A290QD69      -MSKSTKS---SSGKRGSSEQPQTKPAGGG---FSPKSLLNMFLE---RWWIGLIVAAAV
A0A6N6ZC77      ---MVANEFDLFDDK------PKAAGDWQDQARHYWQLAKLLLRR---YWWLPLLTLVLG
A0A832M896      -------------MQAPAPVQPQVMSSWSAAFFTRLHRYKSLLRR---RWWVLALTLSAG
A0A538NJ59      ---MTHSNLPVPASEYPLAGPMDQDANLLPSF--RIQRFFTFLLK---YWWVPVLTLALS
A0A2A2R3V9      ---------------MSSITPPPTLSSWSAAFFTKLHRYRALVKR---RWYVPLLTLSVG
A0A3C1VFY9      -------------MKEDSALTAPDRHAWGRKFFSRVQRYRNLLLR---RWWVLVVCLVLA
A0A2V2SMX4      ---------MNQPGAIETVSTTQHQHAWRARFFTRLQRLRGLLLA---KWWIPALGVALG
A0A522AC27      ------------MNE-PTPTPTHDRSSWAARFHSRVYRYKRLLKQ---RWWIPFSCVFIA
A0A6M1RFD0      ------------MNEYPQPAP-ENRSVRSARFFTVLQRWRSLLRR---HWWVLPGCALLA
A0A7C3HXH0      ------------MNEYPQPVP-ENRSVRSARFFTVLQRWRSLLRR---YWWILPGCALLA
A0A432FDF6      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      -------MSKKPNKKLDPYYGHSAGMMDRINISIHLRRYIKMLKS---RWPFVILTAILG
A0A178IFJ2      FSKKPVPAAGAWPPQSSSPFGEPPPFAGGSLPRLDIRQILLCIRE---RWIVAVSLAILV
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      -----------------MNSKTQPSGKDSKLDGSSIIRTVLAYED---YWRLMIILVLIG
A0A3D3LEQ6      -----------------MNPRQSSNSQKGKLDSSKLIRLLLQFED---YWRLMALLFALG
A0A3D3NW23      -----------------MNPRQSSKSQKGKLDSSKLIRLLLQFED---YWRLMALLFALG
A0A522ACN3      ------------------------------------------------------------
A0A2A2R174      ---------------MDQYSQTQVGDTSSDHGMSLNRELWQVLVE---KAWLIACIMAAA
A0A1H2DTI1      PGTPGGFPPPQAPSSPMTAAMSQAGGRVPGTFMSRLHRYKLLVKK---FWWILLFCTAVG
A0A1H1MGC9      EKAQGSGEAYPYTYYGTSYSGYGSPGHGDNQMQRSMQDYVLILRE---RAWYIVLVFALV
A0A1V5L462      ----------MQDDFLESSGREGGHTDLGETLRSLSHRARLLLQS---YWWILLLCLSIG
A0A3D3LGD3      ------------------------------MKIERLQDKVQVFER---------------
A0A350ARX4      WRSESLPSDPNNFSSSYDLDESSGSLDWGERLQRIYFESKRLLAI---WWWIVLLAVAIG
B5JIS2          SETKKSLRPHASAGYGASGSRNSNTEDTLAGVVTQIRSFFAIIRS---RWLSGVVSALVV
A0A7Y1UGD7      SRQQPEFSQPMRGNLRLRDDDLFDDAGGGESGGEGMLHFKDLLPRLLARWHWILLCALLG
A0A2E5K4P7      --------GYNYGGYDA-----------EPQEHRSLKDYIIIFRE---RFWLFLFCFAII
A0A842HH73      YG------GYSYGGYNYGAGGGGYGGGQQATPQRGIKDYLMILRE---RIWHFLVTFFIV
A0A2E6NAH3      YGYGGSNYGYGGGNYGF----GGGYGDGGAGPQRSFKDYLLMFRE---RIWYLIVSLFII
A0A2A5VZA5      --------GYSYGNYGY----GGYGGGGEQAPQRSIKDYILIFRE---RIWWLIVSFFII
A0A424R295      --------GYSYGNYGY----GGYGGGGEQAPQRSIKDYILIFRE---RIWWLIVSFFII
A0A1H2GQN6      ------------------------MSVSESIDLPHFNDYWRVIRA---RFGIILTLFILT
A0A858RDL7      --------MANYHAPKSAHDDGDQDSAGYDAKAQGSRGIKQAMRDVLSRWYWIVLFLILG
A0A512M3Y3      -------------------------MQKGKKLIITFQDVFLFLTRFVKHWKIASLLFSLG
A0A4P5R5J1      --------------MSLPTSQLPAGTSAINRVRVQGIRYVYLLKK---RWWVLVLLLSLG
A0A4P5YK43      -------MASSHASLELPPPNQGTSLVDRINISIHFRRYFKIISR---RWWIPFLLVLVG
A0A2A2RPW6      ---------------MQTTEDVTQQSPIGGLSSVALRDFWQALLD---KAWLVVCIMLAA
B1ZT68          ----------MPTSKKPAADRRNP--QANTGFRITPRDLLQMFQE---RWLLGLFLGAIA
W0J7C2          ----------MTTTDTTAGNRPSPGRPRAASIRRTPRDFLDMFAE---RWWIGALAGAAA
B4D1I7          ----------MDAHPAATPARDQDAASWWYLIHTKIYRYRALLRK---YWWMVLFTTCAG
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ----------------------MQGSNQTNFDSTPSIDYWQILKN---RYGVILLTFLLV
A0A3B9GA54      ----------------------MQGSNQTNFDSTPSIDYWQILKN---RYGVILLTFLLV
A0A520LEH8      ----------------------MQGSNQTNFDSTPSIDYWQILKN---RYGVILLTFLLV
A0A6B2M0T8      ---------MSNQQYESNPNSSQRNSGNSISSEKSWLDYLFVIRE---HWMLALLVALSV
A0A2D7B7R6      ------------------------------METGNTNSPQDILRSAKSHYAIVLIIIVAC
A0A353DCA1      --------------------------------------MKQMVRE---------------
A0A7C5H7K5      ----MVNGQSTLPSNYYPYPHQYPDYPRKDHFAELLGYTKRVLML---RWWILLLMMMAG
A0A7V3QF58      ----MVNGQSTLSPNYYPYPHQYPDYPRKDYLAELLGYTRRVLML---RWWILLLMVIAG
A0A832FWF3      ----MVNGQSTLSPNYYPYPHQYPDYPRKDYLAELLGYTRRVLML---RWWILLLMVIAG
A0A838YJR8      ------------------------------------------------------------
A0A6N4WVA3      ------------MDDLFQDEKHTKTVDYTELFQQIVYRTKIVLRR---YWWVIPLAVALG
A0A0R2XPB1      ------------MDDLFQDENNTKTVDYTELFQQIVYRAKIVLRR---YWWVIPLAITLG
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ------------MDDLFQDEQNTKTVDYTELFQQIVYRAKIVLRR---YWWIIPLAIALG
A0A2G4GZN8      AYGAGNYRGGNYGGGNYGYGNNPGYGKGGAGESNPIQNYLLMLKE---RYWWILLASLVF
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      RYGGGGNYGNYGNYGNYGYGSYGQN-ADEQGPQRTFKDYLFLIRE---RIWYLIIVFFII
A0A2D7F4D9      RYGGN------SGSGSYGYGSYGNV-SEEQGPQRTFKDYIFLIRE---RIWYLIIVFFII
A0A3R7RBR8      RYGGN------SGSGSYGYGSYGNV-SEEQGPQRTFKDYIFLIRE---RIWYLIIVFFII
A0A2E0NH28      GYGSYG-----SNSS-----------GYGTIAQRSISDYFLMLRE---RVWYLVVAFFII
A0A368BGT4      GYGNGG-----YGYGTGGYGGYGGGYGGGAGPQRSFKDYFLIFRE---RIWYLLVSFFII
A0A317ZP96      GYGGAG-----YGYG----GGYG---GGGGGPQRSFKDYFLMFRE---RIWYLIVAFFII
A0A350AS32      GYGG-G-----YGAG----GGYE---GGSSAPQRSFKDYLLMFRE---RVWYLIVAFFII
A0A7W8DI01      ------------------------MANQGFKRLLTFQDILQFLSRYVKYWRLGVFCATLG
A0A6N6PLV8      -------------------------MNETNEVKLHFLDYWRTIKV---RMGLILLTFFLV
A0A290QE54      -----MSDSPLNPSNASQSG-------DQLVERRTIRDYLIILRE---RLWIALPLALLV
A0A1H1SWX2      ---MSAPDAPLPTAPARAPGPSLHGNDQQVVEKRSLRDYYVILRE---RLWIALPVALLV
A0A1D8AZK8      ---MSVPDSP-PSSSAAQRAASLHGNDHQVVERRSLRDYYIILRE---RLWIALPVALLV
A0A4Q1C9I5      ---MSSPDFS-PHSASVKHGASLHGNEPHVSERRTLRDYYIMLRE---RLWIALPVAVIV
A0A842HCC8      -------------MAEFGTQQSEGDFDWSEMLHSWFFKGRIAFQR---MWWVFLLTVGLG
A0A1G3ZL71      --MPSPLAIPAAPAKPSASTRAPQGGEEHLVERRTLRDYYVIIRE---RLWIALPLALLV
A0A556QP09      ---MSSVQKPSSATKVSGR-------DEEIIERRTLRDYYIILRE---RLWIALPLALVI
A0A2T6DX88      --MNDLQAKHP--SLHTAQ-------GEVLNERRTARDYLIILRE---RVWIALPIGILV
A0A2T6CWI7      --MADANAKPPPPPPVDHD-------DETVSERRTLRDYYIMLRE---RLWIALPLALLV
A0A3E1E5C8      --MPDHTARPF--PPAHDK-------EEPAVERRSLRDYYIILRE---KLWIALPLALLV
B1ZZ74          --MSLAEAKPAVQPGGARD-------EETLVERRGLRDYYIILRE---RLWIALPLALLV
A0A2E0V4K6      ----------MSARRLAGAGRELPDEDEVLEFPGRARGLPKVFWEMLGKWYFPVMGAILG
A0A7W1VQ11      ---------------------MIPRTKKGVFTENDLMMYFALIVK---HLRLMVLLVCFS
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ---------------MNAPLERPAAAPWSTAFFTRIYRYKSLLLR---RWWILLLTICCG
A0A2V6EBU2      ---------------MNAPLERPAAAPWSTAFFTRIYRYKSLLLR---RWWILLLTICCG
A0A2V6EY06      ---------------MNAPLERPAAAPWSTAFFTRIYRYKSLLLR---RWWILLLTICCG
A0A2V6ME53      ---------------MNAPLERPAAAPWSTAFFTRIYRYKSLLLR---RWWILLLTICCG
A0A538NUU0      ---------------MNAPLERPGAAPWSTAFFTRMYRYKSLLLR---RWWILLLTICCG
A0A2V6NIJ1      ---------------MNPPPVRPAAAPWSTAFFTRLYRYKSLLLR---RWWILLLTICCG
A0A2V6C292      ---------------MNPPPERPAAAPWSTAFFTRMYRYKSLLLR---RWWILLLTICCG
A0A2V6D2X0      ---------------MNPPPERPAAAPWSTAFFTRMYRYKSLLLR---RWWILLLTICCG
A0A2V5ZUK1      -------------MQVAATRLQNLSTSWSAAFITRLHRYKSLLLR---RWWIPVLTICLG
A0A7W1MVB5      --------------MQTPALERSSPATVTTAIITRLHRYKALLLR---RWWIPVLTICLG
A0A7W1U7H7      --------------MQTPALERSTPATITTAIVTRIHRYKALLLR---RWWIPVLTTCLG
A0A2V5XFN9      --------------MPASTAAKSLSTSWSATFITRLHRYKSLFLR---RWWIPVLTICLG
A0A2V6EZC8      --------------MPASTAAKSLSTSWSATFITRLHRYKSLFLR---RWWIPVLTICLG
A0A2V6I7Z5      --------------MPASTAAKSLSTSWSATFITRLHRYKSLFLR---RWWIPVLTICLG
A0A3B9LCP2      --------------MQASAAERSTPASWSTAFITRLHRYKALLLR---RWWIPVFTVCLG
A0A3C0R669      --------------MQASAAERSTPASWSTAFITRLHRYKALLLR---RWWIPVFTVCLG
A0A2V6EID2      ------------MQAPIPAVERSTPAAWSNTLITRLHRYKALLLR---RWWIPVLTICLG
A0A2V6MHB0      ------------MQAPIPAVERSTPAAWSNTLITRLHRYKALLLR---RWWIPVLTICLG
A0A7V9V4N8      ----------MQASAPASPLDRPATGAWTSSFITRLHRYKALLLR---RWWIPLLTICLG
A0A838I5D7      ----------MQPPTP----DRPSSASWSTSFITRLHRYRALLLR---RWWIPLLTICLG
A0A2W5YWL9      ---------------MNALAERTNPGSWSTAFITRIHRYKSLLKR---RWWIPLLTICLG
A0A2V5NH62      -----------MPAPAPATTDRPVSAPWSTAFITRLHRYKALLQR---RWWIPVLTICLG
A0A2W6A620      -------------MPAPAATDRPASAPWSTAFITRLHRYKSLLQR---RWWIPVLTICLG
A0A2V5PIJ4      --------------MGNAAPDHPVSPIWTTKFVTRFHRYRALLLR---RWWILLLTVCMG
A0A2V6K2G8      --------------MQPSTAVKNLSTSWSAAFVTRLHRYKSLFLR---RWWIPVLTICLG
A0A2V5W206      --------------MQATTAGKNLSTSWSTVFITRLHRYKSLFLR---RWWIPVLTTCLG
A0A2V6MW77      --------------MQVATVGKNLSTSWSAAFITRLHRYKALFLR---RWWIPVLTTCLG
A0A838MZM0      ----------MQTSAPASPLDRPATGSWTTSFITRLHRYKALLLR---RWWIPLLTICLG
A0A838DHH0      --------------MQATTHDRPAAASWTTSFITRIHRYKALLMR---RWWIPLLTICLG
A0A838FJZ1      --------------MQSPALDRPTAASWTTSFITRIHRYKALMLR---RWWIPLLTICLG
A0A0E3YV65      ---------------------------------MSPREILLSIRE---RALTSFVLALLI
W0J900          IPFTKTGPDTGPLHPRPSAPRSEPPFEGGSLPRLDIRQILLCIRE---RWIVSTSLATLV
B4CZV9          ---------------------MIPGTKKPAFTLHDIFLYVAIASK---HARLMVLLICFA
A0A7X1AX64      MAKQEKRNSYGDGYGGYGNYGGGDYGYEVGQSHRSLSDYLILLRE---RIWYIVIIFLVV
A0A3B9FM17      ------------------------------------------------------------
A0A7W7YGS1      ----------------MNSKANNSGSKNSKLDSSVIVRVILGYEE---YWRLMLILLMNG
A0A2D7WMI4      --------------MDENEIGSLSQNPPNQKV-KGISDFLLILRD---RWMLSLTLALPI
A0A2D6VHX5      --------------MDLEENSNYGDYSPKSKKNKTVSEFLLILRD---RWLLAVTLALPF
A0A2D8I214      ------------MEEEIENLNSQGSVRSKSKT-KSIAEILLVIRD---RWLLALSLALPI
A0A1Z8VL41      ------------MDDNFEDIDRPLSTKPKGRI-RGISDFLLIIRD---RWLLALTLALPI
A0A2E6TNA4      ------------MDDNLEDIDRSLSTKPKGRV-RGISDFLLIIRD---RWLLALTLALPI
A0A1Z8RG47      ------------MDDEIDTTEIHSGGRSKSNI-KGVSDFILIIRD---RWLLALTVALPI
A0A1Z8RJJ5      ------------MDDEIDTTEIHSGGRSKSNI-KGVSDFILIIRD---RWLLALTVALPI
A0A2D7V631      ------------MDDDIDSISVNAGGKPKSRI-KGLSDFVLIIRD---RWLLSLTVALPV
A0A354RA24      ------------MDDDIDSISVNAGGKPKSRI-KGLSDFVLIIRD---RWLLSLTVALPV
A0A2E9RV62      -----------MDSYSNPDPSQEIIQPASRSRLRGVFDYFLIIRD---RWLLATALSLPI
A0A2E4AY96      ------------MDQEHPESFKN---QGDTIKVRGVSDVLLILRD---RWLISLCIALPI
A0A3B9B9P4      ------------MDQEHPESFKN---QGDTIKVRGVSDVLLILRD---RWLISLCIALPI
A0A2D5Y6N6      ------------MDDNFNKMTGDGGASPTGSKIKGIGDFILILRD---RWLIALTLSLPX
A0A2E7HSS8      ------------MEEDFDNFSTP-PQPKGKPKIKGVSDFLLIIRD---RWLLSLALSLPF
A0A2D8VCK3      ------------MEEDFDNFSSS-PVQKGKSKIKGLSDFLLIVRD---RWLLAIALSLPC
A0A350QVY4      ------------MEEDFDNFSSP-PVQKGKSKIKGLSDFLLIIRD---RWLLAIALSLPC
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ---------MNESLEELDGTSSHVPSGAPGPKLKGVIEYLLIIRD---RWLLAIALSLPI
R7E4L8          -----------------------MPVSVIQPEDNDIFSFRFIFSTARRYWPWILACALLG
A0A4P6PCA7      ----------------------APFNLKGGGGFKPMRLLFVVLR----RWYIPVIFGLIG
A0A2T6DSN5      --------------------------------------LLNMFLE---RWWIGLIAGALG
A0A317ZIW7      ----------------------------AEILHKSIYRTKIVLKR---FWWVLPVAVSLG
A0A7C4PPT4      ---------------------MLPGLKRRSINFADIVLYVAIALK---HWRLMVLLVFFA
A0A7C4QZX4      ---------------------MLSKLQKRAFSFAEVVYYLALFLK---HLRLMVLLLCLS
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      -------------------------------IHVWLFRAKLLLKR---FWWVFLITISLG
A0A366HV03      ----------------------MSAPIKKGAPGVDMLHYAVGYLK---YGRMMILLLLLG
A0A6G6K911      -----------------------------------MLHYAVGYLK---YGRMMILLLLLG
A0A832HT83      ---------------------MLPGIKKRGVNFVDLVLYLAIMLK---HFRLMVLLMCLA
A0A5R8KAF2      ----------------------------------------LSYAQ---HGRLMVIMACLG
A0A7C4LRZ6      -------------------------LMDRINIYFRFRRYFKMLAR---RWFIVLLTTGAA
A0A351MR11      -GAYGESRYGGYGS-----VPAPGYGQAAG--VNPLANYMLMLRE---RMWYLVLTVLVF
A0A388PR45      -GGY-----AGYGAPGYGNYGNYAAGGASGGKGGPFTVYLAMLRE---RWWWVLLSVLVF
A0A388QR61      -GNYGGPA-GGYGAGGYGAYGNYGAYGSSGAKASPFTVYLTLLRE---RWWWVLISILVF
A0A4P5YHI0      -GNYGGPA-GGYGAGGYGAYGNYGAYGSSGAKASPFTVYLTLLRE---RWWWVLISILVF
A0A2A2RS01      GGNYGGNYGGGYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRE---RFWWLILAVLVG
A0A2A2Y1A7      GGNYGGNYGGGYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRE---RFWWLILAVLVG
A0A388PDH9      -GNYGGAYGGGYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRE---RFWWLILAVLLG
A0A2G4H1E7      -GQYGQGY-GAYGA-GYGSYGGGPRGGAGG--ASPISNYLLMLRE---RYWWVLLTSLVF
A0A2G4GZA6      -GNYGAAN-GGYGY-GNGNYGAYNRGGAGE--GNPIQNYLLMLRE---RYWWILLSTLVF
A0A388P514      -GNYGAGN-GGYGY---GNSGAYNRGGAGE--GNPIHNYLLMLRE---RYWWVLLSTLVF
A0A2A2YG59      -GNYGAGN-GGYGY---GNYGAYNRGGAGE--GNPIHNYLLMLRE---RYWWVLLSTLVF
A0A2G4F7D5      -GNYGAGN-GGYGY---GNSGAYNRGGAGE--GNPIHNYLLMLRE---RYWWVLLSTLVF
A0A7V4IDX4      --------------------------IRTARFANHWHRFKNQLRR---RWWLLPLLVFFA
A0A2V2SDN0      --------------------------VATSRLFVRLHRHQVLLRE---YWWVLALILLVT
A0A4Q3BVY2      ----------------------------------------SQVLSYAKHVRLMLLMLAVG
A0A8A7W4D3      ------------------------------------------MLSYAKHVRLMLLMLALG
A0A3R8L982      --------------------------VERRT----LRDYYIIVRE---RLWIALPLALLA
A0A6N6QBS9      --------------------------VDRINLYLHFRRYFKILAE---RWLLVVVCTVTG
A0A2V5X6Z6      --------------------------VSASRLYGRLHRWWLLLGR---YWWVIVLILVLV
A0A2V5VGZ7      --------------------------VSASRLYGRLHRWWLLLRR---YWWLIVLILVLG
A0A2V5U130      --------------------------VSASRLYGRLHRWWLLLGR---YWWVIVLILVLV
A0A2V6C237      --------------------------VSASRLYGRLHRWWLLLGR---YWWVIVLILVLV
A0A2E7HPU9      --------------------------DGLGGGTSRRARTRQLIGDILVRWHWMALGLVLG
D5EML0          --------------------------NASTTSVFGLTDLLAVVRK---HWMSGAFIGLVV
A0A1V6GL40      --------------------------NTAARLHARLSRFRNLLRE---KWWVLVLGAMAG
A0A7X7VL75      --------------------------NTAARLHARLSRFRNLLRE---KWWVLVLGAMAG
A0A7C4PPJ4      --------------------------MDRINLYFRLRRYIKMLAR---RWFILLLTVAVG
A0A3C1C1M3      ----------------------------------------QIARN---HWVILLLA--IL
A0A2S7U4L6      ----------------------------------------QILKN---RYGIILLTFILV
A0A2E9EYJ1      ----------------------------------------QVAXN---RYAVILLTXALV
A0A258AXR6      ----------------------------------------QVVKN---RFGLIALSFLLI
A0A7W7YD86      ----------------------------------------QVIKN---RFGLISLSFLLI
A0A3D3NZQ6      ----------------------------------------RVIRG---RAGLIILSFLLV
A0A1T4WVZ9      ----------------------------------------QVIRN---RFGLIILSFLLV
A0A4R7SSI6      ----------------------------------------QVIRN---RFGLIILSFLLV
A0A7W8DNH5      ----------------------------------------QVIRN---RFGLIILSFLLV
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A258AXL1      -----YR-----------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A7Y4QK88      --------SRAGPGPHEGVHKFRPVDCGEQGS----------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A7V3WMH6      AGLGYEPRQTGWDPYWIQTEFEKIQSKTILYQVITNLNLNRRWAEKFKEENELRTDVTYG
A0A2S7U0Z3      YFAALYY-MSINPPSSEAIAVLEVNIQTGQLL--------GQDLVQERMTPDIILATEAS
A0A2E6T1E0      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A7W1HKQ4      ------------------------------------------------------------
A0A6B3L936      YVGALYY-LSVKEPETMAMASLKVTTKQQLLV-------GNEVEQDSMVFRDQMLGTIAA
A0A2N8IR72      --------------------------------------------------MTDAWNGKAV
A0A2N8IV96      --------------------------------------------MVATSNVTANYIPMQY
R7E1V8          --------------------------------------------MVASSNVTANYIPMQY
A0A2E0R252      YFLGLYV-ASLTPVTYQSQATIEIERVKKEDA-------DVDEEERIRMGGASEMFSVTE
A0A3E1EF48      TFYGFYL-FTITPKTYQSWTSIQIARVKQEAA-------DVAEEERIRLGVPAELQATLE
A0A2A2PVG8      YFLGLYL-YSVTPPTYQSSATIEILRVKRDAA-------DIAEEEKIRMTGAAEMLSASE
A0A2E0R421      ILIGHYV-YTHTPHTYQSSATIEVLRIKKDDA-------DVDEDEVLRMNGVAEMMSASE
A0A2E5EJ69      FGGAYYY-LKTATVIYESRATIIVEFAGPTVSYDQNSRNDFRLMRFDILNTMAQTVGRRE
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      TGIAAWL-VASQKQIYMSQARMMVSGKINLPE------------GGSFSEEMTHFMNTQG
A0A2E7ALI1      -----------PPASYLPDWITGFLNRGKRAL------PETGSNTSNHQKKLVSLLKNRC
A0A178IDB9      ATVFILA-QPKLAPVYRSEVKLLFEPQKDQVI-------GIKEVVDTTTTSNLQLNLHIE
A0A290QD69      AAAFVLS-QPKPEPIYKTEVKLLFENQKDNVI-------GMAGVVETTTNSGMQLQLHIE
A0A6N6ZC77      ASWRGWQ-AQNDRPTYRWGAKIMLSGFVAQQL------------NTGVQEQFSYWFGNQR
A0A832M896      LLWQAWT-LATAAPVFISAGQMMVAPRVNIPE------------SGV-MEEGAQFYGTQI
A0A538NJ59      LGGAIWY-FFWEPPTYVSKSRMWETVTLRLPE------------GAMFSEDMQNFLGTQS
A0A2A2R3V9      LCIQAYR-FAQIQPTYISSGKLIVSPRMFLPE------------NAVVSDESVNFIGTQL
A0A3C1VFY9      LGIEAVH-IQFTPPEFISVGQMIVSIKVNIQQ------------GSLYTEELGNFLGTQA
A0A2V2SMX4      VGIQASR-SITEKPSYVSTGRMIVSMKLSIPE------------GQLYTEEMGNFLGTQA
A0A522AC27      LVIQGAL-SWFAPQRFISIGRMIVSIKLSIQE------------TSVYTEELSNFLGTQQ
A0A6M1RFD0      MAVHLIV-VWNSPPAYASRGKMIVNVRIQVQT------------GANYIEELSNFLGTQV
A0A7C3HXH0      MAVHLLI-LWNSPPAYASQGRMIVNVKIQVQT------------GANYIEEFSNFLGTQV
A0A432FDF6      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      TAYMGFK-AFGDKTFFQGKSIIGITSKIRIPG----------EKRVEYLKPAPTYWTDLS
A0A178IFJ2      CVLLGVW-LLNQPKVFQASATLLVDRAEKVLG---NEMTKVVDDSVGGSKNDPSFDTHLA
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      LLGGTCY-FIYARATYESQALIRANSFLMSSE-AAVGNANADRTYRQMRALMDQLNSGYV
A0A3D3LEQ6      LLSGAGY-FVYARATFESTALIRINQFVDAAK-AASG-AQRDNNIALMRSLSKQLTSDFY
A0A3D3NW23      LLSGAGY-FVYARATFESTALIRINQFVDAAK-AASG-AQRDNNIALMRSLSKQLTSDFY
A0A522ACN3      ------------------------------------------------------------
A0A2A2R174      AAIGVWV-GVRSPVVYQSKAVIELDFGEKKVL-------AIDDFEKRDKGGGVDFLNTIA
A0A1H2DTI1      IAIQAYK-IAHEVPNYASTARLMINTKINVTE------------SSVSTTEVGNYMETQI
A0A1H1MGC9      FSAATIF-TFTRVPQYQSVASVQVFRRDPVVM-------QVQGVVDNEIRSAEDLNTQVK
A0A1V5L462      LLVQAVR-VKSMRDAWESSAQLIIQGNIEIQE------------ADRLREVATNFHDNQL
A0A3D3LGD3      -----------SSDNFMANSDVVVKNEFESII------------------KPETLYPVVD
A0A350ARX4      IGWQAYR-ELNREPVYVSYAEMMVSGRFALPD-------------NVYREELSNFFGTQI
B5JIS2          GSAFAYL-FLNDKPEHTAVSTMLAQSPLDELL------HSDQQARERKKDAQENFLQNHL
A0A7Y1UGD7      LGWGLYT-VWRAVPLYQSRATVLVRDYNVTAM--------------------GQLDSAEF
A0A2E5K4P7      ITGVLLY-TLKKPKEYKSVAELRMERFGNTPI---DT---GNEKNQDNIGSHEDFNTWAN
A0A842HH73      FVGTLLY-TLNTTDIYYSQAQVQLLRDAPNVL---G----KMDIEENRILGVDDFMTQVG
A0A2E6NAH3      FSGSILY-TFNKTKVYTAASQVQLFRDDASAL---GAIGQGMEMEQNQILSAEDLNTQIS
A0A2A5VZA5      FSGSLLY-TFNKTKVYTSVAVVRLLRDDPSAM---GV---SVELAQNQIVGAEDLNTQIS
A0A424R295      FSGXLLY-TFNKTKVYTSVAVVRLLRDDPSAM---GV---SVELAQNQIVGAEDLNTQIS
A0A1H2GQN6      FGTGYFVSAFVLQKQYGGTVDIRVFKQDKDVQ--------VFSQSDRNAFDPIFFESERS
A0A858RDL7      VLGSHYY-LSKKPKVYTATCTLLVKHTVASVL-------SRGQAEEVNMSGSEGMNTVAE
A0A512M3Y3      LAASLLY-YTYGRPTYYSRSLVAYDSVNLPIK------SETSDGSDGRGKWAHISNVLTS
A0A4P5R5J1      LCIGAWT-AMQQPPAFRSSGRMMVAGQLRLGD-----------NAAAYSEELMNFFGTQI
A0A4P5YK43      TGIALYV-ALTTPNKYRAYSTLGFTSRVETGV----------GGKAQVVELADGFVEHQL
A0A2A2RPW6      AALGVWH-GARSPVVYQSKAVLYFDSGEVNVI-------NIQEVEKREKAGIDLLNSIAN
B1ZT68          AGVFVYF-QPEKVPLYYSEVSLLFETRKDRVL-------NIQDVVDTGVRSTTELNVHAE
W0J7C2          AALIVVF-RPHFEPIYRTEVSLLFEARKDRVL-------NIQEVVDTTLQTAAELNTHIE
B4D1I7          MAIGAWM-LAHQQVVYVSTGRIMASGKINLPE------------GVTYTEEMNLFISTQR
A0A353F286      ----------MIPEKYESTSVVQVHPSTIAITPFRGQSAVNPGSQMTAQYLQNEFESIIA
A0A354FSA6      FITAAVI-TSVIPEKYESTSVVQVHPSTIAITPFRGQSAVNPGSQMTAQYLQNEFESIIA
A0A3B9GA54      FITAAVI-TSVIPEKYESTSVVQVHPSTIAITPFRGQSAVNPGSQMTAQYLQNEFESIIA
A0A520LEH8      FITAAVI-TSVIPEKYESTSVVQVHPSTIAITPFRGQSAVNPGSQMTAQYLQNEFESIIA
A0A6B2M0T8      SGFYAYK-KLQTVPLYKSVAILLFELQQDKVI-----NIQQVVDNSLGRSADFILRNHLT
A0A2D7B7R6      TFTAYMQ-TRKMTAHYRSTALLVVDTQQFVES---------DADASNDVRDLDILTTLVG
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      CLGGVAF-VYLSPPKYVSEGRMIVNVKLTIPE------------GSAYSEELGNFLGTQA
A0A7V3QF58      CLGGVAF-VYLSPPKYVSEGRMIVNVKLTIPE------------GSAYSEELGNFLGTQA
A0A832FWF3      CLGGVAF-VYLSPPKYVSEGRMIVNVKLTIPE------------GSAYSEELGNFLGTQA
A0A838YJR8      ------------------------------------------------------------
A0A6N4WVA3      VCAKAVQ-SHFKEPFYLSKAQMIVSGRIDLPE------------NDVYAEERDNFFGTQI
A0A0R2XPB1      VSYKAVE-SFVADPFYKSTSQMIVSGRIALPE------------NDMYAEERDNFIGTQI
A0A348NQP1      ----------------------------------------------MYAEERDNFIGTQI
A0A357FV58      VTYKAVE-SFVADPFYKSTAQMIVSGRIALPE------------NDMYAEERDNFIGTQI
A0A2G4GZN8      LTLSLLN-TYNVVPEYRATGRLRVFRLSPNIN---GGS--SAADDNFKIVSNDDFFTAIE
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      FLGSILY-TFNKTKLYTAYSTIELLRDDPTVM---LSS--SGNLEQNEIRTAEDLNTHIS
A0A2D7F4D9      FLGSILY-TFNKTKLYTAYATIELLRDDPTVM----NS--ASNLEQNEIRSSEDLNTHIS
A0A3R7RBR8      FLGSILY-TFNKTKLYTAYATIELLRDDPTVM----NS--ASNLEQNEIRSSEDLNTHIS
A0A2E0NH28      FSGSILY-TFNKTKVYTAYVSVQLLRDDPSAM---RDE---TEMEPNQILSAEDLNTQIS
A0A368BGT4      FSGTIMY-TFNKTKVYTAVSQVQLFRDDASAL---GAYGQGAEMELNQILGAEDFNTQII
A0A317ZP96      FSGSILY-TFNKTKVYTSAATVQLLRDDPSAL---GDT---VEMEQNQIRSAEDLNTQIS
A0A350AS32      FSGSILY-TFNKTKVYTAVAQVQLLRDDPSAM---GNI-PGMEMEPNQIRSAEDLNTQIS
A0A7W8DI01      ASLALAY-FVYGKPSYYSKSSVEYSYVDLPIKSEISDVRGNTKWDNIHSQVVLGLQSRWL
A0A6N6PLV8      MVTAGVT-TYFLPRQYLSKVRMEVK--------QDNSGPVSAFGGNTGKTFDPQFVATQF
A0A290QE54      AVGFGYW-KARAVPMYQARATMQIEKPEKIVT--------SQEIVDISINSDIELNTYLQ
A0A1H1SWX2      ALSIGYY-QAQEIPMYSSTATMQFERPERVVQ--------NEQVVDTAVRSEVDLGTYLQ
A0A1D8AZK8      SLSVGYY-KAQETPMYSSVATMQFERPERVVQ--------NEQVVDTSVRSDVDLNTYIQ
A0A4Q1C9I5      ALGFGYV-KSTETKMYASTATMQFERPERVVL--------NEQVVDTSIRHDVDLNTYLQ
A0A842HCC8      VSFQAYK-GWQQKPVYQSRAKMIVDGQIVLTD----------KSAAQYSEVYANFYGTQV
A0A1G3ZL71      SLGLGYW-KMRETPMYESRATLQFEREERVMN--------QQKVVELAPQSEVDINTYVH
A0A556QP09      SIGMAYY-QSRATPLYRSAATLQIEKPEKVVT--------TVDVVDTGINSDIELNTYLQ
A0A2T6DX88      GVILGYL-QARVTPLYQSQATMQIEKPEKIVT--------SQEVVDLSVTNDIDLNTYLQ
A0A2T6CWI7      AVGYAYK-NLQETPRYAATARMQFEKPDRIVM--------AEGVVDTAVRSEVDMNTHTE
A0A3E1E5C8      SLSLGYY-EASRPKMYAATATMQFEKADTVVT--------TQGVVDPSVRSELELRSNLE
B1ZZ74          AVPLGYF-RARETPLYAAMATMQFEKPETVVT--------SQVVVDPSVRSDIELNTNIQ
A0A2E0V4K6      LFASAYY-LKKTPERFASTATLLVKQNLSGVI-------SSEEVEDLDLRSDNVMNTIAA
A0A7W1VQ11      LLLGLTY-YTYARPLYYAVSEISYDSLSRTVD------------------TQLAFKDSRE
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      LFVEAWL-IFQTPPSFQSTSKMMLAGKLNINQ------------GPVYSEDNVNFYGTQI
A0A2V6EBU2      LFVEAWL-IFQTPPSFQSTSKMMLAGKLNINQ------------GPVYSEDNVNFYGTQI
A0A2V6EY06      LFVEAWL-IFQTPPSFQSTSKMMLAGKLNINQ------------GPVYSEDNVNFYGTQI
A0A2V6ME53      LFVEAWL-IFQTPPSFQSTSKMMMAGKLNINQ------------GPVYSEDNVNFYGTQI
A0A538NUU0      LFVEAWL-IFQTPPSFQSTSKMMMAGKLNINQ------------GPVYSEDNVNFYGTQI
A0A2V6NIJ1      LFVEAWL-IFQTPPSFQSTSKMMMAGKLNINQ------------GPVYSEDNVNFYGTQI
A0A2V6C292      LFVEAWL-IFQTPPSFQSTSKMMMAGKLNINQ------------GPVYSEDNVNFYGTQI
A0A2V6D2X0      LFVEAWL-IFQTPPSFQSTSKMMMAGKLNINQ------------GPVYSEDNVNFYGTQI
A0A2V5ZUK1      LFVEAFL-IYQTPPQYQSTSKMMLAGKLNIAQ------------GAVYSEDAVNFYGTQI
A0A7W1MVB5      LFVGAWM-IYQAPNAFLSTSKMMVAGKLNLSQ------------NAVYSEDTNNFYGTQI
A0A7W1U7H7      LFVGAWM-IFQAPNAFLSTSKMMVAGKMNLSQ------------NAVYSEDTNNFYGTQI
A0A2V5XFN9      LFVEAFL-IYQTPPSYQSTSKMMMAGKLNIAQ------------GAVYSEDAVNFYGTQI
A0A2V6EZC8      LFVEAFL-IYQTPPSYQSTSKMMMAGKLNIAQ------------GAVYSEDAVNFYGTQI
A0A2V6I7Z5      LFVEAFL-IYQTPPSYQSTSKMMMAGKLNIAQ------------GAVYSEDAVNFYGTQI
A0A3B9LCP2      LFVQAWL-IYQTPPSFLSTSKMMLAGKLNIAQ------------GAVYSEDSVNFYGTQI
A0A3C0R669      LFVQAWL-IYQTPPSFLSTSKMMLAGKLNIAQ------------GAVYSEDSVNFYGTQI
A0A2V6EID2      LFVEAFL-IYQMPPSFLSTSKMMLAGKLNIAQ------------GAVYSEDSVNFYGTQI
A0A2V6MHB0      LFVEAFL-IYQMPPSFLSTSKMMLAGKLNIAQ------------GAVYSEDSVNFYGTQI
A0A7V9V4N8      IFVQAWL-SYQTPPSFLSTSKMMLAGKMNINS------------TAVYSEDSMNFYGTQI
A0A838I5D7      LFVQSWL-IYQTPPSFLSTAKMMLAGKLNINQ------------NAVYSEDSVNFYGTQI
A0A2W5YWL9      LFVQSWL-IFQTPPSFLSTSKMMLAGKLNVNS------------SAVYSEDNVNFYGTQI
A0A2V5NH62      LFVQAWF-IYQTPPSFESRSKMMLAGKLNISQ------------SAVYSEDSVNFYGTQI
A0A2W6A620      LFVQSWL-SYQTPPLFQSMSKMMLAGKMNISQ------------SAVYSEDSVNFYGTQI
A0A2V5PIJ4      LFVQAWM-VYQRAPSFLSRSKMMLAGKLNISQ------------NAVYSEDSSNFYGTQI
A0A2V6K2G8      LFVEAFL-IYQTPPSYQSTSKMMLAGKLNIAQ------------GAVYSEDSVNFYGTQI
A0A2V5W206      LFVEAFL-IYQMPPSYLSASKMMLAGKLNIAQ------------GAVYSEDSVNFYGTQI
A0A2V6MW77      LFVEAFL-IYQMPPSYLSASKMMLAGKLNIAQ------------GAVYSEDSVNFYGTQI
A0A838MZM0      VFVQAWL-IYQTAPSFLSMSKMMLAGKMNITQ------------TAVYSEDSMNFYGTQI
A0A838DHH0      LFVQAWL-IYQTPPSFLSTSKMMLAGKLNISQ------------GAVYSEDNVNFYGTQI
A0A838FJZ1      LFVQAWL-IYQTPPQFLSTSKMMLAGKLNIAQ------------SAVYSEDSLNFYGTQI
A0A0E3YV65      CSLLGGW-LLSRPKVYQSRSRLLVDRSERVV--DIA---QVVDQSVGGGKNDAMFDTYLA
W0J900          CVLLGVW-LLKQPKVFQASATLLVGRIEKVLGNEIT---NVVDDSVGGSKNDPAFDTHLA
B4CZV9          LTAGLTY-YVFAKPVYYAHALIHLEYL------ARPLDTDKLYEDGRLSAFVAQFTEPQI
A0A7X1AX64      ATGTTLY-TFRKTKIYTSGAMVEILRTD-----PKPMARMAGDLDNNQIRTAEDLNTEIN
A0A3B9FM17      ----------------------------------------ESHLEGLISRHTEGLNSEKL
A0A7W7YGS1      VLAATCY-FVYASAAYQSQSLVRVNSFIVANDAAQGLP-DGDRTYRQLRALSDQLMSGYL
A0A2D7WMI4      ALGFTYK-SLQVPEFYASSSSFRLIPPPAIIN-LQKVD-REQQLQPLVSKHLDGLNSQEL
A0A2D6VHX5      SLAYVYK-ELQVPEMYQSSSSFVLIPPPKILN-LQKVD-RDQQVNGLISKHLDGLNSQEL
A0A2D8I214      SLGYVYL-KFQDTEFFQSSSSFRLIPPPAVLN-LQKVD-RDTQVQGLVAKHREGLNSQEL
A0A1Z8VL41      ALGFVYK-ELQVPEFFRSESSFRLXPPPXIIN-LQKVD-RXSXINTLXSRHLDGINSQXL
A0A2E6TNA4      ALGFVYK-ELQVPEFFRSESSFRLIPPVEVIN-LQKVD-RSSQINTLISRHLDGINSQEL
A0A1Z8RG47      SLGFVYN-KLQSPEFYKSSSSFRLIPPPAILN-LQKVE-RDQHVQGLVAKHLDGLNSQEL
A0A1Z8RJJ5      SLGFVYN-KLQSPEFYKSSSSFRLIPPPAILN-LQKVE-RDQHVQGLVAKHLDGLNSQEL
A0A2D7V631      ALGFVYN-QLQGPEYYASSSSFRLIPPPAILN-LQKVE-RDQHVQGLVAKHLDGLNSQEL
A0A354RA24      ALGFVYN-QLQGPEYYASSSSFRLIPPPAILN-LQKVE-RDQHVQGLVAKHLDGLNSQEL
A0A2E9RV62      ALGFVYK-EYQQPSIYQSSSSFRLIPPPAILN-LQPVE-QANQLVDLVRKHTEGLNSQEL
A0A2E4AY96      ALTIAYK-DLQVPEFFSSSSSFRLIPPPAIIN-LQKVDQQEQQFQLLVGKHRDGLNSQEL
A0A3B9B9P4      ALTIAYK-DLQVPEFFSSSSSFRLIPPPAIIN-LQKVDQQEQQFQLLVGKHRDGLNSQEL
A0A2D5Y6N6      ALAYIYV-KSQGIELFRSSASFRLIPPPAILN-LQKVD-RDQHVQGLVAXHLDGLNSQDL
A0A2E7HSS8      ALGFVFV-KQQVHEYYRSSSSFSLIPPPAILN-LRSVD-RDQHVEGLIAKHTEGLNSQQL
A0A2D8VCK3      ALLWVFY-KQQEPDKFQSSCSFSLTPPPAILN-LQSVE-RESHLEGLISRHTEGLNSEKL
A0A350QVY4      ALFWVFY-KQQEPDKFASSCSFSLTPPPAILN-LQSVE-RESHLEGLISRHTEGLNSEKL
A0A2E4ZYR7      ---------------------------------MQPVD-RDKYSARIIGQHLEGLRSGEL
A0A2E6TCV1      SLWYVYD-RYQEPELFRSSATFVIQPPLSIIDNMQPIE-RDKYSARIVGDHLHRLKEKEL
R7E4L8          GGLAYFI-CARQGYLYQKTARIMLR--DDKQK-NAQVS-EIILSDLGFKPGEANLANESY
A0A4P6PCA7      IAVGILR-ALYAVPVYQAKAEIEMS---VQRP-QFIQT-EVNLEEGGGTLSEDVIFNTRF
A0A2T6DSN5      AVAFVLA-QPKQDPVYWTEVQLLFE-----PK-EKKVL-NITEVVDTTTSSSLDLHTHLA
A0A317ZIW7      VAYKAIE-SFLEAPNYRSNAQMMLS------G-RISLP-ENELYAEE----RANFFGTQI
A0A7C4PPT4      LSLGLTF-FVYVKPVYMAKSLIRYQ------------A-LERPVDAEKVFRDSSERELIT
A0A7C4QZX4      LVGGLFY-YVYARPIYSSKSLVRYL------------S-LARPLDAENVLMEQTDRVLLT
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      VAFQTYD-VLITPPSYVSYSQMIVS------G-RIALP-EGAIYSEE----LSNFFGTQM
A0A366HV03      VLAGVCY-YTYSPAVYHSRSLIDYKFFALPVA-ADGVD-GSSVARAV--------RSVQG
A0A6G6K911      VLAGVCY-YVYSPAVYQSRSLIDYKFFALPVA-ADGVD-GSTAVRAV--------RSVQS
A0A832HT83      LSFGLFY-YVYARPVYYARALIRFT-----SL-ERPVD-DVKTFRDV------SELDLLA
A0A5R8KAF2      VLAGLCY-FVYTTPLYSSNAVIYFRVFGSPLS-DKGMG-DSAGSQTSALKYLPWELASDS
A0A7C4LRZ6      GGYAFHL-AMKQPPVYQAISKIGID--SKVVT-PYDQK-AAVVVD------LSSFYDTHL
A0A351MR11      VTAALIY-TVNATPEYRASGRLKVY---KYAP-NIT-G-RGAGEELYAIMSADDFNTAIE
A0A388PR45      VTIAVVY-TSTIIPEYRAAGRLRVY---RLTP-TIGTG-NTGVDETQRIGSNDDFLTAIE
A0A388QR61      VTVAIVF-TSSIVPEYRAAGRLRVY---RLTP-NLGNN-NSAVEEAQRIGSNDDFLTAIE
A0A4P5YHI0      VTVAIVF-TSSIVPEYRAAGRLRVY---RLTP-NLGNN-NSAVEEAQRIGSNDDFLTAIE
A0A2A2RS01      VTIALVL-TYQTMPEYRAVGKLRVF---RMAP-DVTAN-NTAANNNFNITTNDDFYTAVE
A0A2A2Y1A7      VTIALVL-TYQTMPEYRAVGKLRVF---RMAP-DVTAN-NTAANNNFNITTNDDFYTAVE
A0A388PDH9      VTIALVL-TYQTMPEYRAIGKLRVF---RMAP-DVTVN-NTTANNNFNITTNDDFFTAVE
A0A2G4H1E7      LTLSLLN-TYNTVPEFQATGRLRVF---RLAP-TINGG-SSAADDNFKIVSNDDFFTAVE
A0A2G4GZA6      LTLSLLN-TYNTVPEYRATGRLRVF---RLTP-TINGG-SSAADDNFRIGSNDDFFTAVE
A0A388P514      LTLSLLN-TYNTVPEYRATGRLRVF---RLAP-TINGG-SSAADDNFKIVSNDDFFTAVE
A0A2A2YG59      LTLSLLN-TYNTVPEYRATGRLRVF---RLAP-TINGG-SSAADDNFKIVSNDDFFTAVE
A0A2G4F7D5      LTLSLLN-TYNTVPEYRATGRLRVF---RLAP-TINGG-SSAADDNFKIVSNDDFFTAVE
A0A7V4IDX4      LGIQAWR-LWSAPPAYTSYGKMIVN----FKV-TTQTG-AGTTFTEE----WSQFLGTQV
A0A2V2SDN0      VVPALVI-TLATPPAYQSDARMWLT------G-KLDLS-EGRLYTEE----LVNFLGTQA
A0A4Q3BVY2      VMAGIIV-YLFTTPSYSSTALVTMHSFGAPMV-DREVA-ETQQVSSFHRNFLNRLRSAPI
A0A8A7W4D3      LLAGIVA-YMYSTPAYRSTSLLSVHGFGAPMV-DREIP-ETYQTSTFHRAFLTSFRSSNV
A0A3R8L982      ALGYAYY-KSRELPMYQSTATMQIEKPERVVT-SQEVV-DTAVSSDADLNTYLQIIGSQK
A0A6N6QBS9      LGIGTWQ-AMSKPDIFQARSVLAVP------------P-KVKMSGGM----QGAQIDEDA
A0A2V5X6Z6      LGPVGFL-SFNSLPAYESKARMWLT------G-RLDIY-EGRLYTEE----LINFLGTQT
A0A2V5VGZ7      LGPAGFL-SFNSPPAYESKARMWLT------G-KLDIY-EGRLYTEE----LINFLGTQA
A0A2V5U130      LGPVGVL-SFNSLPAYESKARMWLT------G-RLDIY-EGRLYTEE----LINFLGTQA
A0A2V6C237      LGPVGFL-SFNSLPAYESKARMWLT------G-RLDIY-EGRLYTEE----LINFLGTQT
A0A2E7HPU9      LLGSFYY-LSKAPKLYEATSTLLVKDSARAAF-EGQRQ-DNADINLRSQEALGTIVEQIK
D5EML0          AGLFVAS-VLTKEKLY--QASASMT------V-ELTTA-NVMDIREV----MDTNVAHVN
A0A1V6GL40      AIIKIVL-LWNAPPSYVSVGRMIVS------M-KLAIQ-PASLYSEE----LSNFLGTQA
A0A7X7VL75      AIIKIVL-LWNAPPSYVSVGRMIVS------M-KLAIQ-PASLYSEE----LSNFLGTQA
A0A7C4PPJ4      VGIAAHR-AYSLPKIY--RAISKIG------I-A--SR-VVTPFDN-----KAAVLVDIN
A0A3C1C1M3      FAGGAAA-FYLSRATE--IYQAEAR------I-ELSTR-RPRIVNKQDAMIEDRGYGDAE
A0A2S7U4L6      VLTAAVI-TYVMPKKY--EAIAVVK------I-NPLGT-NNQVLGSG----SSALM--TR
A0A2E9EYJ1      XMTALVI-AYLRPSEX--LGRVQIX------V-QREAR-DIEVFRXT----GSVGXXGSD
A0A258AXR6      FAAAAVL-TYIMPRKY--RGHVEMT------I-ERITQ-DINVFDRN----RGDSLAFTQ
A0A7W7YD86      FAAAAVL-TYIMPRKY--RGHVEMT------I-ERITQ-DINVFDRN----RGDSLAFTQ
A0A3D3NZQ6      FGSAAML-TYIMPRKY--RGRVEMK------I-ERLQD-KVQVFERS----SDNFMANSD
A0A1T4WVZ9      FATAAII-TYIMPRKY--RGRVEMK------I-ERLQN-KVQVFQRN----TDDFMAPTD
A0A4R7SSI6      FATAAII-TYIMPRKY--RGLVEMK------I-ERMQN-KVQVFQRS----TDDFMAPSD
A0A7W8DNH5      FATAAII-TYIMPRKY--RGLVEMK------I-ERVQN-KVQVFQRS----TDDFMAPSD
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A7Y4QK88      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A7V3WMH6      LLKRMIDV----------------------------------------------------
A0A2S7U0Z3      KLMGPAILSATAQSPEVRALRNAIPPEFSFKPRYMRTEEELAF-----------------
A0A2E6T1E0      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A7W1HKQ4      ------------------------------------------------------------
A0A6B3L936      ELVGLEQLQKVMQRPEVQVLEKVIPPQFSWKPKYWRDESQREF-----------------
A0A2N8IR72      IVRHSPVLETANALLRGLTITR--------------------------------------
A0A2N8IV96      SVLTSAEVLKVVSRKLNLAAEWGMTDE---------------------------------
R7E1V8          SVLTSTEVLKVVSRKLNLAAEWGMTDE---------------------------------
A0A2E0R252      KLRLPNLYTNIAASPKFAEREDVA--SEKFHMPWE---------DVPSVS----------
A0A3E1EF48      KLRMPRIYQNVASNPLFANRPEVVPLSRRYVLPWEPFLAKKPNPEEKPAP----------
A0A2A2PVG8      RIRLPQIYVEAAKGQLFANRENIA--PAKKRFPWT---------KQMRFA----------
A0A2E0R421      KLRMPALYTQVAKSYLFENRDDVF--PDRFHLPWE---------KRQNPT----------
A0A2E5EJ69      VIDRAAELIVDREQLS--------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ELMKDEAIRTRAEAY---------------------------------------------
A0A2E7ALI1      EV----------------------------------------------------------
A0A178IDB9      QMLSTTFYEYVQSSFS--SAEIEQIQAPYRN-----------------------------
A0A290QD69      QMLSRTFYESVQSSFT--PKEIEQIQNAYRN-----------------------------
A0A6N6ZC77      AFLESSDVRKAARER---------------------------------------------
A0A832M896      RLMMSPEVGARARAR---------------------------------------------
A0A538NJ59      ELLESGQLRQLALAR---------------------------------------------
A0A2A2R3V9      ELMQSAEVRSRARAR---------------------------------------------
A0A3C1VFY9      ALMQGNEVLNRARER---------------------------------------------
A0A2V2SMX4      ALMQSDVVIHRAHLL---------------------------------------------
A0A522AC27      ALMQSPVVVQRAHAR---------------------------------------------
A0A6M1RFD0      ALMQSDTVLNRAAER---------------------------------------------
A0A7C3HXH0      ALMQSATVLNRAADR---------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      RSMDSDTVWSRTLEQV--------------------------------------------
A0A178IFJ2      QITSREMVQRVVASFT--PEEKTRVLAAWLDKDDP-------------------------
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      ILEAARAIGVAG------------------------------------------------
A0A3D3LEQ6      QLEAAKKLGVAT------------------------------------------------
A0A3D3NW23      QLEAAKKLGVAT------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A2A2R174      NNVRSSAIIKRVVVGQSLTNHPYFT-----------------------------------
A0A1H2DTI1      ALMTSQKVYTAAINA---------------------------------------------
A0A1H1MGC9      VLESFAIVQRVADRLT--GEDLKAFLAPYQKSAAS-------------------------
A0A1V5L462      HLMTGQWVSERASER---------------------------------------------
A0A3D3LGD3      KLDLQLKWE---------------------------------------------------
A0A350ARX4      TLMLSDRVQKQAKDR---------------------------------------------
B5JIS2          SVMKSRRFSVELASEFTEDEKASIVRAFV-------------------------------
A0A7Y1UGD7      DLRNTQAIETVRAGMTRFRLFELVAADPLVRELEGLEPPKKPLLPFFGVPEKP-------
A0A2E5K4P7      ILKSPTITSMVETRLKASEVDYNNFMEPYQKMDKNGGRDEE-------------------
A0A842HH73      ILNTIAMAEAVANRFK--DEDRERFMAPFLDEIRFTSR----------------------
A0A2E6NAH3      VMESLSIIQGVEQRLQ--DELRLRFMAPYEDTLSLSG-----------------------
A0A2A5VZA5      LLQSGKIIQGVNRRMS--DEQRKRFLLPYEGAFSFSG-----------------------
A0A424R295      LLQSGKIIQGVNRRMS--DEQRKRFLLPYEGAFSFSG-----------------------
A0A1H2GQN6      TIESKEILYPVIKKLN--LVEKWSQRYLH-------------------------------
A0A858RDL7      QIRTFEVMQMVAGDDQ--LRSMPGLVPAPVNWMPDWLDKKLGNNSEEE------------
A0A512M3Y3      ALNSRWLVEHTAKTL---------------------------------------------
A0A4P5R5J1      ELMQSAAVLKGAETR---------------------------------------------
A0A4P5YK43      VLMKSPRVRNKAQEY---------------------------------------------
A0A2A2RPW6      NLKSSVILSRVVKANK--LTNHVYFT----------------------------------
B1ZT68          QLRSQTFFEYVLTSFN--KEEAERIQRPYRD-----------------------------
W0J7C2          QLRSKTFADYVLASFS--TAEAELIRKAYAD-----------------------------
B4D1I7          ELMQDEAVRQRAANL---------------------------------------------
A0A353F286      PETLAMAAEKAQLPVQ--WGMDMDDVVSLLEGIVET------------------------
A0A354FSA6      PETLAMAAEKAQLPVQ--WGMDMDDVVSLLEGIVET------------------------
A0A3B9GA54      PETLAMAAEKAQLPVQ--WGMDMDAVVSLLEGIVET------------------------
A0A520LEH8      PETLAMAAEKAQLPVQ--WGMDMDDVVSLLEGIVET------------------------
A0A6B2M0T8      DLRSNSFRNRVVDSLT--TEEVNLITKDYRDN----------------------------
A0A2D7B7R6      RISTTPVLSHVIEISP--ELQEHYKV----------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      ALMESPRVIQRAFDHA--V-----------------------------------------
A0A7V3QF58      ALMESPRVIQRAFDHA--V-----------------------------------------
A0A832FWF3      ALMESPRVIQRAFDHA--V-----------------------------------------
A0A838YJR8      ------------------------------------------------------------
A0A6N4WVA3      ELMLSEQVQVRAVERI--RLSNPELDAALR------------------------------
A0A0R2XPB1      ELMLSDQVQARAVERI--RLMDPDLHDALI------------------------------
A0A348NQP1      ELMLSDQVQARAVERI--RLLNSDLHDALM------------------------------
A0A357FV58      ELMLSDQVQARAVERI--RLLNSDLHDALM------------------------------
A0A2G4GZN8      AMRSANIIEGVSKRLT--VAERKQVLEPYQGGNIFS------------------------
A0A348NPT1      ----------------------ERFMAPYADALSFT------------------------
A0A2E1KV60      KLESITVIQGVEKRLQ--EDEFAQFMAPYKGVFSFS------------------------
A0A2D7F4D9      RLESVSIIQGVEKRFQ--EDELAQFMAPYKGTFSFS------------------------
A0A3R7RBR8      RLESVSIIQGVEKRFQ--EDELAQFMAPYKGTFSFS------------------------
A0A2E0NH28      VLESLSIIQAVERRLQ--DEERARFMAPYADAFSLT------------------------
A0A368BGT4      VFESLNIMQGVEKRLQ--DEMRERFMAPYMDTLSFS------------------------
A0A317ZP96      LLESGTIIQGVEQRLQ--DDMRKRFMAPYTDALSLR------------------------
A0A350AS32      VLESASIIVGVEQRIQ--DDVRERFMAPYSDALSLS------------------------
A0A7W8DI01      AERTALRLKLVK------------------------------------------------
A0A6N6PLV8      QILQTTEILYPVIERL--ELVKEFS-----------------------------------
A0A290QE54      VLGSAKLRGKVIQSLT--PAEVKMLQQPFLATLE--------------------------
A0A1H1SWX2      ILQSGRLRTMVAQSLT--PDEIRLLQRPYLKDLA--------------------------
A0A1D8AZK8      ILTSGRLRTMVSQSLT--PEEIKILQRPYLKDLA--------------------------
A0A4Q1C9I5      ILTSGKLRQMVAQSLT--AEEVRILQRPYLGELA--------------------------
A0A842HCC8      QLMTSSLVRQKAADR---------------------------------------------
A0A1G3ZL71      QLNSGTLRSRVYDSFT--PEEKAILQRSFLKDLP--------------------------
A0A556QP09      VIASAKMRNRVQESLT--PQERQVLQRPYIKDLA--------------------------
A0A2T6DX88      VLNSTKLRTKVMESFT--PEEVKVIQRAYLKNLK--------------------------
A0A2T6CWI7      VLKSSSLREEVVASFS--ADEIKVLQRAALKRLP--------------------------
A0A3E1E5C8      KLNSQRLRTKVVESFT--PDEVKILQRPYLKNLP--------------------------
B1ZZ74          VLNSARMRSRVVESFT--PEEVQILQRPYLANLA--------------------------
A0A2E0V4K6      QVTRVGILEKVAQRPE--FAGSEDLVRKPASYMPDWASAFFAREGARESNS---------
A0A7W1VQ11      RFVRSKLASAYIKERT--AERLG-------------------------------------
A0A2V6F9Q9      --MQSAEVRRGAAEL---------------------------------------------
A0A2V6NZZ3      QLMQSAEVRRAAAAL---------------------------------------------
A0A2V6EBU2      QLMQSAEVRRAAAAL---------------------------------------------
A0A2V6EY06      QLMQSAEVRRAAAAL---------------------------------------------
A0A2V6ME53      QLMQSAEVRRGAAAL---------------------------------------------
A0A538NUU0      QLMQSAEVRRGAAAL---------------------------------------------
A0A2V6NIJ1      QLMQSAEVRRGAAGL---------------------------------------------
A0A2V6C292      QLMQSAEVRRGAVGL---------------------------------------------
A0A2V6D2X0      QLMQSAEVRRGAVGL---------------------------------------------
A0A2V5ZUK1      QLMQSAEVKHSAEAL---------------------------------------------
A0A7W1MVB5      QLMQSDEVRQGAEAL---------------------------------------------
A0A7W1U7H7      QLMQSDEVHRGAEAL---------------------------------------------
A0A2V5XFN9      QLMQSAEVRRSAESL---------------------------------------------
A0A2V6EZC8      QLMQSAEVRRSAESL---------------------------------------------
A0A2V6I7Z5      QLMQSAEVRRSAESL---------------------------------------------
A0A3B9LCP2      QLMQSAEVKRSAEAL---------------------------------------------
A0A3C0R669      QLMQSAEVKRSAEAL---------------------------------------------
A0A2V6EID2      QLMQSAEVKRSAEAL---------------------------------------------
A0A2V6MHB0      QLMQSAEVKRSAEAL---------------------------------------------
A0A7V9V4N8      QLMQSSEVRRSAEAL---------------------------------------------
A0A838I5D7      QLMQSAEVRRSAESL---------------------------------------------
A0A2W5YWL9      QLMQSTEVRRGAEAL---------------------------------------------
A0A2V5NH62      QLMQSQEVRKSAEQL---------------------------------------------
A0A2W6A620      QLMQSAEVRRSAEAL---------------------------------------------
A0A2V5PIJ4      QLMQSDQVKQGAEGL---------------------------------------------
A0A2V6K2G8      QLMQSAEVRHSAESL---------------------------------------------
A0A2V5W206      QLMQSAEVRHSAESL---------------------------------------------
A0A2V6MW77      QLMQSAEVKHSAESL---------------------------------------------
A0A838MZM0      QLMQSSEVRRSAEAL---------------------------------------------
A0A838DHH0      QLMQSTEVRRSAEAL---------------------------------------------
A0A838FJZ1      QLMQSAEVRRSAEAL---------------------------------------------
A0A0E3YV65      QITSPAMIVRVVDSLS--ETEKLSAWRPYAEQDAP-------------------------
W0J900          QITSREMIQRVVASFK--PEEKARILAPWLDKDAP-------------------------
B4CZV9          MLRTARALGIDTNSRD--LERKYLFKFR--------------------------------
A0A7X1AX64      FLNSGKLIEAVNKRLT--GAERQAFMEPYQDTITFS------------------------
A0A3B9FM17      RINVAHQLDNNPQYKS--VLLGPFLK----------------------------------
A0A7W7YGS1      VLEAAKKI----------------------------------------------------
A0A2D7WMI4      RAQVVTKIENSPELKT--EILAPYIQ----EG----------------------------
A0A2D6VHX5      RMNVIARINENSDYKT--ELLAPYLS----DG----------------------------
A0A2D8I214      KASVIQKISDNPESKS--IMLAPFLR----EG----------------------------
A0A1Z8VL41      RVNVVQKISENPEXKS--IXLAPFLX----EG----------------------------
A0A2E6TNA4      RVNVVQKISENPEYKS--ILLAPFLQ----AG----------------------------
A0A1Z8RG47      RVNVIQKVKDNPEYKS--ALLEPYLK----EG----------------------------
A0A1Z8RJJ5      RVNVIQKVKDNPEYKS--ALLEPYLK----EG----------------------------
A0A2D7V631      RVNVIQKIKDNPEFKS--TLLAPYLK----EG----------------------------
A0A354RA24      RANVVQKIKDNPEFKS--TLLAPYLK----EG----------------------------
A0A2E9RV62      RARVLEAIKDNSFKKS--TMLAPYVH----DQ----------------------------
A0A2E4AY96      RMQVITKIENSPELKR--EMLKPYVE----SG----------------------------
A0A3B9B9P4      RMQVITKIENSPELKR--EMLKPYVE----SG----------------------------
A0A2D5Y6N6      RLNVTQKIKDTPELKS--ELLSPYLK----DG----------------------------
A0A2E7HSS8      RTNVILRLRESPEYKS--VLLAPYLK----DG----------------------------
A0A2D8VCK3      RINVAHQLDNNPQYKS--VLLGPFLK----QG----------------------------
A0A350QVY4      RINVAHQLDNNPQYKS--VLLGPFLK----QG----------------------------
A0A2E4ZYR7      RNRIVRAINEDDHKKA--TLLAPYVK----QG----------------------------
A0A2E6TCV1      RQRVVKAIESDKAKKS--ILLAPYVKDKKEQE----------------------------
R7E4L8          VVKSSEVMSRVVKGLG--LDVSYWEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTPL
A0A4P6PCA7      AKFRSPAMEEIAAEVY--FSKYSKKEYEERTS--------------------------W-
A0A2T6DSN5      RLRSETFLDYVQQSFS--PKEIEMIQNPYRDPQNAN----------------------A-
A0A317ZIW7      ELMESSQVKSRAIERV--KLTEPEVYESL-----------------------------E-
A0A7C4PPT4      RLTADHIIRRTARRLG--LPDNPKILYADHLRAVQ-------------------------
A0A7C4QZX4      RLTSPKIMQRTARRLG--LPEDPKALYAEHLVRIL-------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      SLMQSHRVKERARLRV------------------------------------------R-
A0A366HV03      QLSSRQMIAWTAHSLG--VGRANASFEELR----------------------------S-
A0A6G6K911      QLSSRQMIAWTAHALG--IGRANASFEELR----------------------------S-
A0A832HT83      RITAPHIVQRTARRLG--LEDNLRIINSKYIKLLR-------------------------
A0A5R8KAF2      NVLAAAKELGI-----------------------------------------------V-
A0A7C4LRZ6      QYMQSSKVRARVDEKL--RADSRLPAG-------------------------------I-
A0A351MR11      VMKSSGIIEAVERRLT--TSERKAVLEPYQSGNIF-----------------------S-
A0A388PR45      SMKSTAVIEGVSRLLT--PAERKLVLEPYQQGNVF-----------------------T-
A0A388QR61      SMKSSTVIEGVSRLLT--PAERKLVLEPYQQGNVF-----------------------T-
A0A4P5YHI0      SMKSSTVIEGVSRLLT--PAERKLVLEPYQQGNVF-----------------------T-
A0A2A2RS01      SMRSTGIIESVSRQLT--IDEKKRVIEPYQQGNIF-----------------------S-
A0A2A2Y1A7      SMRSTGIIESVSRQLT--IDEKKRVIEPYQQGNIF-----------------------S-
A0A388PDH9      SMRSTSIIESVSRQLT--IDEKKRVIEPYQQGNIF-----------------------S-
A0A2G4H1E7      EMRSANIIESVSKRLT--TDERKQILEPYQNGNYF-----------------------S-
A0A2G4GZA6      AMRSANIIEGVSKRLT--ADERKLVLEPYQAGNIF-----------------------S-
A0A388P514      AMRSANIIEGVSKRLT--ADERKLVLAPYQAGNIF-----------------------S-
A0A2A2YG59      AMRSANIIEGVSKRLT--ADERKLVLLPYQGGNIF-----------------------S-
A0A2G4F7D5      AMRSANIIEGVSKRLT--ADERKLVLLPYQGGNIF-----------------------S-
A0A7V4IDX4      MLMKSGTVLNRAVQRV--R---------------------------------------D-
A0A2V2SDN0      DLLRSRVIQERALATV--EKQFSNAPPLKPVPGMADFLRHG-----------------S-
A0A4Q3BVY2      QLAAAKRMGL------------------------------------------------V-
A0A8A7W4D3      QLAAARSLGL------------------------------------------------I-
A0A3R8L982      -------LRDKVAESL--KPDDIKILQRPYQQDAIAS---------------------G-
A0A6N6QBS9      RV-----TETQIAMMK--GGAVITRVM--------QRLQ-------------------E-
A0A2V5X6Z6      ELLRSPAIQGRALARL--RSELNPDLAVLLDGGGRQSELLHLAKALCKRLFAS-----G-
A0A2V5VGZ7      ELLRSPAIQGRALAKL--RSERN--LAVLHNGGGTQSELLHKAKALCKKLIAS-----G-
A0A2V5U130      ELLRSPAIQGRALARL--RSELNPDLAVLLDGGGRQSELLHKPKALCKRLFAS-----G-
A0A2V6C237      ELLRSPAIQGRALARL--RSELNPDLAVLLDGGGRQSELLHLAKALCKRLFAS-----G-
A0A2E7HPU9      NFELFEKIAKDPDVLA--LEGLIPPSVNWWPEWSGDLLGGDGEAAI------------E-
D5EML0          LL--NTLMNTHLERIK--TRAIADAVV--------AALSEDQIQQLVDPYYDPAIDGEN-
A0A1V6GL40      AL-----MQC-------------------------GVVVNRAHERV------------S-
A0A7X7VL75      AL-----MQC-------------------------GVVVNRAHERV------------S-
A0A7C4PPJ4      SF-----YDTHLQYLQ--STKVRERVL--------AKIRADER-----------------
A0A3C1C1M3      EI-----LNTQIQKFN--SPSILPFVV------------ASYRELY------------P-
A0A2S7U4L6      QF-----FGTEFKKIE--SDENLKRAA--------ELVQLPQKMQI------------S-
A0A2E9EYJ1      QLPYMTXMQTQFEIXQ--SRETXKEVIXNGVDXAGNXXDLKKSWGV------------P-
A0A258AXR6      EY-----IKTQFETIT--KPTTLYPVI--------ETLELAKKWEL------------P-
A0A7W7YD86      EY-----IKTQFETIT--KPTTLYPVI--------DKLELAKKWQL------------P-
A0A3D3NZQ6      VV-----VKNEFESIT--KPETLYPVV--------DKLDLQLKWEL------------P-
A0A1T4WVZ9      VV-----IKNEFESIT--KPETLYPVV--------DKLDLQKRWSL------------P-
A0A4R7SSI6      VV-----IKNEFESIT--KPETLYPVV--------DKLDLQKRWSM------------P-
A0A7W8DNH5      VV-----IKNEFESIT--KPETLYPVV--------DKLDLQKRWSM------------P-
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A7Y4QK88      --------------------------------------------------------PAAA
A0A1V6GCZ3      ------------------------------------------------------------
A0A7V3WMH6      ------------------------------------------------------------
A0A2S7U0Z3      --------------------------------------------------------KPAS
A0A2E6T1E0      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A7W1HKQ4      ------------------------------------------------------------
A0A6B3L936      --------------------------------------------------------ISAG
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A2E0R252      --------------------------------------------------------GADM
A0A3E1EF48      --------------------------------------------------------GTKQ
A0A2A2PVG8      --------------------------------------------------------GEDL
A0A2E0R421      --------------------------------------------------------REDI
A0A2E5EJ69      --------------------------------------------------------PDIS
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      --------------------------------------------------------VRTT
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      --------------------------------------------------------PDNP
A0A290QD69      --------------------------------------------------------PDSP
A0A6N6ZC77      --------------------------------------------------------VAAF
A0A832M896      --------------------------------------------------------VRAM
A0A538NJ59      --------------------------------------------------------LSAP
A0A2A2R3V9      --------------------------------------------------------VQAL
A0A3C1VFY9      --------------------------------------------------------VASQ
A0A2V2SMX4      --------------------------------------------------------VIAQ
A0A522AC27      --------------------------------------------------------AVAQ
A0A6M1RFD0      --------------------------------------------------------VHAG
A0A7C3HXH0      --------------------------------------------------------VHAT
A0A432FDF6      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      --------------------------------------------------------KEDH
A0A178IFJ2      --------------------------------------------------------PLSA
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      --------------------------------------------------------PSTT
A0A3D3LEQ6      --------------------------------------------------------ASTT
A0A3D3NW23      --------------------------------------------------------ASTT
A0A522ACN3      ------------------------------------------------------------
A0A2A2R174      --------------------------------------------------------GGSN
A0A1H2DTI1      --------------------------------------------------------LKAK
A0A1H1MGC9      --------------------------------------------------------SPPS
A0A1V5L462      --------------------------------------------------------VRAL
A0A3D3LGD3      --------------------------------------------------------LPTR
A0A350ARX4      --------------------------------------------------------VLML
B5JIS2          --------------------------------------------------------KGDG
A0A7Y1UGD7      --------------------------------------------------------LEGD
A0A2E5K4P7      --------------------------------------------------------DPIV
A0A842HH73      ---------------------------------------------------------EPT
A0A2E6NAH3      ---------------------------------------------------------PLT
A0A2A5VZA5      ---------------------------------------------------------PLT
A0A424R295      ---------------------------------------------------------PLT
A0A1H2GQN6      --------------------------------------------------------GERL
A0A858RDL7      --------------------------------------------------------VSKE
A0A512M3Y3      --------------------------------------------------------GLVE
A0A4P5R5J1      --------------------------------------------------------VHAL
A0A4P5YK43      --------------------------------------------------------MREI
A0A2A2RPW6      --------------------------------------------------------QGTN
B1ZT68          --------------------------------------------------------PTQP
W0J7C2          --------------------------------------------------------PLDP
B4D1I7          --------------------------------------------------------VRSN
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ------------------------------------------------------------
A0A3B9GA54      ------------------------------------------------------------
A0A520LEH8      ------------------------------------------------------------
A0A6B2M0T8      --------------------------------------------------------DGNN
A0A2D7B7R6      --------------------------------------------------------DLND
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      --------------------------------------------------------AQTG
A0A7V3QF58      --------------------------------------------------------AQTG
A0A832FWF3      --------------------------------------------------------AQTG
A0A838YJR8      ------------------------------------------------------------
A0A6N4WVA3      --------------------------------------------------------ETEA
A0A0R2XPB1      --------------------------------------------------------ATEA
A0A348NQP1      --------------------------------------------------------VTEA
A0A357FV58      --------------------------------------------------------VTKA
A0A2G4GZN8      --------------------------------------------------------GPLT
A0A348NPT1      --------------------------------------------------------GPLT
A0A2E1KV60      --------------------------------------------------------GPLT
A0A2D7F4D9      --------------------------------------------------------GPLT
A0A3R7RBR8      --------------------------------------------------------GPLT
A0A2E0NH28      --------------------------------------------------------GPLT
A0A368BGT4      --------------------------------------------------------GPLT
A0A317ZP96      --------------------------------------------------------GPLT
A0A350AS32      --------------------------------------------------------GPLS
A0A7W8DI01      --------------------------------------------------------NVSQ
A0A6N6PLV8      --------------------------------------------------------PAGQ
A0A290QE54      --------------------------------------------------------PGQP
A0A1H1SWX2      --------------------------------------------------------PGAN
A0A1D8AZK8      --------------------------------------------------------PGAN
A0A4Q1C9I5      --------------------------------------------------------PGEN
A0A842HCC8      --------------------------------------------------------VRAL
A0A1G3ZL71      --------------------------------------------------------PGAG
A0A556QP09      --------------------------------------------------------PGAT
A0A2T6DX88      --------------------------------------------------------PGDP
A0A2T6CWI7      --------------------------------------------------------PGSP
A0A3E1E5C8      --------------------------------------------------------PGAG
B1ZZ74          --------------------------------------------------------PGAS
A0A2E0V4K6      --------------------------------------------------------EPDT
A0A7W1VQ11      --------------------------------------------------------IKAT
A0A2V6F9Q9      --------------------------------------------------------VWST
A0A2V6NZZ3      --------------------------------------------------------VRST
A0A2V6EBU2      --------------------------------------------------------VRST
A0A2V6EY06      --------------------------------------------------------VRST
A0A2V6ME53      --------------------------------------------------------VRST
A0A538NUU0      --------------------------------------------------------VRST
A0A2V6NIJ1      --------------------------------------------------------VRST
A0A2V6C292      --------------------------------------------------------VRST
A0A2V6D2X0      --------------------------------------------------------VRST
A0A2V5ZUK1      --------------------------------------------------------VRSS
A0A7W1MVB5      --------------------------------------------------------VRAT
A0A7W1U7H7      --------------------------------------------------------VRAT
A0A2V5XFN9      --------------------------------------------------------VRSA
A0A2V6EZC8      --------------------------------------------------------VRSA
A0A2V6I7Z5      --------------------------------------------------------VRSA
A0A3B9LCP2      --------------------------------------------------------VRST
A0A3C0R669      --------------------------------------------------------VRST
A0A2V6EID2      --------------------------------------------------------VRST
A0A2V6MHB0      --------------------------------------------------------VRST
A0A7V9V4N8      --------------------------------------------------------VRAT
A0A838I5D7      --------------------------------------------------------VHST
A0A2W5YWL9      --------------------------------------------------------VRST
A0A2V5NH62      --------------------------------------------------------VRST
A0A2W6A620      --------------------------------------------------------VRST
A0A2V5PIJ4      --------------------------------------------------------VHST
A0A2V6K2G8      --------------------------------------------------------VRSA
A0A2V5W206      --------------------------------------------------------VRSA
A0A2V6MW77      --------------------------------------------------------VRSA
A0A838MZM0      --------------------------------------------------------VRAT
A0A838DHH0      --------------------------------------------------------VRST
A0A838FJZ1      --------------------------------------------------------VRAQ
A0A0E3YV65      --------------------------------------------------------PPAA
W0J900          --------------------------------------------------------PLSD
B4CZV9          ------------------------------------------------------------
A0A7X1AX64      --------------------------------------------------------GPLT
A0A3B9FM17      --------------------------------------------------------QGVR
A0A7W7YGS1      --------------------------------------------------------GIAD
A0A2D7WMI4      --------------------------------------------------------AVTS
A0A2D6VHX5      --------------------------------------------------------TPMK
A0A2D8I214      --------------------------------------------------------IPVG
A0A1Z8VL41      --------------------------------------------------------XPIG
A0A2E6TNA4      --------------------------------------------------------IPTG
A0A1Z8RG47      --------------------------------------------------------ISMD
A0A1Z8RJJ5      --------------------------------------------------------ISMD
A0A2D7V631      --------------------------------------------------------ISMD
A0A354RA24      --------------------------------------------------------ISMD
A0A2E9RV62      --------------------------------------------------------QLPE
A0A2E4AY96      --------------------------------------------------------IPTS
A0A3B9B9P4      --------------------------------------------------------IPTS
A0A2D5Y6N6      --------------------------------------------------------ISID
A0A2E7HSS8      --------------------------------------------------------VIVD
A0A2D8VCK3      --------------------------------------------------------VRVG
A0A350QVY4      --------------------------------------------------------IRVG
A0A2E4ZYR7      --------------------------------------------------------PPPP
A0A2E6TCV1      --------------------------------------------------------VLPT
R7E4L8          NGREFSLSYRAKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKE
A0A4P6PCA7      --------------------------------------------------------IGLE
A0A2T6DSN5      --------------------------------------------------------PVPS
A0A317ZIW7      --------------------------------------------------------QKEE
A0A7C4PPT4      ------------------------------------------------------------
A0A7C4QZX4      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      --------------------------------------------------------AMQP
A0A366HV03      --------------------------------------------------------GPLR
A0A6G6K911      --------------------------------------------------------GPLR
A0A832HT83      ------------------------------------------------------------
A0A5R8KAF2      --------------------------------------------------------GPSA
A0A7C4LRZ6      --------------------------------------------------------QPLS
A0A351MR11      --------------------------------------------------------GPLT
A0A388PR45      --------------------------------------------------------GPLT
A0A388QR61      --------------------------------------------------------GPLT
A0A4P5YHI0      --------------------------------------------------------GPLT
A0A2A2RS01      --------------------------------------------------------GPLS
A0A2A2Y1A7      --------------------------------------------------------GPLS
A0A388PDH9      --------------------------------------------------------GPLS
A0A2G4H1E7      --------------------------------------------------------GPLT
A0A2G4GZA6      --------------------------------------------------------GPLT
A0A388P514      --------------------------------------------------------GPLT
A0A2A2YG59      --------------------------------------------------------GPLT
A0A2G4F7D5      --------------------------------------------------------GPLT
A0A7V4IDX4      --------------------------------------------------------LKPD
A0A2V2SDN0      --------------------------------------------------------SVNA
A0A4Q3BVY2      --------------------------------------------------------GDGA
A0A8A7W4D3      --------------------------------------------------------GKTA
A0A3R8L982      --------------------------------------------------------SPLP
A0A6N6QBS9      --------------------------------------------------------GGGA
A0A2V5X6Z6      --------------------------------------------------------STSS
A0A2V5VGZ7      --------------------------------------------------------SSSS
A0A2V5U130      --------------------------------------------------------STSS
A0A2V6C237      --------------------------------------------------------STSS
A0A2E7HPU9      --------------------------------------------------------ASKM
D5EML0          --------------------------------------------------------KPDP
A0A1V6GL40      --------------------------------------------------------AQKP
A0A7X7VL75      --------------------------------------------------------AQKP
A0A7C4PPJ4      ------------------------------------------------------------
A0A3C1C1M3      --------------------------------------------------------DDPA
A0A2S7U4L6      --------------------------------------------------------TDEA
A0A2E9EYJ1      --------------------------------------------------------SDED
A0A258AXR6      --------------------------------------------------------NRQA
A0A7W7YD86      --------------------------------------------------------SRQA
A0A3D3NZQ6      --------------------------------------------------------TRQA
A0A1T4WVZ9      --------------------------------------------------------NRQS
A0A4R7SSI6      --------------------------------------------------------NRQA
A0A7W8DNH5      --------------------------------------------------------NRQS
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      -----------------------------------------------------KQFINIR
A0A2V6FIP7      ------------------------------------------------------------
A0A3C1UJT2      -----------------------------------------------------------D
A0A258AXL1      ------------SAPLPVGTIVRREPNPDPFLIKTAGPNVVPGATGEQVNGANTARRLSP
A0A2V5UAD5      -------------------------------------------------NALMIEYIQYK
A0A7Y4QK88      RPDPC-------------------RRLRQEFGLLIEASSASPRYTQAYLNALMDAYLENR
A0A1V6GCZ3      --------------------------MRGTSLIEIVVYSEKPEEAARIANAIADAYKTHR
A0A7V3WMH6      ------------------------RQSRNTSLIEIRVFSEDKYEAAEIANEIAKVYRDYR
A0A2S7U0Z3      SVEVY-------ELVSSFGSWITISGRRGTSLIDVRVKHQDAEAARVIADTLLKVYLEKE
A0A2E6T1E0      ------------------------------------------------------------
A0A5E6MKA7      ------------MGSLKV------EPIRNTRLVRIRCESRQPIVAAQVANGYAESFINFG
A0A7W1HKQ4      -KEVA-------------------RIRDEEHIIDLNPEGTEDSLTAANSNVV-------K
A0A6B3L936      DADPA-------EFLRLLHQRVSVENVRGTTLIAIKVTHPDAETAKTLANAVMMTYVEEE
A0A2N8IR72      ------------------------PDSKESSLLEMTLTSSNPQKAEDTLNHLIQVYNQIS
A0A2N8IV96      ------------MAATNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAYKQDR
R7E1V8          ------------MAASNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKTVPEAYKQDR
A0A2E0R252      SPET---------LGGMMRGWVTVRWRKDTTLIDLYASHSDPEIARDTLEGLIEEYDRSV
A0A3E1EF48      GPAAG-------DLAGMMAGWVSVSVRENTNLVDIFAAHTNPEVARDVLSCLLTEYEKLT
A0A2A2PVG8      SPEM---------LGAMLKGWVTVRWRTDTTLLDLYATHTDPAIARDSLAAVLSAYEQLS
A0A2E0R421      SDVS---------LGNMMRGWVSVRWRPDTKLLDIHVTHTNPEVARDVLVALLSEYERMT
A0A2E5EJ69      QNDLR-------GQLGGVSS----SLRKMTRFIDVSFRHRDRVFAMNANQAIVEAFVNWD
A0A2G4I5Z5      ----------------------------MTRLIDVTVELGDRVLSQTLAQAVVDEYIKQI
A0A4P5QQV6      AAEIP-------VSMVMLRV----EPLPQTSIFALTATGEEPLYTQKFLDAILHEYIATR
A0A2E7ALI1      ------------------------TVRRRTRLLDVRINHEDPKVSAELADTVVDEYLKEL
A0A178IDB9      SAPPP-------SLAGIIRPHINIYQQKGTTIVRIVVTNRDPEAAALIANRFSRKYIDFT
A0A290QD69      TAPPP-------SLADIIRPNVRIEPQRSTTILRIMVWNKDPEAAALIANRFARQYIQYT
A0A6N6ZC77      YPDLQ-------PIPVSIQP----MQLPDTSIIQVVATGSDREYTQRYLDALLEEYINWR
A0A832M896      QPDLA-------ESGAGLDV----QQIPKTSIFSLSARGPEPAYAQAWLNAVMDEFIRFK
A0A538NJ59      RTNAIPLGKDGQPLPVEIRV----RQAAKSSVFELEASAADAAYVQAYLSALMIEYLQYK
A0A2A2R3V9      KPNLV-------PIPVALSA----YQQPRTSIFTLQASGSEPNYTQAFLDAVMEEYISRR
A0A3C1VFY9      NPGVT-------PKPVALQV----SVLPKTTIFILRATGGNPEYTKAYLQACMDEYRNLK
A0A2V2SMX4      NPNFK-------PQPVSLKV----TILPKTTIFLLVGTGDDPVYTQKFLQACMEEYANLK
A0A522AC27      RPDIV-------VQPAELSV----AITPKTTIFVVRAIGHDPQYVKAFLQACMEEYIKLK
A0A6M1RFD0      RPDLV-------PVPVKVTV----GVTPKTTVFNLRAVGSDPAYVQAYLDAVMEEFINLK
A0A7C3HXH0      RPDLV-------PVPVKVSV----GVTPKTTIFNLRAVGSDPAYVQAYLDAVMEEFINLK
A0A432FDF6      ------------------------------------------------------------
A0A2E7VDS1      --------------------------------LRITAIARNGEGAAMIANLAQDEYERIH
A0A7C8D3W3      PPPAD-------VEVLSKGA----SRIGKSSSFQLTVNSNNESYAKQLAAYWVTNFVHHK
A0A178IFJ2      SQMDG-------RLSGLITSGVGVQRQGTTFLIRITCKHREPAMAALVATRFAECYIVYL
A0A357FSP9      --------------------------------------------AARVANLFADEFINYN
A0A1T4WWY4      FDGLR-------DDVMPVCR----MAILDQSHFQILVVSYDAEVVKKMPQALVDAYERIR
A0A3D3LEQ6      AVDLR-------ASLIPAIR----IGFLDQNHIQLRVISYRPRIVREFPQAMIEAYEGAR
A0A3D3NW23      AVDLR-------ASLIPAIR----IGFLDQSHIQLRVISYRPRIVREFPQAMIEAYEGAR
A0A522ACN3      ------------------------------------------------------------
A0A2A2R174      APSEQ-------MVVSSVSGAVDARLRRMTRLIDVTVELGDRMLAQTVAQSVVDEYIKER
A0A1H2DTI1      NPGFV-------ESDVRIDV----HPLGSTPILIIRAMSSDAQFAKDFLQADIDAYIALQ
A0A1H1MGC9      PAEII-------FRERKI------VPVRLSLVLQVQYAHPDRHVAAKVANLFIDEYIAYN
A0A1V5L462      HPEIQ-------KDWVSLWA----GRKGTTDIFQLVASGGNARYTQAYLAQIIQAYLEFR
A0A3D3LGD3      QAALG-------KLRSNLDT----QSSIRSDFVIIEFFDKDPALAATIANAVADSYMTRR
A0A350ARX4      YPEIT-------PSWVSLSV----VQRSQASIFQLRAQGGSAEFTQKFLDAVMEEYQTFR
B5JIS2          VPSMS-------AFEKILAGRMDATRQRDREFFTLSFRHPEAEIALMVADRMTAAYLKLV
A0A7Y1UGD7      VPSMS-------KLAGMIAGWVAVEVRPDTRLIDIAVKHPRPEVSQVIANRLVHHYIEDR
A0A2E5K4P7      AGPIL-------HEKRRI------IPKRLSLVIQIEYIHPNPEIAATVVNHFAQSFREYQ
A0A842HH73      LVEKL-------YENKRV------DGIRSTLLIRIGFYHPDPEMAAMAANYYADEYITYN
A0A2E6NAH3      PLEIL-------AKNRKI------IPRRMSLMVNFTYSHPDPFLAAEVANLFAKEFIDYN
A0A2A5VZA5      PTEIL-------GKYRKI------MPQRMSLMVNVAYTHPDAQIAADVANLFAQEFINYN
A0A424R295      PTEIL-------GKYRKI------MPQRMSLMVNVAYTXPDAQIAADVANLFAQEFINYN
A0A1H2GQN6      LREDE-------VYGILLGRHLKVEPQRGSNIIQITGISEEMEEAPLLANTIAETYIGVR
A0A858RDL7      PPAPA-------LLAGMIGSWTRVSTRRYTRLLDISVTHPNPEVAKEVANKIADYYFRVV
A0A512M3Y3      TPGEY-------EMIRNRYVSSIRVTLVPGNILQIEIYAYQPWLVEKWPQAMLDTYKTYT
A0A4P5R5J1      HPDLP-------VEQVKVVV----GQLPKAAIFVMNVYAKSPAYASAYVDALMDEYMAKK
A0A4P5YK43      DAALG-------VHPELESS----VSKGAGSLFMMTVDSTDLRYASLYVSNWARAFVAYK
A0A2A2RPW6      AISEE-------RLTRQLAYVVDARLRRFTRLIDVSVELGNAKLAQVIGQSVMEEFLKQN
B1ZT68          DKPVP-------SLAEIIRPNLTIFARRNTTILVVGVTNRNPENAALIANRFARRYIDYN
W0J7C2          DAAPP-------PLDAIIRPNVTVFARRGTPILGIQVSNRSPEAAALIANRHARKYIDYN
B4D1I7          NPELT-------PCPITLFV----APLPQTSIFNLSAIGTEPQYPQKFLDALMHEYIATR
A0A353F286      ------------------------IPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRR
A0A354FSA6      ------------------------IPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRR
A0A3B9GA54      ------------------------IPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRR
A0A520LEH8      ------------------------IPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRR
A0A6B2M0T8      APSIH-------NIIASANK----IALVGGNIFKFEFHHRNPQAAALLANRFSEEFNDFL
A0A2D7B7R6      PRSIT-------SASKKLGANITAKLRGDSLFIDLTANSENRDLAYWSAKYVSTGYTNFL
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      INEKE-------PPKIKV------TIVPRASVFVLQAKGRDPRFVQAFLQACMEEFINLK
A0A7V3QF58      INEKE-------PPKIKV------TIVPRASVFVLQAKGRDPKFVQAFLQACMEEFINLK
A0A832FWF3      INEKE-------PPKIKV------TIVPRASVFVLQAKGRDPKFVQAFLQACMEEFINLK
A0A838YJR8      --------------------------------------------------FAAEEAIQNL
A0A6N4WVA3      YQVNG-------LNSLDIEA----YVKRDTSIFVLRAYTPHAEYTQAYLDAVMEEYINRR
A0A0R2XPB1      YQIDG-------LRALSIES----NVKRDTSIFVLSAYTPHAEYTQAYLDAVMEEYINRR
A0A348NQP1      YQNDG-------LRALLIEA----DVKRDTSIFVLTAYTPHAEYTQAYLDAVMEEYINRR
A0A357FV58      YQIDG-------LRALSIEA----DVKRDTSIFVLTAYTPHAEYTQAYLDAVMEEYINRR
A0A2G4GZN8      EQEVF-------ARQRGI------NPQRQTLVINVDFTHPNRDLARQVARLFCESIKKNS
A0A348NPT1      PTQML-------AQNRKI------LPQRGTLMIGVGYNHPDPVMAARVANLFADEFINYN
A0A2E1KV60      AFEIL-------AKNRKI------IPRRMSLMVNISYTHPNPIVAAKIANLFGDEYINSM
A0A2D7F4D9      AFEIL-------SINRKI------IPRRMSLMVNIAYTHPNPIMAAKIANLFGDEYINTM
A0A3R7RBR8      AFEIL-------SINRKI------IPRRMSLMVNIAYTHPNPIMAAKIANLFGDEYINTM
A0A2E0NH28      PVEML-------AKNRKI------IPRRMSLMVNVGFTHPDPIIAARVANLFADEFIAYN
A0A368BGT4      PLEVL-------AENRKV------IPRRMSLMINLAYSHPDPLIAAEVSNLFAKEFIDYN
A0A317ZP96      PTEVL-------GRNRKI------IPRRMSLMINIAYSHPDPIVAAEVANLFAKEFIDYN
A0A350AS32      PTEVL-------GRNRKI------MPKRMSLMINIAYTHPDPIIAADVANLFAKEFIDYN
A0A7W8DI01      LGTIW-------SRFISKIK----ITSSVANQLEIEVWVYEPRLAKLWPQAMLLEYHDFL
A0A6N6PLV8      RLPVQ-------SIHNRLRRAMKLQEVRMTGLIDIGIYDVKADRAANIANMIGVVYVERR
A0A290QE54      PPSIH-------EVVGSIGV----QAIKNSFLISITATHRSGEGAALIANRYVDQFMQDL
A0A1H1SWX2      PPAVG-------GLLGSMSP----LSIRNSFLITITVNNRDPEGAALLANRFVEQFMRYL
A0A1D8AZK8      PPPVG-------GLLGSMAP----QSVRNSFLINISVTNRDPEGAALLANRYVEQFMRYL
A0A4Q1C9I5      PPPVG-------QLLGSMSP----QSIRNSFLIHISVTNRDPQGAALLANRYVEQFMRYL
A0A842HCC8      HPEYL-------PCQVTLNV----TQSKDANIFNLSAWGAEQNYTQAYLDAVMEEYLNFK
A0A1G3ZL71      PPATG-------DFMGQVVA----DAVRGSRLIRITARHRDPAAAALVANRTYQQFVNQL
A0A556QP09      PPT-G-------VDLGVMSV----QSVRSTFLINIAVSHRDPDAAAILANRYIEQFIESL
A0A2T6DX88      LPGVG-------SMLGSTSV----QSVRNSFIIRIVVSHPDPEAAALIANRTVDQFMQYL
A0A2T6CWI7      PTNVG-------IPMGELSV----FPIRNTYLIAVTVTHDDPDAAALVANRFVEVFMKRL
A0A3E1E5C8      VPSAG-------EALGAVSI----DSTRNSLLISITVRHPDPVAAALVANQYVNQFVGYL
B1ZZ74          PPSAG-------GALGGVSI----DAARNSLLITVRVVHPDPEAAALVANRYVNQFMTYL
A0A2E0V4K6      GANLT-------RVAAMLAQRCDATVRKRTRLLDVTVTHEDPELARTLADAVVDEYLKEL
A0A7W1VQ11      AREIE-------RKYIRKMT----VRFTPQNTIRVEVFAYSYDLARDWAETTLQQFLLDR
A0A2V6F9Q9      HPDIS-------PVPIELSV----AQRPRTSIFELQAIGSSPEYTQLYLSAVMQKYLDFK
A0A2V6NZZ3      NPELQ-------PVPVELSV----AQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFK
A0A2V6EBU2      NPELQ-------PVPVELSV----AQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFK
A0A2V6EY06      NPELQ-------PVPVELSV----AQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFK
A0A2V6ME53      NPELQ-------PAPVELTV----AQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFK
A0A538NUU0      NPELQ-------PAPVELTV----AQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFK
A0A2V6NIJ1      NPELQ-------PVPVELSV----AQRPRTSIFELQAIGSSPDYIQAYLNAVMQKYLDFK
A0A2V6C292      NPELQ-------PVPVELSV----AQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFK
A0A2V6D2X0      NPELQ-------PVPVELSV----AQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFK
A0A2V5ZUK1      HPELQ-------PVPVEIFV----MQKPRTSIFDLSAVGSSPEYTQAYLNAAMQKYLDFK
A0A7W1MVB5      HPELP-------QAKVTVSV----SQRPRTSIFELEAVGTTPDYTQLYLNAAMQKYVDVK
A0A7W1U7H7      HPELP-------QVKVEINV----TQRPRTSIFELEAVGTTPDYTQAFLDATMQKYLDVK
A0A2V5XFN9      HPELQ-------PVTVEIFV----IQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFK
A0A2V6EZC8      HPELQ-------PVTVEIFV----IQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFK
A0A2V6I7Z5      HPELQ-------PVTVEIFV----IQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFK
A0A3B9LCP2      HPEMQ-------PVPVDITV----SQKPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFK
A0A3C0R669      HPEMQ-------PVPVDITV----SQKPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFK
A0A2V6EID2      HPEMQ-------PMRVEITV----VQKPRTSIFDLQAIGRTPDYTQAYLNALMQKYLDFK
A0A2V6MHB0      HPEMQ-------PMRVEITV----VQKPRTSIFDLQAIGRTPDYTQAYLNALMQKYLDFK
A0A7V9V4N8      HPEMQ-------PVLVNVNV----TQKPRTSIFDLQAVGAAPEYTQAYLNAVMQKYLDFK
A0A838I5D7      HPELP-------PVRVDLSV----AQKPRTSIFDLQAIGSTPEYTQAYLNAVMQKYLDFK
A0A2W5YWL9      HPELH-------PVPVEINV----LQRARTSIFELQAIGSSPDYTQAYLNAAMQKYLDFK
A0A2V5NH62      HPEMQ-------PVMVEISV----VQKPRTSIFDLVAIGTTPDYTQAYLNAVMQKYLDFK
A0A2W6A620      HPELQ-------PHLVEITV----TQKPRTSIFDLVAIGSTPEYTQAYLNAVMQKYVDFK
A0A2V5PIJ4      HPEMP-------TAPVEITV----SQQSRTSIFDLRAVGAVPEYTQAYLNALMQKYLDFK
A0A2V6K2G8      HPELQ-------PVPVEIFV----LQKPRTSIFDLSAIGSAPEYTQAYLNATMQKYLDFK
A0A2V5W206      HPELQ-------PVPVEITV----LQKPRTSIFDLAAVGSAPEYTQAYLNAVMQKYLDFK
A0A2V6MW77      HPELQ-------SVPVEITV----LQKPRTSIFDLAAVGSAPEYTQAYLNAIMQKYLDFK
A0A838MZM0      HPEMQ-------PVPVEVTV----TQKPRTSIFDLQAIGTTPEYTQAYLNAVMQKYLDFK
A0A838DHH0      HPEMQ-------PVLVAVTV----TQKPRTSIFDLQAIGTTPEYTQAYLNALMQKYVDFK
A0A838FJZ1      HPELQ-------PVKIDITV----NQKPRTSIFDLQAIGSTPDYTQAYLNAVMQKYLDFK
A0A0E3YV65      PVLRD-------TLLQIIGSSVSAARQGNTFFISINVLQRDPDSAALLASRFASQFIIHL
W0J900          SQTDA-------RLASLIADNVGVVRQGSTFLVRVSYKHREPAVAALVATRFTECYIVYL
B4CZV9          ------------------------ASLNTEKNIDVEAWPYSADWAHRWTETMVQQFIAYR
A0A7X1AX64      PLEVL-------GRNREI------KPARMSLNVYISYSHPSAAIAADVANMFAEEYVAYS
A0A3B9FM17      VGIAS-------AYSYRITQ----AGSKSRPRFIITSDARSALGAKYVADVVQKEYEKLH
A0A7W7YGS1      SKTTY-------DYLRETTLRVCRVTMLDQSHLEILIVSLSPDVVRDMPKALVEVFEEVR
A0A2D7WMI4      VAAAI-------SYSVSVS-------GEGRPVITISSNARSAQAAMIIAREVQTEYEILH
A0A2D6VHX5      IQNIV-------TYNVSVS-----SPSEGRPRFKINSQSRTGKGAMIIADLVQKEYDKLN
A0A2D8I214      VESTI-------SYSISVS-----PPSEGRPRFVISSTSRSAKGAMLVADLVQSEYEKLH
A0A1Z8VL41      VAXTV-------SYSVSVT-----PPSAGNPRFTISATSRSARGAQIIADTVQLEYEKLH
A0A2E6TNA4      VASTV-------SYSVGVT-----PPSAGNPRFTISAVSRSARGAQIIADTVQSEYEKLH
A0A1Z8RG47      VGATV-------SYGVSVS-----PPSEGRPRFTINSNSRSGKGAMIVADIVQSEYEKLH
A0A1Z8RJJ5      VGATV-------SYGVSVS-----PPSEGRPRFTINSNSRSGKGAMIVADIVQSEYEKLH
A0A2D7V631      VGATV-------TYSVGVS-----PPTEGRPRFTINSNSRSGKGAMIVADVVQSEYEKLH
A0A354RA24      VGATV-------TYSVGVS-----PPTEGRPRFTINSNSRSGKGAMIVADVVQSEYEKLH
A0A2E9RV62      IASII-------NYSVS-------VGGEGRPVFTITATGRSPESVQLVADLVQQYYDESH
A0A2E4AY96      VGSTV-------SYSIS-------LSEESRPRFTITSNARSAKSAMIIAREVQSEYEILH
A0A3B9B9P4      VGSTV-------SYSIS-------LSEESRPRFTITSNARSAKSAMIIAREVQSEYEILH
A0A2D5Y6N6      VGATI-------SYSISVS-----PPSEGRPRFTINSTARSGRGAQIIADVVQSEYEKLH
A0A2E7HSS8      LASTV-------SYRVD-Q-----SGTKSRPRFIITSDSRSAKGAMIVADLVQKEYEKLH
A0A2D8VCK3      IASAY-------SYRIT-Q-----AGSKSRPRFIITSDARSALGAKYVADVVQKEYEKLH
A0A350QVY4      IASAY-------SYRIT-Q-----AGSKSRPRFIITSDARSALGAKFVADVVQKEYEKLH
A0A2E4ZYR7      VASVV-------NYTVS-------LAGEGTPILRINSMARNGEGAAMVANLAQDEYERIH
A0A2E6TCV1      VGQVV-------NYKID-------LIGKGTPTLQITAEARNAEGAQLVANLVQIEYERAH
R7E4L8          ATDGM-------LGRLSVTR----PDSKESSLLELTLRLSHPQKAEDALNYLIEVYNDHS
A0A4P6PCA7      DLAYW-------VRQVGWYK----QGNANIVHVSF--QSPDPEFAAQLVNVMIEAAGVLM
A0A2T6DSN5      VRNIV-------RSAIQIRD----DKATTIVRIGA--YHRDPEAAALIANRFARKYIDFM
A0A317ZIW7      FLNEG-------LRSLKIAA----EVKDDTSIFALSAITPDRKFSQEFLDAVMAEYINRR
A0A7C4PPT4      ------------------------VRFNSERNLEVTVLAYRGDIVRRWTETMLEEFLKDR
A0A7C4QZX4      ------------------------PRFDSDRNVEVTVIAYSKQVVNAWVPVMVEEFLKEL
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      ELDPC-------VVRVSVSQ----SPDASIFILSA--VGEKPEYTQAYLNALMNEYLSFK
A0A366HV03      KIE---------------------LGLLDGATMQLDVFSTNPNVVREFPQALINQYDSYT
A0A6G6K911      KVE---------------------LGLLDGATMQLDVFSTNPNVVREFPQALINQFDTYT
A0A832HT83      ------------------------ARFNSERNIELDIYSYSSSLVRVWGEAMLQEYLRDR
A0A5R8KAF2      SFEAV-------KSKQLRVR----ASTMNWSHLQISVMSPDPAVVRVFAKKLIEVYRAQR
A0A7C4LRZ6      AQA---------------------SRGVGFFLLTV--QSTNFLHAQQFALHWAREFMNFK
A0A351MR11      SQEVF-------GRQRGIAA----QRMTMIVNVEF--THPDRDLSRQVCRLFCESIQKNS
A0A388PR45      EQEVF-------ARQRGVNP----TRQTFVVNVDF--THPNRELARLVAQRFCDVIQKSS
A0A388QR61      EQEVF-------GRQRAINP----TRQTFVVNVEF--THPNRELARMVAQRFCDVIQKSS
A0A4P5YHI0      EQEVF-------GRQRAINP----TRQTFVVNVEF--THPNRELARMVAQRFCDVIQKSS
A0A2A2RS01      EQEVF-------GRQRAINP----LKSTFVVTVEF--THPNRDLARQVAGIFCKAIQKNS
A0A2A2Y1A7      EQEVF-------GRQRAINP----LKSTFVVTVEF--THPNRDLARQVAGIFCKAIQKNS
A0A388PDH9      EQEVF-------GRQRAVTP----LKSTFVVAVEF--THPNRELARQVASIFCKAIQKNS
A0A2G4H1E7      EQEVF-------AKQRSINP----QRQTLVINVAF--THPTRDLSRKVAQLFCEAIKKNS
A0A2G4GZA6      EQEVF-------AKQRGINP----QRQTLVINIDF--THPNRDLARQVARHFCDSIKKSS
A0A388P514      DQEVF-------VKQRGINP----QRQTLVINVDF--THPNRDLARQVARHFCDAIKKYS
A0A2A2YG59      EQEVF-------ARQRGINP----QRQTLVINVDF--THPNRDLARQVARHFCDAIKKYS
A0A2G4F7D5      EQEVF-------AKQRGINP----QRQTLVINVDF--THPNRDLARQVARHFCDAIKKYS
A0A7V4IDX4      LKPTP-------LQPIQINV----LPKTTIFLLQL--TGEEPEYTTAYLQAVMDEYIALK
A0A2V2SDN0      ANAEP-------SELFKLKV----VESSKSSILELHATGAEPLSTRAFLNAVMAEYLSFK
A0A4Q3BVY2      TSEDI-------LRVIPSLV----IRAMDGRTIELTVVAHDKRAVRGFAEAIVTAYQDIQ
A0A8A7W4D3      TSEDL-------LRIIPSVV----VVPIDSRSLELTVVAHDPAVVRDFAKAMVSAYQDLQ
A0A3R8L982      GPSGL-------VGGINVQS----VARSYLISITA--YNRDPDGAALIANRYVDQFITYL
A0A6N6QBS9      TNRMA-------RPEYDALA----GRGATYVMTV---RGTNFDYCQKFALAWAQEFIDYK
A0A2V5X6Z6      SNAPP-------RFPFDVKV----LEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFK
A0A2V5VGZ7      SNAPP-------RFPFDVKV----LEGAKSSTLALRVIGAEPASTRAFLDCLMEEYLSFK
A0A2V5U130      SNAPP-------RFPFDVKV----LEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFK
A0A2V6C237      SNAPP-------RFPFDVKV----LEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFK
A0A2E7HPU9      ETSQL-------ARLIRGWTEVSNRRKTRLVDVVV--SHPLPEVASALADKISQTYANEL
D5EML0          AVLLM-------RRMLSVER----GENEESQVLNIIITHQNPRIAQQVANTYVDEYIAYK
A0A1V6GL40      EIGRH-------AVALNVLV----LPKTTIFVLQA--TGRDRDYTQAFLQACMDEYIALK
A0A7X7VL75      EIGRH-------AVALNVSV----LPKTTIFVLQA--TGCDRDYTQAFLQACMDEYIALK
A0A7C4PPJ4      -LVGM-------SGPVNATA----TKGLGYFLITV--DATNFLFAQQYAMHWAREFMSFK
A0A3C1C1M3      PEEEL-------TARLANRGRFAIIKRTRLVSVTF--TDPDPEFAMRACAAYAAGAEAAA
A0A2S7U4L6      ILV-L-------KGGLSARQ----ERGTDLIEISLRMVKDNRQYVKPATEAIALAYSEMR
A0A2E9EYJ1      AYRIL-------KRKVETQD----VRGTDLIDIEV--YDTDPNLAADIANAVADAYRTRR
A0A258AXR6      ALGRL-------RANLETQS----MLRSDFVTIDY--YDQDPQLAATIANEVAKSYMTQR
A0A7W7YD86      ALAKL-------RANLETQS----MLRSDFVVIDY--YDQDAQLAANVANEVAHSYMAQR
A0A3D3NZQ6      ALGKL-------RSNLDTQS----SIRSDFVIIEF--FDKDPALAATIANAVADSYMTRR
A0A1T4WVZ9      ALAKL-------RGNLDTQS----SVRSDFVVIEY--FDQDPGVAAEIANAVYQSYMTRR
A0A4R7SSI6      ALAKL-------RGNLDTQS----SVRSDFVTIEF--YDQEPGAAAEIANAVAQSYMTRR
A0A7W8DNH5      ALAKL-------RGNLDTQS----SVRSDFVTIEF--YDQDPNTAAEIANAVAQSYMTRR
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      EGVNEEGKKSDLQHLLAAAKERESELETARRRAGSYTPAL--------------------
A0A2V6FIP7      -------------IVLQALKQAQADLDKARSDAAAARKLDEEVERLL-------------
A0A3C1UJT2      LEDLESVGYVDAASEKARPDNLTNEQLEIVSLIPSVAKNEDFK-----------------
A0A258AXL1      EVGAATPEASTTTIVTPQVAKRANEWEYIEGQLHSSEREYERL-----------------
A0A2V5UAD5      KDIRKVVSGDTLASISEQVLRLERDLKSEQENLVAFQRTNNLA-IVQ--QEAT-------
A0A7Y4QK88      KNNRKEISGGTLASISEQVQRWERDLKTAQDALNVFQQTNNLA-ILQ--EEGT-------
A0A1V6GCZ3      QEQRAQLSRGGIKALEERFAEQEAKVKAAQERVDNLRKELNISDAMASGDGPSPL-----
A0A7V3WMH6      LAVRREMSARGIRKLEEEWDKQDKLVKEKQKEVDQLKAELGISDMDAAIGPGGHT-----
A0A2S7U0Z3      ESQLIGGSDDAFKILKKEADGARLEMELAEKSLQFYVSAIKLS-----------------
A0A2E6T1E0      ---------------------------------LTYKRENDII-SLE--ESQN-------
A0A5E6MKA7      LDRKLEANRHARKFLAGQMDALRKKMAQSEERLADFMAEAGIAHLSP--QEKA-------
A0A7W1HKQ4      QEGEVNDAEINVATLSAKLQQIETLKGDDLMRMMPTLNIQDPT-VLK-------------
A0A6B3L936      EARISGGTSDAFKVVSIEADEIAAEMEAAERSFQTYRAALELN-----------------
A0A2N8IR72      KDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEFKTKSDIVKDAD--TTMS-------
A0A2N8IV96      EMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYL-PTSWRNGEH-------
R7E1V8          EMRENRLVETAIKSLKDVLREQEDTVNEKMMSLKKLIAESSYL-PTTWRNGEN-------
A0A2E0R252      ESKVAGSSEFALDYILESSDKVKEKMLNLERALRLYKRCLELS-----------------
A0A3E1EF48      AESIAGSEENTINYIVEKCRELQEGIFKIESSLARYQGCVDLS-----------------
A0A2A2PVG8      ESRVEGSSEYVLEYILDSSAEIKERLLDLESTLQLYQRCLELS-----------------
A0A2E0R421      ESKVADSSEYALDYILENTNRIRKGILDLERAIELYNNCQDLI-----------------
A0A2E5EJ69      IERKMGRGTNTIAIHTTAAEELKVKWLEAQEIAHQYVKSNSLAVGMTDMKRME-------
A0A2G4I5Z5      NEDRAGIGTNTSQFLMGEEIRIKAGLLKAEVAVQEYLKTNSSS-LIQ---GQN-------
A0A4P5QQV6      REMRSQKGEFAAGAIDDEIERVAAELRKEEDRLLAFQRDNKTG-FLE--QEGN-------
A0A2E7ALI1      TEENRGTKNKRSEGLVKQAEEARVGLQEATSALAIYNRAIEAHKLLE-------------
A0A178IDB9      VDKAMTSTNSAIIFLKNQSEEKRSEVESVERAMQDYRARHNMA-ALG--EATN-------
A0A290QD69      IDRAMTKTSSAMLLLRGQAEEKRTELQLIERQKQDFRAKHNMA-ALG--ENKG-------
A0A6N6ZC77      QQMKGETSERALLAITEQLDDIERKIQQGEDAVVEFRKRNNLI-FIQ--EQGD-------
A0A832M896      DEMRQDTSDKTLASITEQLLRLEKELEQHETDLFAFQKANDVV-VVQ--EQGS-------
A0A538NJ59      KDIRKVVSGDTLASISEQVLRLERDLKSEQENLVAFQRTNNLA-IVQ--QEAT-------
A0A2A2R3V9      KETRSEKSQSALLTIKEQVDKSEKEINQVDEEMLSFQKENNVI-FME--EQGN-------
A0A3C1VFY9      KGMTEHASDTTVAGLTDQMLRLDPEMRKVDDQVAVFLSTNDVA-FLE--EASG-------
A0A2V2SMX4      AEMRTQTSDKTLSGLSEEVESLRKELKQSSVQLEAFQGSNSVV-VLD--QQGN-------
A0A522AC27      REMREKTSDTTLAGLTEEILHLQRDLKKSDEELAEFQKTNSVV-LLQ--EQGN-------
A0A6M1RFD0      KEMRTRSSDVTLAGITEEVARLEKELKQYEDELLQFQATNSIV-FLQ--EQGN-------
A0A7C3HXH0      KEMRTRSSDVTLAGITEEVARLEKELKGYEEELLQFQATNSIV-FLQ--EQGN-------
A0A432FDF6      ------------------------------------------------------------
A0A2E7VDS1      DVRKGKKHDMAITFLEEQMNKSRKLGQAIDANTRDFKRQHNLA-FIE--DEKK-------
A0A7C8D3W3      DLKTLEEFTNKQASLEKNKTKWIRNLADVQKEYDELILKHGAT-----------------
A0A178IFJ2      MDRNASANDSAISFLRAQTEDLRKKAEASERALHAYREKSRMV-SLE--ESQN-------
A0A357FSP9      LTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEYREDNNAV-SLE--SQEN-------
A0A1T4WWY4      LKIRSEYRDTAVKRYADEVTEIRKKVAEQLDSRLQFEEQSALA-NAQ-------------
A0A3D3LEQ6      KRLRNEYRDKAIARYVDELADVRAKVTSQLDSRLKFEEESALA-SAQ-------------
A0A3D3NW23      KRLRNEYRDKAIARYVDELADVRAKVTSQLDSRLKFEEESALA-SAQ-------------
A0A522ACN3      --------------------------NIAEQRLLALRKEHGED-----------------
A0A2A2R174      NEVRAGVGTNTSQFLMAEETRIKEKLLLAERAAEQYLRTNSSS-LIQ---SQN-------
A0A1H2DTI1      HDIKVDDKDRAIKDITDELTKAEATLQTDEDDVLGFQKANNIV-FLQ--EQGS-------
A0A1H1MGC9      SRLRIEDSMKAVDDLKERAEQQKKKVEELAINLQAYREKNKMV-SLD--QRKD-------
A0A1V5L462      RQTRLETSDDVMLSIGEELRELDVKIQQIQEAIRRFQQENNTI-AIK--ELSE-------
A0A3D3LGD3      VEVESKQKESALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWF--SAGPNSTVPGA
A0A350ARX4      SEMRSETTETTLIAVTEQLYRLEEEIENQENTVVDFQKENNLI-FLK--EQDS-------
B5JIS2          QREIKETNQAAAEMLRLQAEQLQAEISELEGKQRDFRERNNVI-SLE--ENQD-------
A0A7Y1UGD7      TESRSSGQQTNLEFLIEESKRVKDELQAAQSVLTAYSAPLDAE-----------------
A0A2E5K4P7      LDQSLKKGISDISKLGTEIQEKEKDVLVLEAKAVNYKTQFTSL-GLD--SEEN-------
A0A842HH73      VRLNVESSMRAVEDLRIRADKQRAEVDSIREKLVEYREKANRT-SLK--PDEN-------
A0A2E6NAH3      LKLNIDGSMKAVEDLRIRADQQKNRVEELELKLAEYREQNNAV-SLQ--SDEN-------
A0A2A5VZA5      LSENIDASMVAVEGLRIRADQQKERVEEIELKLAEYRERHNAV-SLD--SQEN-------
A0A424R295      LSENIDASMVAVEGLRIRADQQKERVEEIELKLAEYRERHNAV-SLD--SQEN-------
A0A1H2GQN6      TKNEKDRINRGLDNVADQIEKQRTIVTDAKKKVDDMRLQLGVDIIPGTQNESQ-------
A0A858RDL7      SKASRDGRGGSMDLLTVKSGEAQTQEQKDSAVLATYQRSLELH-----------------
A0A512M3Y3      QQQRSRFKDNAVEEYTKDLDRLKTRIASEQNATAKFEEDNHLIEQYIANNGLE-------
A0A4P5R5J1      KEMRQTSGESAAVAIQEELVRLEKDMKLEEEEMHGFQQKNNIG-FLK--EDGN-------
A0A4P5YK43      NEVNTELIEKKFGQTRQEVKRYEQNLEKARESTLIFKKKHNIG-DIR--DAGL-------
A0A2A2RPW6      AEDRVGAGTNAGHALLASEAAIKQRLLKAEHAVAEYRRTKNIS-LQD-------------
B1ZT68          LDRANSGTNSAIIFLRNQAEELRAQVEAVESSLQEFRARNNIA-ALG--ENQN-------
W0J7C2          LDNASTRTNSAIVFLRNQADETRAQVEAAEKALQNYREKNNLA-AIG--ETQN-------
B4D1I7          REMRTEKSEDAESSIEDEISRVQADVRKEEEKLVTFQRENNVG-FLE--QGGN-------
A0A353F286      RKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIP-YFDGGSAGNRLGLSEQ
A0A354FSA6      RKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIP-YFDGGSAGNRLGLSEQ
A0A3B9GA54      RKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIP-YFDGGSAGNRLGLSEQ
A0A520LEH8      RKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIP-YFDGGSAGNRLGLSEQ
A0A6B2M0T8      VERSRKTNDSALRFLRSQSEELKLKVERSELAVQRYRQERNLV-SLE--ESQN-------
A0A2D7B7R6      KVNSRSKAMGGLIQLERGRELSQKDLEDAQKALIRFQTKNRIT-NLK--ERKEQLETKNN
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      REMVGRTSDVTLAGMTEEVLRLEKELRQYETELAEFQKSNDIV-FLQ--EQGN-------
A0A7V3QF58      REMVGRTSDVTLAGMTEEVLRLEKELRQYEAELAEFQKSNDIV-FLQ--EQGN-------
A0A832FWF3      REMVGRTSDVTLAGMTEEVLRLEKELRQYEAELAEFQKSNDIV-FLQ--EQGN-------
A0A838YJR8      RSTIKSLTQLEGAELIKSAVDLGVKNETLNSGWSEYQ-------TLE--LSRA-------
A0A6N4WVA3      VEMRSKTSERTYDAIVAQLQILEKEVDEGEDAIVEFQQRNNIV-FIQ--EQGS-------
A0A0R2XPB1      VEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIV-FIQ--EQGA-------
A0A348NQP1      VEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIV-FIQ--EQGA-------
A0A357FV58      VEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIV-FIQ--EQGA-------
A0A2G4GZN8      EDDRLMVTNPLIEKARIEIETLEDKVRRLNEQKNGLIKNQKLL-SIA--KDTN-------
A0A348NPT1      LTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEYREDNNAV-SLE--SQEN-------
A0A2E1KV60      LSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKNAI-SLD--KQEN-------
A0A2D7F4D9      LSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKKAV-SLD--KQEN-------
A0A3R7RBR8      LSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKKAV-SLD--KQEN-------
A0A2E0NH28      LTKSVDASMDAVEDLRIRADQQRQRVEELELKLAEYREEHNAV-SLD--QQEN-------
A0A368BGT4      LRLNIDGSMKAVEDLRIRADQQKDRVEELELKLAEYREQNNAV-SLQ--SDEN-------
A0A317ZP96      LKLNIDSSMKAVEDLRIRADQQKDRVEELEFKLADYREQKNAV-SLD--SQEN-------
A0A350AS32      LKLNIDGSMKAVEDLRIRADQQKERVEELDMKLADYREQNNAV-SLD--SQEN-------
A0A7W8DI01      TESRIKHRDLIIQGFSKEMDRIRENLKAETERDRRFESENRILENF--------------
A0A6N6PLV8      RADLQKNVDRGLEQLTEEVAKQREVMKKASAEAAQLRTEGNINDPNP--DEQNVIITTDG
A0A290QE54      LMNVGGKNEYAVQSLRTRAEQLRKEVEVADQRLQTYMKEQRLV-SLD--SSVN-------
A0A1H1SWX2      MENVGGKNEFAVDYLRSRAKELQQESEAAEGKLQDYRRKHNLV-SLD--NSMN-------
A0A1D8AZK8      LENVGGKNEFAVDYLKTRAEELRKESEIAEGRLQDYRRKHNLV-SLD--NSIN-------
A0A4Q1C9I5      FENAGGKNEDAVNFLRSRADELRKDSETAEGRLQDYRRKHNLV-SLD--NSIN-------
A0A842HCC8      RDRRESKAKDTVYSLQENLLEYQRQIEELEQQKLDFQKKNNII-FVQ--EQGN-------
A0A1G3ZL71      IENAGGSSEFTVEFLQLRATELRKELGEKEALLQDYKKRHNLI-SLD--DSLN-------
A0A556QP09      LENVSGGHDYAVKYLRDRATQLQEEARIAEQRLQDYMRAQNLV-SLD--NSTN-------
A0A2T6DX88      LDSVSGKNEYAVERLRLSAEQLRKEAEAADQKLQSYMREHNLV-SLD--NSVN-------
A0A2T6CWI7      YDTAGGRTADAVKFLREQASRLEREAQEKEQALQQYMTKHQLT-SLD--TSQS-------
A0A3E1E5C8      MDYYGGKNETGVEYLRAQADRLGKDAADAEQKLMAYKKEHNLV-SLG--NSTN-------
B1ZZ74          IERVGGVNESAVEFLRNRADQLRKEAEQADVKLNAYMQAHNLV-SLD--KNKD-------
A0A2E0V4K6      AEEDKGSADRRSAGLLGQADVARESLQEANSALAVYNRAL--------------------
A0A7W1VQ11      EEKRRSRADMTVKTFSKEMEEMQERMDQIFNSKYDLRTSNDLT-KIT--IELN-------
A0A2V6F9Q9      RGMREGQTQTFTTGITEHLIQVEKDLRTAEDEMLEFQKENNIG-FIQ--EEGN-------
A0A2V6NZZ3      RGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A2V6EBU2      RGMREGQTHTFTTGITEQLIQVEKDLRAAEDDMLDFQKQNNIG-FIQ--EEGN-------
A0A2V6EY06      RGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A2V6ME53      RGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A538NUU0      RGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A2V6NIJ1      RGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A2V6C292      RGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A2V6D2X0      RGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A2V5ZUK1      RGMREDRGHEITTGITEQLIQVEKDLRNSEDEMLEFQKQNNIG-FIQ--EDST-------
A0A7W1MVB5      KGMRADEGSHVTTAITEQLIQVEKDLRNGEDEMLEYQKDNNIG-LIQ--GEGN-------
A0A7W1U7H7      KGMRADEGSHLTTAITEQLIQVEKDLRNGEDELLEYQKENNIG-LLQ--GEGN-------
A0A2V5XFN9      RGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A2V6EZC8      RGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A2V6I7Z5      RGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A3B9LCP2      KGMREGQGQTVITGITEQLIQTEKDLRTAEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A3C0R669      KGMREGQGQTVITGITEQLIQTEKDLRTAEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A2V6EID2      KGMREGQGQTLITGITEQLIQTEKDLRTAEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A2V6MHB0      KGMREGQGQTLITGITEQLIQTEKDLRTAEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A7V9V4N8      KGMREDRGHEVTTGMTEQLIQVEKDLRTAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A838I5D7      KGMREDQGHNVTTAITEQLIQVEKDLRNGEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A2W5YWL9      RGMRQDQTHTLTTGMTEQLIQVEKDLRAAEDEMLEFQKQNNIG-FIQ--EEGN-------
A0A2V5NH62      KGMRENQGSTVTTAITEQLIQVEKDLRGAEDEMIEFQKQNNIG-FIQ--EEGN-------
A0A2W6A620      KGLRENQGSTVTTAITEQLIQVEKDLRNSEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A2V5PIJ4      KGMREGQGHNVTTAITEQLIEVEKDLRTAEDELLEFQKQNNIG-FIQ--EEGN-------
A0A2V6K2G8      RGMREDRGHEITTGITEQLIQVEKDLRNSEDEITEFQKQNNIG-FIQ--EEGN-------
A0A2V5W206      RGMREDRGHEITTGITEQLIQVEKDLRNGEDEMLEFQKQNNIG-FIQ--EQGN-------
A0A2V6MW77      RGMREDRGHEITTGITEQLIQVEKDLRNGEDEMLEFQKQNNIG-FIQ--EQGN-------
A0A838MZM0      KAMREDRGHEVTTGMTEQLIQVEKDLRAAEDELLDFQKQNNIG-FIQ--EEGN-------
A0A838DHH0      KRMRENQGDTVTTAITEQLIGVEKDLRNAEDEIVEFQKQNNIG-FIQ--EEGN-------
A0A838FJZ1      KGMREDQGHNVTTAITEQLIQVEKDLRNAEDEMLDFQKQNNIG-FIQ--EEGN-------
A0A0E3YV65      LDRNSAVNNSAIAFLREQTQELRVKAESSERALQQYREKSGMV-SLD--ESRN-------
W0J900          MDRNTSSNDSAISFLREQTEDLRKKAEASERALQAYREKTRMV-SLE--ESQN-------
B4CZV9          QERRNEEKNLIVNTYSEELKELVGRLDQQFSEKLDFQDQQDFT-----------------
A0A7X1AX64      LNRGLERTIKAVEDLRREAETKKQKVDELEAELAQYRRENNAV-SIE--QSEN-------
A0A3B9FM17      KSTKNEKVEFVKQTLEDLLDTSLGKEKKIAADMANYKKEHNLP-FLE--DEKR-------
A0A7W7YGS1      LKMRDEYRQQAIQRYAQEINEVRKKVTEQLDNKLKFEEQSALA-SAQ--IEME-------
A0A2D7WMI4      RSRSNLKVESAKQTLEGLLQKEIQKEENIKRQITALKIKRSVP-NLE--DIKR-------
A0A2D6VHX5      SIKKTEQVQTAKGILELLLDKSLMEEDRILKEISDIKESNDIP-FIE--DAKK-------
A0A2D8I214      KSKKNQQVESVRNLLEKLLAQSIEKESQLADEMSAYKKNLGLP-FIE--DEKR-------
A0A1Z8VL41      KSRKSEKVESARNLLELLLENRQSEEKRIAQEMSQFKKGKNIP-YLE--DAKN-------
A0A2E6TNA4      KSRKSEKVESARNLLELLLENRQSEERRIAQEMSQFKKGKNIP-YLE--DAKN-------
A0A1Z8RG47      RSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSGYKKNNQLP-FLE--DEKK-------
A0A1Z8RJJ5      RSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSGYKKNNQLP-FLE--DEKK-------
A0A2D7V631      KSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSEYKKANQLP-FLE--DEKK-------
A0A354RA24      KSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSEYKKANQLP-FLE--DEKK-------
A0A2E9RV62      KKGAGEIVRGARSVLESLLEKSQSREDSILEEMTKYKGERELP-FVE--DERL-------
A0A2E4AY96      RSNSSLKVESAIKTLERLLDREMKKEKDIQAKISQYKAEKEAP-FLE--DDKK-------
A0A3B9B9P4      RSNSSLKVESAIKTLERLLDREMKKEKDIQAKISQYKAEKEAP-FLE--DDKK-------
A0A2D5Y6N6      KSKKSLQVENVKNVLQLLLDKSLQEEERISQEQSSFKKKYDLP-FLE--DEKQ-------
A0A2E7HSS8      KSSKSEKVEFVKKTLEDLLENSLSKERKIAYDMSEFKKVNQLP-FLE--DEKR-------
A0A2D8VCK3      KSTKNEKVEFVKQTLEDLLDTSLGKEKKIAADMANYKKEHNLP-FLE--DEKR-------
A0A350QVY4      KSTKSEKVEFVKQTLEDLLDTELSKEKKIAADMANYKKDNNLP-FLE--DEKR-------
A0A2E4ZYR7      ESRQGKKHDTAIAFLEEQMTRSRNAETEIDNKVREFKRRHNLA-FIA--DEKK-------
A0A2E6TCV1      KSRKGQNQTKSVAFLDIQMAESRKKEDAIIKQINSFKTNHNLT-YIE--DDKK-------
R7E4L8          RREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDMD--TTLD-------
A0A4P6PCA7      ERDNKELSDGAVKWLVDQTEVLRKELEAVELELAGKRQDFQIA-TLE--QRRE-------
A0A2T6DSN5      LDEAMSGTTSAILWLRNQAEETRSQLEAATRELQEFRERHNMA-SVG--ENKG-------
A0A317ZIW7      SEMRAKTSEKTYDAIAAKIKSLEDEINQNEDAIVDFQRKNNIV-FIQ--EQGS-------
A0A7C4PPT4      EEKRVEMREKIISSYTEELKEVSRRMEEALMTTHQVESGRKT------------------
A0A7C4QZX4      EEKRAEMRNRILAAYNAEMKDMGEEIESILNAKYQVEGGRKM------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      REMRSETADRTFLAITEEMMDLQKEIESGEDEKLNFQKENNIV-FIQ--EQGS-------
A0A366HV03      REKRFEFFEVALKRYNEELGLLKKKIDESLQVKTSFERDNEIN-ELL--IKQN-------
A0A6G6K911      REKRFAFFEVALKRYNEELGLLKKKIDESLEVKTNFERDNEVN-ELL--IKQN-------
A0A832HT83      DEKRDALRANVIQTYTNEMKQISEKLEELIRSRYNMVSSNQQM-EIM--LKLA-------
A0A5R8KAF2      EEAWAKYRNEALIRYAREVDTLEGLAVDSYKDLSKLERESRMT-EVK--IEQS-------
A0A7C4LRZ6      EEQTASAVDQRLTETRREIERYERKLETARRALQDFQLSNNIA-SVK--ETAD-------
A0A351MR11      EDERLTVTNPLVEKARVEIESLEERLNRLYLDKNELVGRERML-AIV--KDTN-------
A0A388PR45      EDERLTITHPLVEKARIEIESLEDKIRRLYEKKNGLVKSGDLL-DIA--GTTN-------
A0A388QR61      EDERLTMTHPLVEKARIEIESLEDKVRRLYEKKNGLVKSGELL-DIA--GTTN-------
A0A4P5YHI0      EDERLTMTHPLVEKARIEIESLEDKVRRLYEKKNGLVKSGELL-DIA--GTTN-------
A0A2A2RS01      EDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKTQKLL-SIA--KDTT-------
A0A2A2Y1A7      EDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKTQKLL-SIA--KDTT-------
A0A388PDH9      EDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKSQKLL-SIA--KDTT-------
A0A2G4H1E7      EDGRLMMTNPLVEKARIEIETLEDKVRRLFEQKNDLIKNQKLL-SIA--KDTN-------
A0A2G4GZA6      EDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKSQKLL-SIA--KDTN-------
A0A388P514      EDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLL-SIA--KDTN-------
A0A2A2YG59      EDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLL-SIA--KDTN-------
A0A2G4F7D5      EDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLL-SIA--KDTN-------
A0A7V4IDX4      DEMLVTASGKTLAGIMSELSRLEKDLKRGEDELLAFQSSNSVV-FLQ--EQGN-------
A0A2V2SDN0      RESREKTSDRAVASLARQVNQLANELKAQQEKMYAFQMSNNVV-FLQ--EQGS-------
A0A4Q3BVY2      QENYEEYRDEALRRYAEQVDRLEAEISQTLSSLSSVERSQNLT-EAM--LEQQ-------
A0A8A7W4D3      QQNYEEYRNEALLRYAEQVERLETEITETMSSLSSVERDQNLT-EAI--LEQK-------
A0A3R8L982      IDSVSGRNEDAVSYLNTSADRLRDEANAAEQRLLDYMRRENLV-SLD--NSTN-------
A0A6N6QBS9      KQMLVNLKSSAEATLHREILQSERELENVRDEIDQFTRKWNIA-NFT--DAGA-------
A0A2V5X6Z6      KESREKTTDRTATSLGVEVTQLKGELEAQQEKLHAFQASNNVV-FLQ--EQGN-------
A0A2V5VGZ7      KESREKTSDRTAASLAAEVTQLKSELEAQQEKLHAFQASNNVV-FLQ--EQGN-------
A0A2V5U130      KESREKTSDRTATSLGAEVTQLKGELEAQQEKLHAFQASNNVV-FLQ--EQGN-------
A0A2V6C237      KESREKTSDRTATSLGVEVTQLKGELEAQQEKLHAFQASNNVV-FLQ--EQGN-------
A0A2E7HPU9      GVERATGRTNSSSVLAQKSEEAEKLLNQKENALANYQIIL--------------------
D5EML0          AGLRSSSTGEAVNFLERQVAEMREELELQEVELQDYRQQHNLV-SVQ--QDKG-------
A0A1V6GL40      KEMRSQTSDTTVAGLTEQVMRLEKDLRRAEAEMVQFQSTNSMM-LTQ--EQGN-------
A0A7X7VL75      KEMRSQTSDTTVAGLTEQVMRLEKDLRRAEAEMVQFQSTNSMM-LTQ--EQGN-------
A0A7C4PPJ4      EELTASTVDLSLAETQREIERYERKLEKARQDLLAFQVKHNIA-S---------------
A0A3C1C1M3      RAENRSGSNAAVAWLEAQALAQRQELEKADQELFDARQTLQ-------------------
A0A2S7U4L6      INQETKRRDKTRVELAKKIQKYEDIVEDYRTRLLEFSAKTGIY-SLD--RSSG-------
A0A2E9EYJ1      QEEEQSRAQKALALLDQQIKSQEGRLEKARXNMIELMEELNIV-D----LSLG-------
A0A258AXR6      NNIETGKKHKALEVLQQQISDQEGLRSQAQVRSQEARRKAGIV-GDW--IVGG-------
A0A7W7YD86      NSIETEKKHKALEVLQQQISEQEGLRRQAQVRSQEARRKAGIV-GDW--IVGG-------
A0A3D3NZQ6      VEVESKQKESALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIV-GEW--FSAG-------
A0A1T4WVZ9      VEVETSQKQEALAMLAKQIAEQEQLRDQARLKMQEAKKKGGIV-GEW--FSSG-------
A0A4R7SSI6      VEVESKQKQDALTMLGQQISEQEQLRDQARLKMQEARKKGGIV-GEW--FSNG-------
A0A7W8DNH5      VEVESKQKNEALTMLGKQIAEQEEQRSQARLTMQEAKKKGGIV-GEW--FSNG-------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A2V6FIP7      ----HAATSIDAIPLVAGNPLIQ-------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2V5UAD5      ----IAGGSLARLSTELSDGILQTQLLESRALGLEANGPVG-------------------
A0A7Y4QK88      ----IAGGYLVKLKVQLSDLQLEMRLLNASVPPTNLPPAIA-------------------
A0A1V6GCZ3      ----MTAETLRKIESLRIESQAEYVRQATRLDRLKNLGKEL-------------------
A0A7V3WMH6      ----IEPESLRKLEALRIEAQADCARMETFYQNLTNLTR---------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A2E6T1E0      ----VTLKALIQAQTDFDMARSAEVTAVAAAEEAARVFHET-------------------
A0A5E6MKA7      ----PAEKESVQIRDSLLRARLLMLQKQIRLERAKAALADG-------------------
A0A7W1HKQ4      ------------------------------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ----ADFSTSQALEKEIFDLETQIKLASTLADNLKESERKH-------------------
A0A2N8IV96      ----RSTLTAGMEEEEFRNAKAQAMDFERREKELASYVQEL-------------------
R7E1V8          ----RSTLTAGMEEEDFRNAKSQAMQFEKDEKELASYVQEL-------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      ---------LESIGKELTVSKNEKLKLDTDWKMIQQYSNNV-------------------
A0A2G4I5Z5      ----IVTEEFKSLSERRSAATDERRDMERDFEMTRRVGGKV-------------------
A0A4P5QQV6      ----AAAAYLSKLNTRLAELRNESQLLDLFDADQQIARDRK-------------------
A0A2E7ALI1      ----LEAIKVSDL-----------------------------------------------
A0A178IDB9      ----IVRQKVGLLGNDLAQAQLEQTTLQTLIQLIEDYRKRG-------------------
A0A290QD69      ----VVQQKVTMLGNSLAEAELRQTNLRTLIESVEDYQKNN-------------------
A0A6N6ZC77      ----AAGSNLAALERRRSELRTQMRLLESLDVDMQLQNPEG-------------------
A0A832M896      ----TAGQYLVGLEKELADMNKELQLLEMLSLDQRLSDSPA-------------------
A0A538NJ59      ----IAGGSLARLSTELSDGILQTQLLESRALGLEANGPVG-------------------
A0A2A2R3V9      ----KNATYLINLSKQLDDLNTEFQLLSKLTLDQNIERRST-------------------
A0A3C1VFY9      ----VA-NYLSVLYQRLAESKSEYDLLQSMTLDQNLLLEQG-------------------
A0A2V2SMX4      ----SAGNYLTALNQRLAGLKSELELLRTMSVEQTLERRQQ-------------------
A0A522AC27      ----NYGMYLASLTRKLADLKSEYDLLTTMTLDQNIERQRQ-------------------
A0A6M1RFD0      ----VAGNYLAQLNQQLAMLQSELNLLNMLDLEQNLERQQA-------------------
A0A7C3HXH0      ----VAGNYLAQLNQQLAMLQSELNLLEMLNLEQNLERQQA-------------------
A0A432FDF6      ----TLANH---------------------------------------------------
A0A2E7VDS1      ----DVADRKSQYQGAITLAQVEKLRIQSTLRQIIAIQGRVEQST---------------
A0A7C8D3W3      ----GNENLVTPIREVIVSINRELDRTEIQLQKLELTAKEDYAQF---------------
A0A178IFJ2      ----IVVDRMKAISSALTEAQVALLAIEARLQQAESVIAKN-------------------
A0A357FSP9      ----IAATQLSSLNTIKIENKHLYDNLETRINLIESFRRAG-------------------
A0A1T4WWY4      ----IEMERLSNIPVDIVRAKYRLKEHEEISRILQEQQSSL----------------DVI
A0A3D3LEQ6      ----IELERLSDVPVQQVRVRYKLQEMDGVRQVLKDQGGTL----------------DTV
A0A3D3NW23      ----IELERLSDVPVQQVRVRYKLQEMDGVRQVLKDQGGTL----------------DTV
A0A522ACN3      ------------------------------------------------------------
A0A2A2R174      ----IVTEEFKALNERRAVATDERRDVERDFEMTRRVGVKV-------------------
A0A1H2DTI1      ----SLGSHLAQLNNQLVDRRNEYDLLVKLTAKQGDLQGLP-------------------
A0A1H1MGC9      ----IVTEKLKALNAYVTQTTSRLNEAEIRWRQVQERKATP-------------------
A0A1V5L462      ----KAAGRLSELKTRLEDYRTQLRILESFDENVSLDQIQD-------------------
A0A3D3LGD3      ELRTTGDSMAVTREQAIFQADLDVETLSAEIGQLQTLEGDE-------------------
A0A350ARX4      ----STGAYLARLTTQQAELKTQLLILENLKTGDITTSVVE-------------------
B5JIS2          ----LLAERLKGIDANRIEARLDRFRLETKLGNVKAALGED-------------------
A0A7Y1UGD7      ------------------------------------------------------------
A0A2E5K4P7      ----IFLRELTVLREHLIKKDDVRKAVESRWQQLLAYEAEG-RSL---------------
A0A842HH73      ----IETQEIFQLNQLVTEAKAELDTRESRWQLVQEYVAEG-KQL---------------
A0A2E6NAH3      ----IAAVQLSHLNEIELTNKNIYDQFQTKWDQIETYRLEG-RNL---------------
A0A2A5VZA5      ----IAREQLVTLNQIKLESKNNYDQLDTKWNLIETYKREE-RKL---------------
A0A424R295      ----IAREQLVTLNQIKLESKNNYDQLDTKWNLIETYKREE-RKL---------------
A0A1H2GQN6      ----LLDQELEGKQKQLDDARQDAVARRVRYEQLKNLSTED-------------------
A0A858RDL7      ------------------------------------------------------------
A0A512M3Y3      ----SVPGEMLTTKNRMDSMQQVIEMIESGKLPAVEQLSLL-KKFRGTPVPVGTIMRNSR
A0A4P5R5J1      ----SAATYLSILNRRLDELKTEFNLLQRLDIDQTLDRTPS-------------------
A0A4P5YK43      ----AAQDRLNRLTAELDEIVLVRKRLESYTKDELLEGKMP-------------------
A0A2A2RPW6      ----TSDIQTADFKAMAEKLNEAKDEVRLLELEWGMSQKVG-------------------
B1ZT68          ----VVLQKVGTVGTALVRAQMEQVEMRSVLDKIDEYRKEG-KDL---------------
W0J7C2          ----VVLQKMSSLGTAVVAATLDQIDAKSLIDKIEEYQAGN-RDL---------------
B4D1I7          ----SAGAYLAKLNTQLAEFKKEAQLLDLFQLDQKIAADES-------------------
A0A353F286      AMFQSAKGKLANFETQADQIKIQIGKLVQLTSEELISYAAG-------------------
A0A354FSA6      AMFQSAKGKLANFETQADQIKIQIGKLVQLTSEELISYAAG-------------------
A0A3B9GA54      AMFQSAKGKLANFETQADQIKIQIGKLVQLTSEELISYAAG-------------------
A0A520LEH8      AMFQSAKGKLANFETQADQIKIQIGKLVQLTSEELISYAAG-------------------
A0A6B2M0T8      ----LIVDRMKNLSGSLNDAKVELLNLSATLEKIQEAKGDL-------------------
A0A2D7B7R6      ----SDRLVLDNLKLELSRIQNDLEDLESVGYVDAASEKARPDNL---------------
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      ----AIGAYLAQLNQRITSLKSEYDLLSTLTENAGFLDILT-------------------
A0A7V3QF58      ----AIGAYLAQLNQRITSLKSEYDLLSTLTENAGFLDILT-------------------
A0A832FWF3      ----AIGAYLAQLNQRITSLKSEYDLLSTLTENAGFLDILT-------------------
A0A838YJR8      ------------------------------------------------------------
A0A6N4WVA3      ----AAGVYLAELKREVAELNTESRSLTSILNENAQQKSLLIDQL---------------
A0A0R2XPB1      ----AASTYLAELKRELAELNTENRVLTSILNVDAVKMSLLLDQW---------------
A0A348NQP1      ----AASTYLAELKRELAELNTENRVLTSILNVDAAKMSLLLDQW---------------
A0A357FV58      ----AASTYLAELKRELAELNTENRVLTSILNVDAAKMSLLLDQW---------------
A0A2G4GZN8      ----TLTAERSVLVRDREETRKQIDENEILVLVIASYESEG-RPV---------------
A0A348NPT1      ----IAATQLSSLNTIKIENKHLYDNLETRINLIESFRRAG-RNL---------------
A0A2E1KV60      ----IAAEELASLNQIKTAAKMELDQSETRWNLIQDYLRQN-KDL---------------
A0A2D7F4D9      ----IAAEQLASLNEIKTMAKMNLDQAEIRWNLTQDYQKQG-KEL---------------
A0A3R7RBR8      ----IAAEQLASLNEIKTMAKMNLDQAEIRWNLTQDYQKQG-KEL---------------
A0A2E0NH28      ----IANEQLMTLNAIKSGNKNQFDAQETQWNLIESYRRDG-RDL---------------
A0A368BGT4      ----IAGAQLAHLNEIVLTNKNTYDQFQTKWNQVETYRKEG-RNL---------------
A0A317ZP96      ----IAREQLGSLNTMKLNNKNILDNLETKWNLIENYKREG-KDL---------------
A0A350AS32      ----IAREQLASLNEMKLNAKNVYDMIETKWNLVESYRREQ-RDL---------------
A0A7W8DI01      ----VANNKLEQLPTQMLTYRSQLDAMEEVEKYIDATAPSP-AEKLSLLKKHRDKPLAVG
A0A6N6PLV8      FRAASQERNLLELESRVSTLKLHLDLLQKLKPEELPQALRA-------------------
A0A290QE54      ----IVSDRLKTVNAALSSARLDRLQLEELNNQIASFKKDA-RNL---------------
A0A1H1SWX2      ----IVGERLRTVNATLTTARLARLDIETLLSQIEKMQKENPANL---------------
A0A1D8AZK8      ----IISERLRTINATLTSARLSRIDLENLLGQIERMQQAG-GNL---------------
A0A4Q1C9I5      ----IISDRLRGYNTSLTDARNARIAIENRLAQIERMQQAG-GNL---------------
A0A842HCC8      ----TAGAQLASLKDQQAQLKTQLRLLEEIDLDRFVDQGLP-PGD---------------
A0A1G3ZL71      ----IVADQLRRANEARTAARHERLRVENLFRQVEAYRQNG-RDL---------------
A0A556QP09      ----IAQANLSSVNQALQGARLDRLAIAEQERLVERYQAEK-RNL---------------
A0A2T6DX88      ----IVSDRLKSVNAALQTARLERLSIEEQVNQVASYKREG-RDL---------------
A0A2T6CWI7      ----MSDEALKKAHTMRDDARLRLMAVDEKITQVEAYQKEK-RNL---------------
A0A3E1E5C8      ----IVGTRLTTVNDALTKARLARIDLETQYHQVEAYRKEG-RNL---------------
B1ZZ74          ----IVSERLKTISSTLTSAQLVRLNFENQYALVEAYRKEG-RNL---------------
A0A2E0V4K6      ------------------------------------------------------------
A0A7W1VQ11      ----HYKGIRKDLLIVTNKLGMMERTRQILDSQSFDTMGKL-SVL---------------
A0A2V6F9Q9      ----SAAQYLVKLNQDFARLKTEYELLQKLDLDQNLDRGEK-TKT---------------
A0A2V6NZZ3      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK-TQT---------------
A0A2V6EBU2      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK-TQT---------------
A0A2V6EY06      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK-TQT---------------
A0A2V6ME53      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK-TQT---------------
A0A538NUU0      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK-TQT---------------
A0A2V6NIJ1      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK---T---------------
A0A2V6C292      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK---T---------------
A0A2V6D2X0      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK---T---------------
A0A2V5ZUK1      ----SAAAYLVKLNQQYAQLKTEYALLNLLDLDQNLDRAQT--KL---------------
A0A7W1MVB5      ----SAAAYLVKLNQEYAHLKTEYDLLSLLDLDQNLDRQQA--TP---------------
A0A7W1U7H7      ----SAAAYLVKLNQEYARQKTEYDLLSLLDLDQNLDRQQA--VP---------------
A0A2V5XFN9      ----SAAAYLVKLNQQYAQLKTEYALLNLLDLDQNLDRAQN--RT---------------
A0A2V6EZC8      ----SAAAYLVKLNQQYAQLKTEYALLNLLDLDQNLDRAQN--RT---------------
A0A2V6I7Z5      ----SAAAYLVKLNQQYAQLKTEYALLNLLDLDQNLDRAQN--RT---------------
A0A3B9LCP2      ----SAAAYLVKLNREYAGLKTEHDLLSLLDLDQNLDRAQI--KP---------------
A0A3C0R669      ----SAAAYLVKLNREYAGLKTEHDLLSLLDLDQNLDRAQI--KP---------------
A0A2V6EID2      ----SAAAYLVRLNRDYAGLKTEYDLLNLLDLDQNLDRAQN--KS---------------
A0A2V6MHB0      ----SAAAYLVRLNRDYAGLKTEYDLLNLLDLDQNLDRAQN--KS---------------
A0A7V9V4N8      ----SAAAYLVRLNQQYAQLKTEYELLEKLDLDQNLDRGQM--P----------------
A0A838I5D7      ----SAAAYLVKLNQQYASLKTEYELLEKLDLDQNLDRGPA--SN---------------
A0A2W5YWL9      ----SAAQYLVKLNQDYARLKTEYELLEKLDLDQNLDRGQS-T-----------------
A0A2V5NH62      ----SAAAYLVRLNQQYAQLKTEYDLLSLLDLDQNLDRAQG-K-----------------
A0A2W6A620      ----SAAQYLVRLNQQYAQLKTEYDLLSLLDLDQNLDRTSG-K-----------------
A0A2V5PIJ4      ----SAAAYLVKLNQSFAALKTEYDLLSMLDLDQNLDRKQV-Q-----------------
A0A2V6K2G8      ----SAAAYLVKLNQQYAQLKTEYDLLNLLDLDQNLDRAQN-K-M---------------
A0A2V5W206      ----SAAQYLVKLNQQYAQLKTEYDLLNLLDLDQNLDRAQN-K-T---------------
A0A2V6MW77      ----SAAQYLVKLNQQYAQLKTEYDLLNLLDLDQNLDRAQN-K-T---------------
A0A838MZM0      ----SAAQYLVRLNQQYAQLKTEYELLEKLDLDQNLDRGQM-P-----------------
A0A838DHH0      ----SAAQYLVRLNQQYAQLKTEHELLEKLDLDQNLDRGQG-A-----------------
A0A838FJZ1      ----SAAAYLVRLNQQYAMLKTEYDLLEKLDLDQNLDRSQA-AST---------------
A0A0E3YV65      ----IVVDRMKALSSTVTGARVSRVTIEARLNQAEFIMAGG-GDP---------------
W0J900          ----IVVDRMKAISSALTEAQVARFAINARLQQAESIISKN-SDP---------------
B4CZV9          ----KTLILVNSINNLPADLTKLQMRIDEIGRVRVRLQDPA-LDS------------VAK
A0A7X1AX64      ----VALSELQSITARLNAAEAEYSSVEAQWELVQQYREEG-RPL---------------
A0A3B9FM17      ----DTGDRKSQFSSEVTKSRLEQIRINSLLRQILAIKTRI-GSN---------------
A0A7W7YGS1      ----RLSNIPVDIVRTKYRLKEHEEISAVLAQQGNALDVVG-KLS-------------LV
A0A2D7WMI4      ----DNATRKSQYQSEITRCNIEQLRLDSTLSQIRSILKRI-NSN---------------
A0A2D6VHX5      ----INSSKKSQFQAKITASKLDQIQINSILRQILDIRKRI-SSN---------------
A0A2D8I214      ----DTADRKSQYSAEVTTSKLEQIKIDSLLRQVLQIQARI-GSR---------------
A0A1Z8VL41      ----SIFARXSQYQSEITRSKXXQXKITTLLKQIINVRVNI-GVQ---------------
A0A2E6TNA4      ----SIFARKSQYQSEITKSKLEQIKITTLLKQIINVRXNX-GXQ---------------
A0A1Z8RG47      ----DTADRKSRYQAEITKCKLEQIRINSLLRQILQIQMRI-GNE---------------
A0A1Z8RJJ5      ----DTADRKSRYQAEITKCKLEQIRINSLLRQILQIQMRI-GNE---------------
A0A2D7V631      ----DTADRKSQYQAEITRCKLEQIRINSLLRQILQIQMRI-GAQ---------------
A0A354RA24      ----DTADRKSQYQAEITRCKLEQIRINSLLRQILQIQMRI-GAQ---------------
A0A2E9RV62      ----DNAARKSSYHSEITKAKVEKVRINSLLRQIIQIQASI-SSR---------------
A0A2E4AY96      ----DISAKKSQYQAEITRCRIERLRIESLKSQVLAVDNKI-------------------
A0A3B9B9P4      ----DISAKKSQYQAEITRCRIERLRIESLKSQVLAVDNKI-------------------
A0A2D5Y6N6      ----DTSARKSQYQSEITSSKLEQIRINSLLRQILQIQVRI-GSQ---------------
A0A2E7HSS8      ----DTGTRKSQYSEEVTKSRLEQIRINSLLRQILAIKTRI-GSG---------------
A0A2D8VCK3      ----DTGDRKSQFSSEVTKSRLEQIRINSLLRQILAIKTRI-GSN---------------
A0A350QVY4      ----DTGDRKSQFSSEVTKSRLEQIRINSLLRQILAIKTRI-GSS---------------
A0A2E4ZYR7      ----DVADRKSQYQSAITQAQVEKLKIQSTLRQIIAIQGRV-ERA---------------
A0A2E6TCV1      ----DNAERKSQYQNAITTADVKLLEIDSHLVSIRGIHNKV-VQS---------------
R7E4L8          ----ATFNRVQEIGTELFSTRTELIQVKVLARLLADRSRQQ-DMI---------------
A0A4P6PCA7      ----SLRAILADLGTQKAGLENQLALRQTEYDYLSEWEESG-RSI---------------
A0A2T6DSN5      ----VIAQKVVQLGQSLVGIELEQTNLRTILETIETYQKNN-RDL---------------
A0A317ZIW7      ----AAGTYLADL---KRRLAELKTESRTLSSISDSSEVEE-LIL---------------
A0A7C4PPT4      ----ELQTKLALLQEVPKQLVEVSERLEVLERVKKTLDDES-MDA--------VSRLSLL
A0A7C4QZX4      ----EIAVKMDELKQLPRKIAIISSRLSQLDRIQSTLESTN-LSL--------VDKLSLL
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      ----SVGAYLAEL---NQQLAELETQYRFLDTLSLDAIGER-AQA---------------
A0A366HV03      ----SLAQIPLDILRVQHRMRQYDEVRGIVQSRSQNSVIAP-LEHLSLLESAKKSSLDEN
A0A6G6K911      ----ALAQIPLDILRVQHKIRQYDEVRSIVESRVQNGAMDP-LEHLSLLDSAKKSSLDEN
A0A832HT83      ----HLRELPQQIV-------EVTERISLLEQIRKGLDDPN-PDPAVKLALLCSLLRKST
A0A5R8KAF2      ----RLFMVPAELIMTKEVVRRMEE-----VRLSLDQRGTL-GTAPEKLTAEQIFAELSM
A0A7C4LRZ6      ----AAQQRLDGLLDEYTAVQTLRQRLENKTSLDLLKGGVM-DAP---------------
A0A351MR11      ----TLGSERGALVKDREELRRQIDELAIIWEQIEQFKKEG-KDL---------------
A0A388PR45      ----SIAAQRSKLIQDREDYRKQLDEIGIVVALVAQYRAAG-RDL---------------
A0A388QR61      ----SIAAQRAKLIQDREEYRKQVDEVGIVVALVKQYRVAG-RDL---------------
A0A4P5YHI0      ----SIAAQRAKLIQDREEYRKQVDEVGIVVALVKQYRVAG-RDL---------------
A0A2A2RS01      ----TLNTERGVLVRNREDARKQIDELEIIWKLILEYKTAG-KDA---------------
A0A2A2Y1A7      ----TLNTERGVLVRNREDARKQIDELEIIWKLILEYKTAG-KDA---------------
A0A388PDH9      ----TLNTERGVLVRNREDARKQIDELEIIWKLILEYKKAT-KDV---------------
A0A2G4H1E7      ----TLTAERSVLVRDREETRKQIDENEILVLVIASYEQEG-RSL---------------
A0A2G4GZA6      ----TLTTERSVLVKDREETRKQIDENEILVSVIASYEKES-RPL---------------
A0A388P514      ----TLTTERSVLVKDREETRKQIDENEILVSVIASYEKEG-RPL---------------
A0A2A2YG59      ----TLTTERSVLVKDREETRKQIDENEILVSVIASYEKEG-RPL---------------
A0A2G4F7D5      ----TLTTERSVLVKDREETRKQIDENEILVSVIASYEKEG-RPL---------------
A0A7V4IDX4      ----SAAVYLDKL---NRQLASLQSELQLLNSLTLDQNLER-QAR---------------
A0A2V2SDN0      ----GAGSYLALL---NRQLATLRTELQLLQLVQPDQWVEI-GSR---------------
A0A4Q3BVY2      ----SLLEIPKQLIQTRERLARMRDVRILLTNLENKASAEG-SEG-GTGSDQKIGNMMSL
A0A8A7W4D3      ----SLLEIPKQLIQTRERLARMRDVRVLLETLESQPEKPG-DPSLGDGPGGKMGNMMSL
A0A3R8L982      ----IVRERLTSV---NAALQTARLERLAIENLNNQVEAFR-KDN-----KDLIEL----
A0A6N6QBS9      ----RSRERLERA---KSEYLTLQTERKLYEAATAEEVAAG-NIE-----SKRPARVRVS
A0A2V5X6Z6      ----SAGSYLASL---NKQLATLRTELRLLQSLQPEQWIET-GHK-----GVPSG-----
A0A2V5VGZ7      ----SAGSYLASL---NKQLATLRTELRLLQSLQPEQWIEA-GHK-----VVPSSESLPD
A0A2V5U130      ----SAGSYLASL---NKQLATLRTELRLLQSLQPEQWIET-GHK-----GVPAGESLPD
A0A2V6C237      ----SAGSYLASL---NKQLATLRTELRLLQSLQPEQWIET-GHK-----GVPSGESLPD
A0A2E7HPU9      ------------------------------------------------------------
D5EML0          ----ITADRLARL---N----DALTDAEIRQLSVETRQRQI-AAA-----DGVIDRLMEI
A0A1V6GL40      ----SPAHYLTTL---YQRLVTLKSEYALLQRLTLDQNLAR-RQA-----AGGTFSLGNE
A0A7X7VL75      ----SPAHYLTTL---YQRLVTLKSEYALLQRLTLDQNLAR-RQA-----AGGTFSLGNE
A0A7C4PPJ4      ----VKETADAA---------QQRLDKLLDEMTAVQTLRQR-LEN-----KSSRDLLKGG
A0A3C1C1M3      ------------------------------MDVLAGRRKTI-EES-----LLHFNESLSE
A0A2S7U4L6      ----GATDVVRR---------DLQQENMLYDEAVKARDE-----------------LERQ
A0A2E9EYJ1      ----EPVWLRGS---------QPNTGT---ASLVMAAKQRE-FAA-----EEAIQNLRST
A0A258AXR6      ----GSSLNPGG---------EMRSEK---DSMVISREQAL-MIA-----DQEILTLQSE
A0A7W7YD86      ----NNSLTPGG---------EMRSEK---DSMVISREQAL-MQA-----DQDILALQSE
A0A3D3NZQ6      ----PNSTVPGA---------ELRTTG---DSMAVTREQAI-FQA-----DLDVETLSAE
A0A1T4WVZ9      ----TNSTAPGA---------NLRTTE---DSMVVTREQAL-LNT-----ELEVQALQAE
A0A4R7SSI6      ----SNSTAPGS---------TLRTKE---ESMVMSREQAL-LQA-----DLEVQSLRAE
A0A7W8DNH5      ----TNSTTPGA---------NLRTTE---DSMVVTREQAL-LQA-----DLEVQSLSAE
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ---------------------------------ASTLADNLKESERKQGLISVETGLPDS
A0A2V6N5E0      -------------------------DLDQNLDRAQNKTEAASGQGSDNQGMPFSDVGPEG
A0A2V6NH44      ---------------------------------------------------PFSDVGPEG
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------AGVSVGLNGPLLGADSEIPSTGTS
A0A7Y4QK88      ------------------------------------TNLNSIARETSATPNSTPSSAASA
A0A1V6GCZ3      --------------------------------GPEGLAQAITTDAPDTLLT---------
A0A7V3WMH6      ----------------------------------EELRKAVATASPDPQLV---------
A0A2S7U0Z3      ------------------------------------------------------------
A0A2E6T1E0      -----------------------------------KQYGTIPEVATDTEVR---------
A0A5E6MKA7      ----------------------------------------RAGVPENPYTL---------
A0A7W1HKQ4      ------------------------------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------GLISVETGLPDSGIA---------
A0A2N8IV96      ----------------------QRLPDDKLLDYVISSDLLNAETVGADALR---------
R7E1V8          ----------------------QRLPDDKLLDYVISSDLLNAESVGAKALR---------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      -----------------------------------ERLLTVQSILDDKQVS---------
A0A2G4I5Z5      -----------------------------------SELLILASISRAPEVA---------
A0A4P5QQV6      ------------------------MPKPDGGDLREGDPRIPSATGPLLEYE---------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      -----------------------------------QSLYEISAIIGFGNVA---------
A0A290QD69      -----------------------------------KNILEISDIASYGNVS---------
A0A6N6ZC77      ----LG------------------------------LDKALLNSAATDDYQ---------
A0A832M896      ----PS------------SGGAEG--------NADDSSAAIAAAGPEQDYL---------
A0A538NJ59      ----AG----VSVGLNGPLLGADS----------------EIASTGTSERQ---------
A0A2A2R3V9      ----NTSKPQTTTKNPATTNTAEKRTPDSEEIKAAAGDLLSPE----SEYR---------
A0A3C1VFY9      ----RS----PALAGAGMPGGLGTGNGILANAALGGQSTLFAPSTMGMQYL---------
A0A2V2SMX4      ----GG----GVLPAPEPVADVNN----------SASSSLSANDSSQNDYF---------
A0A522AC27      ----QG----VAS--TSSEAGSER----------GGGG---RN----ANYE---------
A0A6M1RFD0      ----AG----VITGVRPVPPGQQR----------SPVDVLRAD----SEYL---------
A0A7C3HXH0      ----SG----VITGVRPVPPGQQR----------SPVDVLRAD----SDYL---------
A0A432FDF6      ------------------------------------------------------------
A0A2E7VDS1      -----------------RTTKDNEHARTNDEMEKIKEYFEISAVETYGNVQ---------
A0A7C8D3W3      ----------------------VSSGASSSSPLNSTANQLTEPFIKDTNDERYRKIAKDS
A0A178IFJ2      -----------------------------------SSPLELASITEFSSLA---------
A0A357FSP9      -----------------------------------RNLSELPFIAEQGQVS---------
A0A1T4WWY4      GKLSLISGFTDEEKDPLEAGRVVRKGG---AVAPFTFSSPSTDKKFTQVVVQPNMVDGLK
A0A3D3LEQ6      GTLALLTSMTSDKDDPLSVGRIVRRTGDPRTSAPATFQTPEMAKEYNQIVVQPDMVEGIE
A0A3D3NW23      GTLALLTSMTSDKDDPLSVGRIVRRTGDPRTSAPATFQTPEMAKEYNQIVVQPDMVEGIE
A0A522ACN3      ------------------------------------------------------------
A0A2A2R174      -----------------------------------AELLTLSTVSRVPEVV---------
A0A1H2DTI1      ---------------------------VVAGASNSQQESRMRLAAATTEFFKAQQ-----
A0A1H1MGC9      -----------------------------------AQLLDLPFISSSQLIG---------
A0A1V5L462      -------------------------------------VVNLDTIESSQNYR---------
A0A3D3LGD3      -----------------------------------LVARAGGLKLDNANVA---------
A0A350ARX4      -------------------------------------QSPLIEAESVALLN---------
B5JIS2          -----------------------------------GRPFDNPFLANFANNE---------
A0A7Y1UGD7      ------------------------------------------------------------
A0A2E5K4P7      --------------------------------------LDLGFISNTTHVA---------
A0A842HH73      --------------------------------------WDLPFISMRQRIS---------
A0A2E6NAH3      --------------------------------------WELPFVAEQSRVA---------
A0A2A5VZA5      --------------------------------------WQLTFVAEQSRVS---------
A0A424R295      --------------------------------------WQLTFVAEQSRVS---------
A0A1H2GQN6      ----------------------------------------------LIDTLPSLGLNDAN
A0A858RDL7      ------------------------------------------------------------
A0A512M3Y3      PDEVVSIAAPIAGSTVAGLSSDSPSAPIPAVPAGASAGAMMIAAMSQPKIVVPSMVEELE
A0A4P5R5J1      -------------------------VATGAEGQLNRMDSLAGAPGPLAEYL---------
A0A4P5YK43      --------------------------EILSKNPAKDAASAVTAGPDKSKTADPLAPFRQN
A0A2A2RPW6      --------------------------------NSVDELLKLPMISRSPEVA---------
B1ZT68          --------------------------------------FEIPAILGYGQVS---------
W0J7C2          --------------------------------------LEITQIRTSGQVA---------
B4D1I7          -----------------------------RAGDKDGERNPRLTGQPEMEYT---------
A0A353F286      ------------------------------------LDLPQNQVTA--------------
A0A354FSA6      ------------------------------------LDLPQNQVTA--------------
A0A3B9GA54      ------------------------------------LDLPQNQVTA--------------
A0A520LEH8      ------------------------------------LDLPQNQVTA--------------
A0A6B2M0T8      -----------------------------------DLLAKLPAINQMGTLP---------
A0A2D7B7R6      ------------------------------TNEQLEIVSLIPSVAKNEDFK---------
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      -----------------------------------GEQTPLITDQLVGQRAIRIEDSVSA
A0A7V3QF58      -----------------------------------GEQTPLITDQLMGQRAVRIEDSVSA
A0A832FWF3      -----------------------------------GEQTPLITDQLMGQRAVRIEDSVSA
A0A838YJR8      ------------------------------------------------------------
A0A6N4WVA3      -------------------------QGAGRGEAPSSEAFNGGGVDENQKYI---------
A0A0R2XPB1      -------------------------QGA----EDTSSATTGGSAGDNQSYQ---------
A0A348NQP1      -------------------------QGA----EDTSIAASGGSDGDDQSYQ---------
A0A357FV58      -------------------------QGA----EDTSIAASGGSDGDDQSYQ---------
A0A2G4GZN8      --------------------------------------GDIPQIRADNDVA---------
A0A348NPT1      --------------------------------------SELPFIAEQGQVS---------
A0A2E1KV60      --------------------------------------WELPFISQQIRVA---------
A0A2D7F4D9      --------------------------------------WELPFISEQIRVA---------
A0A3R7RBR8      --------------------------------------WELPFISEQIRVA---------
A0A2E0NH28      --------------------------------------WELSFIADQSRVA---------
A0A368BGT4      --------------------------------------WELAFVAEQLRVS---------
A0A317ZP96      --------------------------------------WELSFIAEQERVA---------
A0A350AS32      --------------------------------------WELSFISEQSRVA---------
A0A7W8DI01      TIVRRGAEVDPFLTKTNAPDILMAGTGAVAVEPPKRAAAGASSAATTSTIVIPENSKRTE
A0A6N6PLV8      ----------------------------------------LQIIDPAVEK----------
A0A290QE54      --------------------------------------LEIAAISNHGTIP---------
A0A1H1SWX2      --------------------------------------LEIGYISAYGNIP---------
A0A1D8AZK8      --------------------------------------LEIGYITAYGNIA---------
A0A4Q1C9I5      --------------------------------------LDIDYISAYGNVA---------
A0A842HCC8      ----------------------------------EQALVESVLTETDTEYG---------
A0A1G3ZL71      --------------------------------------LELSEITGYGNIP---------
A0A556QP09      --------------------------------------LEITAIAAYGSVP---------
A0A2T6DX88      --------------------------------------LQISSIANHGTIP---------
A0A2T6CWI7      --------------------------------------FEVVEIANYGAVP---------
A0A3E1E5C8      --------------------------------------MEIAYIAGHATVP---------
B1ZZ74          --------------------------------------VEIQFIAGHGTVP---------
A0A2E0V4K6      ------------------------------------------------------------
A0A7W1VQ11      --SALEKELD---------PSLNIGQILQQDNGSFGGSETESSSSSVVIVPGMVQSPNRQ
A0A2V6F9Q9      -------------------EASPGASPTD------QAGMPFSDVGPEGDYL---------
A0A2V6NZZ3      -------------------EASPNPSAND------QVGMPFSDVGPEGDYL---------
A0A2V6EBU2      -------------------EASPNPSAND------QVGMPFSDVGPEGDYL---------
A0A2V6EY06      -------------------EASPNPSAND------QVGMPFSDVGPEGDYL---------
A0A2V6ME53      -------------------EASPNPSAND------QVGMPFSDVGPEGDYL---------
A0A538NUU0      -------------------EASPNPSAND------QVGMPFSDVGPEGDYL---------
A0A2V6NIJ1      -------------------ESSPGASPTD------QVGMPFSDVGPEGDYL---------
A0A2V6C292      -------------------ESSPGASPTD------QVGMPFSDVGPEGDYL---------
A0A2V6D2X0      -------------------ESSPGASPTD------QVGMPFSDVGPEGDYL---------
A0A2V5ZUK1      -------------------DSSSGQASD-------NQGLPFADVGPEADYL---------
A0A7W1MVB5      -------------------RAAENGSPAP------NEGMPFADVGPEGDYL---------
A0A7W1U7H7      -------------------HPSESSSPAP------NEGMPYSDVGPEGDYL---------
A0A2V5XFN9      -------------------ETAASNQPVE------NGGLPFSDVGPEADYL---------
A0A2V6EZC8      -------------------ETAASNQPVE------NGGLPFSDVGPEADYL---------
A0A2V6I7Z5      -------------------ETAASNQPVE------NGGLPFSDVGPEADYL---------
A0A3B9LCP2      -------------------ESLANGQTAE------DQGLPFAGVGPEGDYL---------
A0A3C0R669      -------------------ESLANGQTAE------DQGLPFAGVGPEGDYL---------
A0A2V6EID2      -------------------EMNLGGQSTE------DQGMPFSGVGPEGEYL---------
A0A2V6MHB0      -------------------EMNLGGQSTE------DQGMPFSGVGPEGEYL---------
A0A7V9V4N8      -------------------KADTGASPAA-TDSPEQVGMPFSDVGPEGDYL---------
A0A838I5D7      -------------------KPEAGASPAGEAPQPPQQGMPFSDIGPEGDYL---------
A0A2W5YWL9      --------------------AKPEASPSASASEQT--GMPFSDVGPEGDYL---------
A0A2V5NH62      --------------------NDMPSAPNTQSNDDKPPGMAFSDVGPEGDYL---------
A0A2W6A620      --------------------NDGTTPPSTQSTDEKAPGMAFSDVGPEADYL---------
A0A2V5PIJ4      ---------------------PDGAGSTNTQPSDDSAGMAFTDRGPEGDYL---------
A0A2V6K2G8      -------------------DSAGGANPGS-----DNQGLPFSDVGPEGDYL---------
A0A2V5W206      -------------------EAASG--QGS-----DNQGMPFSDVGPEGDYL---------
A0A2V6MW77      -------------------EAASG--QGS-----DNQGMPFSDVGPEGDYL---------
A0A838MZM0      -------------------KAEGGASPAATTESSDQVGMPFADVGPEGDYL---------
A0A838DHH0      -------------------KPEAGASPGAPGSEQAAQGMPFSDVGPEGDYL---------
A0A838FJZ1      -------------------SPQTGASPAA--GEVPLQGMPFSDVGPEGEYL---------
A0A0E3YV65      --------------------------------------LELAAATEFANLS---------
W0J900          --------------------------------------LELASVTEFSSLA---------
B4CZV9          LSLIASADDN---------DTRLSVGQTVAQPQSGQSADKKDAAANNSVVVVPSLLKSLH
A0A7X1AX64      --------------------------------------------------WDLDFISARP
A0A3B9FM17      ----------------------------SNSVSSKDIKDDIAVIKEFFEIDAIEQFGNIP
A0A7W7YGS1      SNFTDSEKDP---------LEAGRVVRKAGGAAPFTFSSPSTDKKVTQLVVQPNMVDGLK
A0A2D7WMI4      --------------------KE-------SSNS---IEERFELFSEIFKIDEIENFANIP
A0A2D6VHX5      --------------------KESSIDSTNTGVD---VESNIAQIKQYFEIDVIEGFGSIP
A0A2D8I214      --------------------NSSS-----RSKD---IDNDIALIKDFFEIDAIESFGNVP
A0A1Z8VL41      --------------------NESL-----KSQD---IETDIAMIKEFFEIDAIESYGSVP
A0A2E6TNA4      --------------------NESX-----KSQD---XEXDXAXIKEXFXIDAIESYGXVP
A0A1Z8RG47      --------------------TSSL-----QSAD---VAGDIAVIKEFFELDAIESYGNIP
A0A1Z8RJJ5      --------------------TSSL-----QSAD---VAGDIAVIKEFFELDAIESYGNIP
A0A2D7V631      --------------------TSSL-----KSDD---VEGDIAVIKEFFELDAIETYGSIP
A0A354RA24      --------------------TSSL-----KSDD---VEGDIAVIKEFFELDAIETYGSIP
A0A2E9RV62      --------------------IQND-----GASKD--VNANIDAIKEYFKIDAIESFGNVP
A0A2E4AY96      ---------------------KSR-----KVES---IEERYALFGEFFKIKEINQFGRIA
A0A3B9B9P4      ---------------------KSR-----KVES---IEERYALFGEFFKIKEINQFGRIA
A0A2D5Y6N6      --------------------SEST-----SSQD---IDDDIAVIKEFFEIDAIESYGSIP
A0A2E7HSS8      --------------------SDSV-----SSKD---VNDDIAVIKEFFEIDAIEEYGNIP
A0A2D8VCK3      --------------------SNSV-----SSKD---IKDDIAVIKEFFEIDAIEQFGNIP
A0A350QVY4      --------------------TNSV-----SSKD---IKDDIAVIKEFFEIDAIEQFGNIP
A0A2E4ZYR7      --------------------TNAV-----KDNEHARANAETDKIKEYFEISAIEGYGNVQ
A0A2E6TCV1      --------------------LKAL-----TATGPARTTAKIKIIEDFFKISAIAEYGNVN
R7E4L8          ---------------------------------------PANIGIQDAGIA---------
A0A4P6PCA7      -------------------------------------ETLPTGLPKEQQLY---------
A0A2T6DSN5      --------------------------------------MEIPQIASFGGVG---------
A0A317ZIW7      -------------------------KDVPTPDDGSSDGTIVSAIGSKEDNE---------
A0A7C4PPT4      AAILKNSTIR---------PGDLVPAGDG------SAKASVVVLPPNVTSP------SQM
A0A7C4QZX4      QVLQRESQLQ---------PGEVINAGTGEEIAGENPKTALVVLPTMLPQG------NTP
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D4HHL8      -------------------------VAELAKAKRKNNTEVVPAENHSGAALTSELYKLSE
A0A366HV03      -------PVG---------QLVVPASGDLKDALLVPSNSPAPLAAP-SIVVQPSMVEGLN
A0A6G6K911      -------PVG---------QLVVPATGDLKDNLLTPSVAPVAAITPSSIVVQPSMVEGLN
A0A832HT83      LKTGDVVSTP---------DLGPLSPVPGPRPNTVVVVPDMAAPPQEKRWE---------
A0A5R8KAF2      LTAFEKEREL---------RVGDLLRRQSQQGMVDKPEGAPAQPVPASFVVQPNMVEGLR
A0A7C4LRZ6      ---------K---------RPPARGSEDALGPNRREASDPLERFLGESKYA---------
A0A351MR11      --------------------------------------VLIPMVKSDDRVA---------
A0A388PR45      --------------------------------------SEIPLVRSDADVA---------
A0A388QR61      --------------------------------------AEIPLVRADVEVT---------
A0A4P5YHI0      --------------------------------------AEIPLVRADVEVT---------
A0A2A2RS01      --------------------------------------YDIAQVRTDERVA---------
A0A2A2Y1A7      --------------------------------------YDIAQVRTDERVA---------
A0A388PDH9      --------------------------------------YDIAQVRTDERVA---------
A0A2G4H1E7      --------------------------------------GDIPQIRADTDVA---------
A0A2G4GZA6      --------------------------------------GDIPQIRADTDVA---------
A0A388P514      --------------------------------------GDIPQIRADSDVA---------
A0A2A2YG59      --------------------------------------GDIPQIRADSDVA---------
A0A2G4F7D5      --------------------------------------GDIPQIRADSDVA---------
A0A7V4IDX4      -------------------------------PGDSGADALAGLTAADANYF---------
A0A2V2SDN0      --------------------TRPSGPGEPPAGEASPQDIMAGLTGPQSDLF---------
A0A4Q3BVY2      --LSLLGSFE---------NEAEVNVGDIVP-NGQFKGSLTSVKTPETNIVSPAEVDSIE
A0A8A7W4D3      --LSLLGSFE---------DDTDVNVGDVIPSSGTRTTTVRSNSGDSTHIISPSDVDPIE
A0A3R8L982      --------------------------------NIISTYGTVPALRAQLAEH---------
A0A6N6QBS9      --KDRTQEEQ---------DEEGYLQSASYPALKFELRKLQALYLEKGNNL---------
A0A2V5X6Z6      -------------------------------------EMLASLAEPQLELF---------
A0A2V5VGZ7      --------------------------------QATEKEMLASLAEPQLELF---------
A0A2V5U130      --------------------------------PATEKEMLASLAEPQLELF---------
A0A2V6C237      --------------------------------QAAEKEMLASLAEPQLELF---------
A0A2E7HPU9      --------------------------------LTLEDLEKREATFSELDLR---------
D5EML0          --------------------------------PYIGERDAVNAVYAQLSEL---------
A0A1V6GL40      PLAEGNDSLP---------DTNAVALTAG---GTPGQSSTAAGDRGDTAYL---------
A0A7X7VL75      PLAEGNDSLP---------DTNAVALTAG---GTPGQSSTAAGDRGDTAYL---------
A0A7C4PPJ4      --MVETRRMP---------DRTTSDASQP---APQSTGDTLERLLSESKYA---------
A0A3C1C1M3      --VEAKASME---------QKMLDALSEGKLPAEIPGAADVAASLDRWRQA---------
A0A2S7U4L6      --VKDLVGLD---------DETLISHVSG---LNRPESAVLALTFQQYQDA---------
A0A2E9EYJ1      --IKSLTQLE---------GAELIKSAVD---LGVKNETLNSGW-SEYQTL---------
A0A258AXR6      --IDQVSKLT---------PDELIDQASG---LRLENQNITAIT-VKLQDL---------
A0A7W7YD86      --IDQVSKLS---------PDELIEQASG---LKLENQNILAMT-SKLQEL---------
A0A3D3NZQ6      --IGQLQTLE---------GDELVARAGG---LKLDNANVAQMT-GELQRL---------
A0A1T4WVZ9      --IAELSKLS---------DEELVARSSG---LKLENANVTNML-AELTRL---------
A0A4R7SSI6      --IDELSKLE---------GDELVSRASG---LKLENTNVTGMM-ADLNKL---------
A0A7W8DNH5      --IDELSKLE---------GDELVARASG---LKLENANVTSMM-ADLNKL---------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      GIARQIEHYNEAYLEYQKI-AGSAGSQNPITVSLKDRMNST-------RAAANKALSNYR
A0A2V6N5E0      DYLKAKQQIQLLKAERETL-AKDLRPNHPKILKLNDEITKQDKLIQLFRADALEKLKTRR
A0A2V6NH44      DYLKAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIELFRSDAFEKLETRR
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ----------------------------------------------------------QL
A0A356FSV4      ------------------------------MIQLLQRLQESEIELTEAVTNSTDKIYAAY
A0A3D3DET9      ---------MLLRVEQQEL-GRYLRPNHPKMIAMQEDIARREELLKILRTQSEEQLKNRK
A0A355SVK9      ---------------------------EVELVSAVEN--------------SVGKVDSAY
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ---------------------------HPKIIAATEEIAHLERLLPIYREQSNEQLTNKL
A0A353DI77      ---EAEKEMAVAEKAVQDL-SIRYGPKHPKIISATDHIDLKTKILLSAMMDVLSNDLETD
A0A2V6FIP7      ---DMRKSLAEREALLANL-LKRYKDKYPDVIRVREEIASLKESIQKESQKVRQAIRAEA
A0A3C1UJT2      ---SINGLYKAAKTTVRNL-EVDLKSKHPLMIDALRNVNNTRRVLLETISDVPKGLYAQI
A0A258AXL1      --------------------SNSLLPGHEKMRELRKQIENYQFSLDAEWKKQIASFHLEK
A0A2V5UAD5      ERQGASRDLELLKLQRERL-SKFLRPKHPKIAQLDTQIQRAEKLIELFRNQSREQIAAAQ
A0A7Y4QK88      ETQSSFKEVELLKMQRAKL-SQFLRPKHPKIVKLDADIERGRRLQEIFGQQSRDQLAAAR
A0A1V6GCZ3      ---SLLDQLTMAEQRLIAL-EADYGPENTEVLKCKGLAEDLHKKIKSRVEGIMLGLDTRV
A0A7V3WMH6      ---ELLSKLHETKQRLASM-EASYGPEHPDFKATQMLRDEVDKQIEDRLDGILTGLKAKV
A0A2S7U0Z3      ------EQIQEKRNQVIIL-RQRYLPKHPARIQEEALYTDLLESFGGAIKRSSGKPSEKS
A0A2E6T1E0      ---KIRGDLALAEAELAEL-LKRYLDKHPKVIEKRGKIESLIEGLASSQKRIFDSIINKA
A0A5E6MKA7      ---EIKKLLLKEVARYQQM-EETYKPEYPGMTRLHAEIEGLKGELAQEKEGSVADLEADF
A0A7W1HKQ4      ---ILPNYQEAVASEAQLL-NSGLGENHPKVKALRATKAIYVRQLEQQVTSVRDALKRNL
A0A6B3L936      ------QELNTFRSELSAF-RQRYKSKHPRLIEAEAIYQDLYRRFRLEIETAARTGDEVD
A0A2N8IR72      ---RQIEHYNEAYLEYQKI-AGSAGSQNPIAVSLRDRMNSTRAAANKALSNYRSNLDLKL
A0A2N8IV96      ---KTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLKSKL
R7E1V8          ---ETYAEFSDKLKEKENLKAQNIGARHPKMLALLETERILGEKLNKELIGLRSSLKSKL
A0A2E0R252      ------DEIRGSETAIAQM-EKRYLPKWPALVEAKELGAILKKNFSKELDQVIRLSDEEK
A0A3E1EF48      ------KRIETTRIAIIEM-EKRYLPKWPDLIEAKELLALLLNRFSTELAQVIAGSAEEQ
A0A2A2PVG8      ------KEIDEAERQVAEM-EKRYLPKWPALVEAKELLKILQDRFVQEFNQVMNLSEEER
A0A2E0R421      ------TEIKLVESRIAGM-EKRYLPKWPALVESKEHSKILKQRFSAELERVLRLSEEER
A0A2E5EJ69      ---ALRTQELEKRSEISQL-EERYREKHPKMIAARKEVVDLGARLQEAILAAPSKVHTTI
A0A2G4I5Z5      ---ALKEKLQVQEATLANH-QLRYREKHPEMIKAKTELESIRQQFEVEVLKAPLRLNQQL
A0A4P5QQV6      ---RARQRIETLKAERAGY-ARDLTPRHPIMVELDEQIAQQQQLIDTFRKQSTEELKRRR
A0A2E7ALI1      --------------------ARRYRAKHPKMISTVAKLEDSRKKFMSEFLVAASSAADKS
A0A178IDB9      ---SLKTQYENILAERTAL-AERYLEEHPRMRQNALALADTRARLDAAVDLAIAETHARL
A0A290QD69      ---EMKTRIDTLRAERRQL-DERYLSEHPRMKQNQLAMEDAEAGFKSAVDLAIAELKNRF
A0A6N6ZC77      ---AAKRRLTQLKAERDQF-GRYLKPRHPKMISLGDEISRTEELMEIYREQAEQQMGDRK
A0A832M896      ---KVRQELQLKKNELQEL-SKFLKPRHPKVIGLQEEIAQQETLLSIYREQSLQQLKTRR
A0A538NJ59      ---GASRDLELLKLQRERL-SKFLRPKHPKITQLDTQIQRAEKLIELFRNQSREQIAAAQ
A0A2A2R3V9      ---NSNQQIQLLLLQRDEL-SQYLKPKHPKIIALNAEIQRQQTLLDMFKKQSIEQLNNRR
A0A3C1VFY9      ---SIKQQILLLKAEQDRF-GEFLKPKHPKMVAMNEESEKMGRLLGIYRDQSVEQLEAKK
A0A2V2SMX4      ---KAKQQIALMEAQKQDW-SEFLRPKHPKMVALDEDISRRRRLLGIFKDQSSEQLQTLQ
A0A522AC27      ---LTYQKRTVLLAEKERL-EEYLRPKHPRLIGINEEIAQQERLLNTYRKQTSEYLENLK
A0A6M1RFD0      ---KVKQEIQVLKAEEQQL-SEYLRPKHPKMIALREEIQRKEKLLDIVREQSAEQIENRK
A0A7C3HXH0      ---KVKQEIQMLKAEEQQL-SEFLRPKHPKMIALREEIQRKEKLLDIVREQSVEQIENRK
A0A432FDF6      --------------------GIDLGEEHPRIKGLKKVVATLEGQIDNRIKGILAGLGLRV
A0A2E7VDS1      ---ALRQKLLDLETTRKAF-EVKYLEKHPKMSANTRAVQELHRLLRLEVKTAIKDLTNRV
A0A7C8D3W3      SYRKIVLELAGLTEEWEKQ-SKLLKTQHPYMVNLSSQIEEFNAQKNRLLVLATTELDNSI
A0A178IFJ2      ---SVQSQLDELVARKAVM-AEKYGRRHPAMIDQERSIQALEKLRGDLILTAVANLRNQR
A0A357FSP9      ---QLLSQISAIKIGISSS-SKRYREKHPVMIEQQQTLQESEVELAAAVKDSVDKLSSAL
A0A1T4WWY4      SWQELERTKRATEEKLRLI-QTKFLDDHPEVIKLKDELKQVESALDIELKVALTSFDLEK
A0A3D3LEQ6      PWRELDKKKRSLEEKMAQS-RAKFLDDHPEMIKLREELRETVSALELELQVARRAFDLEY
A0A3D3NW23      PWRELDKKKRSLEEKMAQS-RAKFLDDHPEMIKLREELRETVSALELELQVARRAFDLEY
A0A522ACN3      ---------------------------HPEVINTQKQIDLLNTKIEARVSGIMYSLSNQV
A0A2A2R174      ---ALKEKLQAQEAVLVNH-QLRYKEKHPEMIKARAELESIRQQFEAEVLKAPLRLGLQL
A0A1H2DTI1      ---KAQERITELETQMKEE-EEYLRPAHPKRVALAAQIADLKRSITLSKEQNIEEANVRR
A0A1H1MGC9      ---QLVQQVSAQKIVMSQL-REHYRDKHPKMIEAVNSLAQTERELSRAIDSTAAMFEADF
A0A1V5L462      ---NTKRQHQQLLAMKEQF-GIYLKPKHPRMMDIEAELEILSNRIRIFRAQAFGQIEEEK
A0A3D3LGD3      ---QMTGELQRLEVAREGLVNQGRGRRHPEVLANDSQITKYKELIAAAAKDHLAGLQNRL
A0A350ARX4      ---KTQQEWTQLKAQLEEY-SLYLKPKHPKIIDLELNIERATNLIDILERQTTDSLDDRK
B5JIS2          ---RLRQELDKLNGQREVM-ALRYGRNHPKMRDLDSRIEAVEGNLNRNMEMALKDLEGQY
A0A7Y1UGD7      ------KALAAAETAVGTL-SLRYRAKHPKMIEAQARLEQAEKTFRQFMGRAVRNPSDLN
A0A2E5K4P7      ---TLVARNSLKKEELGLL-AARYRSKHPKMLQALQAQALVKKELDNAILMARNKAEAEH
A0A842HH73      ---NLLAQLSTQEVELSSM-RKRYGPKWPALEQAVRGHEQTKQELDAAINSAVQEIRVEY
A0A2E6NAH3      ---SLLQQVSSTRIEISSL-GKRYREKHPAMIQLLQTLQEGELELSRAVQNSVDKIYAGY
A0A2A5VZA5      ---RLLESISATRIEISSY-SKRYREKHPIMIQLLQTLQESEIELQEAVTNSVDKLYASY
A0A424R295      ---RLLESISATRIEISSY-SKRYREKHPIMIQLLQTLQESEIELQEAVTNSVDKLYASY
A0A1H2GQN6      IDQIRQQELQGSANIQSLL-KGGFGEEHPRVQSLRAAVGRAQEQLKSLAEGKRRALLIDL
A0A858RDL7      ------AELDKRETELDRV-ALRYRDKHPKKVEAVALMEDAKERFLKDFKAVLTQKQDEE
A0A512M3Y3      PWERTERDLRVARQKREQA-AQTYLPGHEIMRNLDREITDLEASLSSEVNTAITSFRLQK
A0A4P5R5J1      ---KVKQAINQLKADRQEF-LQTLKPKHPAVVALDEQIAKNEAMLGTYKQLGQDAITSRR
A0A4P5YK43      SYTEHKLNLKAREAEYFRY-QATLKPKHPFLVSLQNEIQRTRQELQFQLDNIEERRRAEI
A0A2A2RPW6      ---ALKEKLQSHEAALSNL-QLRYKDKHPTMIQARNELSTLKAQFEVEIRRAPERLKLMR
B1ZT68          ---ALRTRYAELQAQRKLL-GEKYLRLHPKMTQNELETTETKRLLDEAAAQAIANLETRN
W0J7C2          ---DLNNSLISLLTQRTLL-AEHYLGEHPKMKQNEAETRETRRMLAESIAKAVADLRARY
B4D1I7          ---HARQQIEVLKSERAEY-AKDLRSKHPIMVELDRQIAQQQQLIDAFRKQSAEDLQHRR
A0A353F286      ---YALQNRSAVDRMLDLE-AQGIGKKHPDMVTMKQRAEGALAKAHEEVISLKEVLKTKL
A0A354FSA6      ---YALQNRSAVDRMLDLE-AQGIGKKHPDMVTMKQRAEGALAKAHEEVISLKEVLKTKL
A0A3B9GA54      ---YALQNRSAVDRMLDLE-AQGIGKKHPDMVTMKQRADGALEKAHEEVISLKEVLKTKL
A0A520LEH8      ---YALQNRSAVDRMLDLE-AQGIGKKHPDMVTMKQRADGALEKAHEEVISLKEVLRTKL
A0A6B2M0T8      ---SKFESRNNLLAERNSL-SLRYGRRHPRMIENASSLEGVETEIQAALEKNVSDFVQQH
A0A2D7B7R6      ---SINGLYKAAKTTVRNL-EVDLKSKHPLMIDALRNVNNTRRVLLETISDVPKGLYAQI
A0A353DCA1      ------------------------------------------------------------
A0A7C5H7K5      GYLKVKQQLLLLKAEQIDL-GQYLRPKHPKMVALAEEISRRERLLEIYKQQGLEQLESRK
A0A7V3QF58      GYLKVKQQLLLLKAEQIDL-GQYLRPKHPKMVALAEEISRRERLLEIYKQQGLEQLESRK
A0A832FWF3      GYLKVKQQLLLLKAEQIDL-GQYLRPKHPKMVALAEEISRRERLLEIYKQQGLEQLESRK
A0A838YJR8      ----------------ALI-DSGVGVKHPKIVNIDSQLNLRMNQLLDAVETHKKALTTQL
A0A6N4WVA3      ---QSKEQLQLLHAQLDEF-SIYLKPKHPKIIGLKNQIERTENQLKIHRAQALERIAERQ
A0A0R2XPB1      ---LSKKQLQVLHAQLDEF-SIYLQPKHPKIIGLKNQIERTENQLEIQRDQTLRRIRERQ
A0A348NQP1      ---YSKKQLQVLHGQLDEF-SIYLQPKHPKIIGLKNQIERTENQLEIQREQTLTRIRERQ
A0A357FV58      ---YSKKQLQVLHGQLDEF-SIYLQPKHPKIIGLKNQIERTENQLEIQREQTLTRIRERQ
A0A2G4GZN8      ---AAQTAISGSKIRVSQM-TETYTDQHPKLVAEREALKQLERQLKEATTQAIKSRRSSL
A0A348NPT1      ---QLLSQISAIKIGISSS-SKRYREKHPVMIEQQQTLQESEVELAAAVKDSVDKLSSAL
A0A2E1KV60      ---SLTEQISNIRIAMSTM-SKRYREKHPEMRSLLQQLQESQSELDYAVQNAVDNLNASF
A0A2D7F4D9      ---TLIEQISAIRIAISTK-SKRYREKHPEMRSLLQQLQESQSELEYAVQNAVDNISGYF
A0A3R7RBR8      ---TLIEQISAIRIAISTK-SKRYREKHPEMRSLLQQLQESQSELEYAVQNAVDNISGYF
A0A2E0NH28      ---FMLQEVSKTKIEISSL-GKRYRSKHPVMIQLLQRLQESEIELTEAVTNSTDKIYAAY
A0A368BGT4      ---SLLQQISSTRISISSA-SKRYREKHPAMIELLQTLQEGELELELAVQNSVDKIYAGY
A0A317ZP96      ---SLLERISGARISISSL-SKRYREKHPVMIQQIQTLQEAEMELESAVKNAVDKIYAGY
A0A350AS32      ---SLLESISQAKIQISSL-SKRYREKHPVMIQLLQQLQESEAELSSAVQNAVNKLDSSF
A0A7W8DI01      VWEEIDEKLREAQREYQRL-SSNLLPGHEQMRALQKEIDSYSFALEAEWKKEIAAFQLEK
A0A6N6PLV8      ---AGQSIGEFSIEEKRLL-TSGVGENHPRVATLRGQLAVYRSQLQIALNGQLSAIANTY
A0A290QE54      ---AVSSQLSELTRQQSVL-AQRYFERHPKMIELEKSIKAAREQLTRATDLAIADLHASL
A0A1H1SWX2      ---VLKNNLAELNKQQAIL-SERYLERHPKMIELANSIDVVTAQITRNIEQSISDLRTQY
A0A1D8AZK8      ---ALKTQLAELQNQQSLL-AERYLERHPKMISVANSIDVIAAQIQNDIAQSLSDLRTQY
A0A4Q1C9I5      ---ALKTQLTDLQNQQSIL-SERYLERHPKMINVANSIDVLTAQIKTDIAQAIAALRAQH
A0A842HCC8      ---QARRNLERLRAEMDEF-SIYMKPKHPKIIDLKREIERQENLLKIIRRQTLNQVVNKK
A0A1G3ZL71      ---ALRNQLSELLQTQKVL-SDRYLERHPRMIELARQIATVRADLEKSIQLAVADLSASL
A0A556QP09      ---DLSKQLETLNRDHSLL-AERYLERHPKVINVVNAIHVAQEQLDTAIRLSIADLKTSL
A0A2T6DX88      ---AIRTQLADLQRQQSVL-SERYFERHPKMMDLARAIKVSQDQLASAIDLAIADLQASL
A0A2T6CWI7      ---SLRAQLSTLQQEQNIL-SERYYERHPRMIDVANRIDVTEKELAKAVQLAIDDLRARQ
A0A3E1E5C8      ---TLKNQLSNLHQNQSVL-GERYLERHPKMVDLANQVTVVQDQLEKAVDLAVADLATQL
B1ZZ74          ---TLSAQLSSLLQSQSVL-AERYLERHPKMIDLANSIAIVQEQLGKALDLAIADLGTRL
A0A2E0V4K6      ---ETHAALEVEEVKVADL-ARRYRGKHPKMIAASAKLAAAKGSFLEEFLVAARSPVDKS
A0A7W1VQ11      SWEKLDLERRQKKREHDDL-ARTFLPKHPKMVVVIKQLEQIERALDLELEVAFNRLESNY
A0A2V6F9Q9      ---KAKQQVQLLKAERDTL-SQDLRPRHPKIIKLNDEISKQEKLIAVFRADAVEKLETRR
A0A2V6NZZ3      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR
A0A2V6EBU2      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR
A0A2V6EY06      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR
A0A2V6ME53      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR
A0A538NUU0      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR
A0A2V6NIJ1      ---KAKQQVQLLKAERDTL-SLDLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETRR
A0A2V6C292      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETRR
A0A2V6D2X0      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETRR
A0A2V5ZUK1      ---KAKQQAQMLKAERDTL-AKDLRPNHPKILKLNDEVAKQDKLIELFRADTLERLKTRR
A0A7W1MVB5      ---KAKQSVQLLKAQRDTL-AKDLRPKHPKITKLNDEITQQENLIQLYREDAVEKLETRR
A0A7W1U7H7      ---KAKQAVQLLKAQRDTL-SKDLRPKHPKILKLNDQITQQQNLIQLYRQDAVEKLETRR
A0A2V5XFN9      ---KAKQQVQLLKAERDTR-AKDLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTRR
A0A2V6EZC8      ---KAKQQVQLLKAERDTL-AKDLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTRR
A0A2V6I7Z5      ---KAKQQVQLLKAERDTL-AKDLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTRR
A0A3B9LCP2      ---KAKQQLQLLKAERDTL-AKDLRPKHPKIVKLNDEISKQEKLIDLFRADTVEKLETRR
A0A3C0R669      ---KAKQQLQLLKAERDTL-AKDLRPKHPKIVKLNDEISKQEKLIDLFRADTVEKLETRR
A0A2V6EID2      ---KAKQAVQLLKAERDTL-AKDLRPKHPKILKLNDEISKQEKLIDLFRADTVEKLETRR
A0A2V6MHB0      ---KAKQAVQLLKAERDTL-AKDLRPKHPKILKLNDEISKQEKLIDLFRADTVEKLETRR
A0A7V9V4N8      ---KAKQAVQLLKAERDTL-SKDLRPKHPKILKLNDDISKQENLIVLFRADAVEKLETRR
A0A838I5D7      ---KAKQNVQLLKAERDTL-SRDLRPKHPKIIKLNDEIAKQENLIKLFRADAVEKLSTRR
A0A2W5YWL9      ---KAKQTVQLLKAERDTL-AKDLRPKHPKILKLNDEITKQEKLIQLFRSDAVEKLETRR
A0A2V5NH62      ---KAKQALQLLKAERETL-SKDLRPKHPKIIKLNDEVTKQEKLIELYRQDTVEKLDTRR
A0A2W6A620      ---KAKQTLQLLKAERETL-SKDLRPKHPKIIKINDEITKQEKLIELYRQDTVEKLETRR
A0A2V5PIJ4      ---KAKQALQVVKAERDTL-AKDLRPRHPKILKLNDEIAKQENLIKLFREDSIEKLDTRR
A0A2V6K2G8      ---KAKQQVQLLKAERDTL-AKDLRPNHPKIIKLKDEISKQEKLIELFRADTLEKLKTRR
A0A2V5W206      ---KAKQQIQLLKAERETL-AKDLRPSHPKILKLNDEITKQDKLIQLFRADALEKLKTRR
A0A2V6MW77      ---KAKQQIQLLKAERETL-AKDLRPNHPKILKLNDEITKQDKLIQLFRADTLEKLKTRR
A0A838MZM0      ---KAKQAVQLFKAERDTL-SKDLRPRHPKILKLNDEITKQENLIGLFRADAVEKLETRR
A0A838DHH0      ---KAKQNVQLLTAERDTL-ARDLRPKHPKIIKLNDEIAKQENLIGLFRADAVEKLTTRR
A0A838FJZ1      ---KAKQNVQLLKADRDTL-ARDLRPRHPKIIRLNDEIAKQESLIQLFRADAVEKLATRR
A0A0E3YV65      ---AVQSQLDTLRTQRATM-GERYGVRHPSMIENDRSREALERLRTELITAAMSNLRNQR
W0J900          ---SVQSQLDGLIAKKAVM-SEKYGRRHPAMVEQERSIQALEKLRGDLVRAALSTLRNQR
B4CZV9          PWDELAQQQQQVKKEISEG-LRKYLPTAGAMKPLYQQLDVINQRLDAEVEVATNRFNLEY
A0A7X1AX64      LVQDLLARRANALINLSTL-AKRYREKHPVMIEAAQNLNQVNAELMRAVETATASIEANY
A0A3B9FM17      ALRQTLYDLEKTRRDYEET-GSGYLERHPKMLENARSVQQVKSALRQSVTSAIEDLRDKH
A0A7W7YGS1      PWQELEKNKRALEEKIRFA-RLKFLDGHPEVQKLVEELKQVEAGLEIELKVALSAFELEK
A0A2D7WMI4      ALRSSLFELYKQRRDYQEV-GTGYLSKHPKMLSNARQIQDTYGRINKQVKDAIFDMDNRK
A0A2D6VHX5      SLRQELLEHELQRKTYVET-GTGYGPNHPKMIENARQVQEVQELLRKEVTLAIEDLRDRH
A0A2D8I214      SLRKTLFDLEKTRMRYQEG-SPGYLERHPKMLENARQVNEVKNSLIKEVTSAIEDLKDKR
A0A1Z8VL41      ALRKNLFDLEKTRRDYQEL-EPGYLERHPKMLSNAKQVKDVKKALALEVKSAIDDSRDKL
A0A2E6TNA4      AXRKNLFDLEKTRRDYQEL-EPGYLERHPKMLXNAKQVKDVKKELAXEVKSAIDDSRDKL
A0A1Z8RG47      SLRQTLYNLELTRKNYQET-GTGYLERHPKMMENARQVLEVKQSLNLAVKSAIEDLRDKY
A0A1Z8RJJ5      SLRQTLYNLELTRKNYQET-GTGYLERHPKMMENARQVLEVKQSLNLAVKSAIEDLRDKY
A0A2D7V631      SLRKTLYDLETTRKNYQET-GTGYLERHPKMMENARQVSEIKTTLNLEVKSAIEDLRDKH
A0A354RA24      SLRKTLYDLETTRKNYQET-GTGYLERHPKMMENARQVSEIKTTLNLEVKSAIEDLRDKH
A0A2E9RV62      ALQKRLFDLEQSHKLY----GQKYLANHPKMIETARQIKDVERILQLEVKASIEDLKNSY
A0A2E4AY96      FLREDLQKLYSTRKNYQEV-GTGYLEKHPKMLANARQIRDTNMQILSEIRNAISDLYERE
A0A3B9B9P4      FLREDLQKLYSTRKNYQEV-GTGYLEKHPKMLANGRQIRDTNMQILSEIRNAISDLYERE
A0A2D5Y6N6      SLRQNLYDLESKRRDYQET-GSGYLERHPKMIENARQVQLVKQALNKEVKSAIEDLRDKH
A0A2E7HSS8      SLRQTLYNLEKTRRDYEET-GSGYLEKHPKMLENARNVLQVKNALKDEVTSSIEDLRDKH
A0A2D8VCK3      ALRQTLYDLEKTRRDYEET-GSGYLERHPKMLENARSVQQVKSALRQSVTSAIEDLRDKH
A0A350QVY4      ALRQTLYDLEKTRRDYEET-GSGYLERHPRMLENARSVQQVKSALRQSVTSAIEDLRDKH
A0A2E4ZYR7      TLRQKLLDLETIRKEHE----VKYLELHPKMSSNTRAIMELHRLLRLEVKTAIEDLTNRV
A0A2E6TCV1      SLRTELQEHEKTRKTYE----AKYLENHPKMKENALAIGELHKILLNEVQVAIEDLTNQK
R7E4L8          ---KQIELFNDNFLQHKKL-FASAGRQNPMVSSLAENMKEMRESIGRSIANYCNALEVRM
A0A4P6PCA7      ---ELLGVWQTALDEFQRV-SEKYTEKHPRYQEAKRAEERALSRLDQFVEVSWKAIQNEL
A0A2T6DSN5      ---ALRGELENLKAERRML-SETYLDEFPKMKENALATENTEKRLQANIELAIAELRSRY
A0A317ZIW7      KYTEAKNQLDQLKADLEEF-EIYLKPKHPKIIGLKDQIERTSNQLEILRRQAFERIGERK
A0A7C4PPT4      RWEDLQREYEKLQLTSNEL-SKKYLPGHPKMAEVLKKMEEIKSALEAELRAAQQTYNLEY
A0A7C4QZX4      PWEQLQRDREQCKTALDEA-AKKYLPAHPKMAELLRKMDQINKSIEAELAGAQKQYALEQ
A0A3C1AXQ2      ------------------V-NSGRGREHPEVEGVDSQILLSKQLILDAVKSHLSALQTRM
A0A3D4HHL8      QYLVAKKELNLLKAQRDEY-LTYMKGKHPKLAAVNLEIERKENEMSVLKRQALHELKDEK
A0A366HV03      SWQMLERDKRKVETEIAEA-SRVYLEDHEILKALRTKQRQIDESLTTELEVERKRFEVER
A0A6G6K911      PWHTLERDKRKVETEIAEA-ARVYLEDHKVMKELRAKQRQISEALTTELDVERKRFEVER
A0A832HT83      ---ELARQREKLKGQQAEL-SRKFLPAHPRMQEVNKKLEEIEKEIESDLATARRSYEIEY
A0A5R8KAF2      PWQDLEKKRRVIEEELMEA-NKRYLPAHAIVKGLEEDLANNTRALAAELEVMRRRFELDF
A0A7C4LRZ6      ---ELEFKLRGLEMDYEAR-LKTLKPQHPFMVALQAGLDQVKREMQFQVELIEEKRKAKV
A0A351MR11      ---ALYNRVSELQVTIETL-EKKYTESHPTLRISREQLDVTKRELKTAIEMSVNRLAGLR
A0A388PR45      ---AARAKMTDAQTRVRAM-EEIYTDLHPKMIAERQALAQLSAEFQRAVKTKADSLAAAQ
A0A388QR61      ---NTRNKVAEETAKTRAM-EEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKADSMQTTW
A0A4P5YHI0      ---NTRNKVAEETAKTRAM-EEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKAESMQTTW
A0A2A2RS01      ---ALGPKVTELRVLVSTM-EKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASV
A0A2A2Y1A7      ---ALGPKVTELRVLVSTM-EKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASV
A0A388PDH9      ---ALGPKVTELRVLVSTM-EKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASV
A0A2G4H1E7      ---TTLTALSASKIRMSQM-TEKYTDQHPTLVAEREALNQVDRQLREAVVQAVKSRRASL
A0A2G4GZA6      ---AVQMVISASKIRVSQM-TETYTDQHPKLVAEREALKQLDLQLKESISQAIKSRRSSL
A0A388P514      ---ATQTAISASKIRVSQM-IETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSL
A0A2A2YG59      ---ATQTAISASKIRVSQM-IETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSL
A0A2G4F7D5      ---ATQTAISASKIRVSQM-IETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSL
A0A7V4IDX4      ---KIRQEILLLKARQQEL-AEFLRPRHPKMEKLAQEIAEKERLLGIYREQSQEQIQNRT
A0A2V2SDN0      ---RANQQIRLLKDKRDEL-SKGLRPMHPKILKLNEDIAAQEKLVEGSRSEVMKQLVNRR
A0A4Q3BVY2      PWRKLEKERRLLISQIRQN-STIYQPGHRVMKDLEKKLEDTERALETEFKMLRQKFDLNF
A0A8A7W4D3      PWRKLDKERRTIINQIAQN-AGIYLPEHRVMKDLEAKLAAAESALETEFRMMRQKFDLNY
A0A3R8L982      ---LRTQAVLSERYLDR----------HPRMIEIDNSIRVTRQQLAAAIALAIADLQATL
A0A6N6QBS9      ---RTN---------------------HPYMVDLARNVALKQQEIDEALRMADEGRRATI
A0A2V5X6Z6      ---KANQQMQLLKAKRDEL-SRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRR
A0A2V5VGZ7      ---KANQQMQLLKAKRDEL-SRFLRPLHPKILKLDEQIATQEKLVEISRDEALKQLAHRR
A0A2V5U130      ---KANQQMQLLKAKRDEL-SRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRR
A0A2V6C237      ---KANQQMQLLKAKRDEL-SRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRR
A0A2E7HPU9      ---YLSK--------------------HPKLIAAKNALEEYAFRFLREFDQVRKAAADKS
D5EML0          ---KRERLVLDERYLRK----------HPKIVENEAAMKSVSTELSRAIRQAEQQSTIEY
A0A1V6GL40      ---QAQQQLLLLRVEQQEL-GRYLRPNHPKMIAMQEDIARREELLKILRTQSEEQLKNRK
A0A7X7VL75      ---QAQQQLLLLRVEQQEL-GRYLRPNHPKMIAMQEDIARREELLKILRTQSEEQLKNRK
A0A7C4PPJ4      ---ELEFRLLSKQDEVKKY-SATLKPQHPFMQNLLAEVAKLQREMQYQLDLIEDKRLARI
A0A3C1C1M3      ---MTERDALLSR-YTPE---------HPAVEAQDKAVALYKEQANQALNRAKNTAAANL
A0A2S7U4L6      ---KRERAGVIAQGLGEN---------HPQVKHHDSQISILRETLDAKVRRVRDLLKVLL
A0A2E9EYJ1      ---ELSRAALIXSGVGVK---------HPKIVNIDSQLNLRMNQLLDAVETHKKALTTQL
A0A258AXR6      ---KVAREGLVNEGRGRL---------HPQVLSVDSQMAEYQSLILGAAKAHVAGLQNRL
A0A7W7YD86      ---KVAREGLMNEGRGRM---------HPQVLSADSQMAEYKKLILAAAQAHVAGLQNRL
A0A3D3NZQ6      ---EVAREGLVNQGRGRR---------HPEVLANDSQITKYKELIAAAAKDHLAGLQNRL
A0A1T4WVZ9      ---QVTREGLVNAGRGRR---------HPEVMGVDSQIALSKQLILDAVKAHLAALQTRL
A0A4R7SSI6      ---QVTREGLVNAGRGRK---------HPEVIGVDSQIILSKQLILDAVKSHVAALQTRL
A0A7W8DNH5      ---QVTREGLVNAGRGRK---------HPEVEGVDSQIVLSKQLILDAVKSHLSALQTRL
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      --------------------EYENLQRSVSRLQALYDLVFNRLKEVDVSIGIEPERIRIV
A0A849Y855      -----------------------------------------------TAGGLEQELIQIH
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      -----------------------------------------------------------N
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      --SNLDLKLNQLIDKRNS----LTERLTE-----------TAIK--EQEIIPLIREHKVK
A0A2V6N5E0      --ESIGKQMENLQANIKE----WEAKALD-----------LSQR--LAQFNRIKGKVDRL
A0A2V6NH44      --KSIGKQMENLQGNIKE----WEVKALD-----------LSQR--LAQFNRIKGKVDRT
A0A3D0IZR7      -----------------------MRGQLR-----------ADRSDRLAPYNEARRDFETQ
A0A520LRZ3      --SMAEQQFQNSKETKEK----TEKASLK-----------ERKD--NINYIEAKKEYELS
A0A356FSV4      --IEAKRNFEVSSQRLAE----KENELIQ-----------LSKT--RVDYNTLYREFEVQ
A0A3D3DET9      --ELLAVEIEILEKDLKA----WDARNQE-----------FQHK--NAEYQALKANVQRI
A0A355SVK9      --AEAKTNFELASRRLAE----KESELIQ-----------LSKT--RVEYSSLERELNVQ
A0A2E5D7I3      ----------VELKEVQS----NESEGLA-----------TARRLLLARTQVLDGETKSR
A0A2V5NYE2      --NSLDMQIKNRRKDIKE----QEEQVLE-----------INRK--TAEWQRLKDNKQRI
A0A353DI77      YWRGFQDQIDDVKNEENF----REL---------------RNAM--KLRASLLTNSVETK
A0A2V6FIP7      --ELAKAKETTMASELKK----KEQESFE-----------LSQL--RIQYDVLSRQADQS
A0A3C1UJT2      --KYQQEFIEELTQSIEN----QTSKLFE-----------WEQL--YMQQAALEQDLEIG
A0A258AXL1      --EHLQQRLESLQDKLPE----YRKLIAG-----------YDDF--RRDYKLQSSGHLAW
A0A2V5UAD5      --QVLKLKMNGIQTSIKE----SLGKVLA-----------ANDR--IADAERMKMNISRI
A0A7Y4QK88      --RDNELRIQNVLETIRD----WETRVIA-----------ANGR--IGEAERLKLNVQRI
A0A1V6GCZ3      --LSLSNSLVNLQQEVGR----ATTNDVT-----------QANL--TRPYFEAKRALEEL
A0A7V3WMH6      --ESERARVRLLEEQVNQ----FKTNEID-----------LAIK--RRPYWQARRDLESL
A0A2S7U0Z3      YWLEYKDEMDALEKIIDGDGPDKSDAADK------WVLLSQGAL--ASRAKLLNNTSEQT
A0A2E6T1E0      --ELAKATALNLKGVLEI----RKSEQQA-----------MNQK--SIQYFALEREAKQS
A0A5E6MKA7      --EAAKANYEGLEQEFQH----SMEKVRG-----------ESKA--LAHYALLKREADTD
A0A7W1HKQ4      --NSAQTTRDELKKRLTD----INEAQLA-----------QKNL--SANYVRAKNAYIKE
A0A6B3L936      YWKPLMADVDRLDKQIAS----AESEADRRDATDRWLSFVQNKL--SSRASVLESRIGSL
A0A2N8IR72      --NQLIDKRNSLTERLTE----------------------TAIK--EQEIIPLIREHKVK
A0A2N8IV96      --EMVAASRKHWEATVAQ----KEEDLQK-----------HVLQ--VPMYEQASRDYDAA
R7E1V8          --EMVSASRKHWEATVAQ----KEEALQK-----------HVLQ--VPMYEQASRDYDAA
A0A2E0R252      --AFWEQHSESFSSMDAD-----TRIDSQ-----------IQIA--STRASVLERELEAE
A0A3E1EF48      --RFWKENASVLAGLEGE-----ALIAAQ-----------LRTV--ASRASILSKALETE
A0A2A2PVG8      --KYWETSLASLQGAPME-----ALTNAK-----------RQVV--STRSNVLERELEAE
A0A2E0R421      --QFWEDAGTSIADVEGE-----ELATDQ-----------MQIV--ATRSRSLGRELESE
A0A2E5EJ69      --LTLSSQIDSQQGRLEA----QEKKVAA-----------DQQK--EIEYKHLKAQAESL
A0A2G4I5Z5      --QAAIDKEKGLELAVKE----QEKKLSL-----------LNSQ--RSGFDHLQAEVMQN
A0A4P5QQV6      --DATTLEIRNLETTVKE----WEAKAAS-----------NSER--LTQHAGIQAGISRM
A0A2E7ALI1      YWEGAGAELQQIANDEEA------GLASA-----------RRLL--LARTQVLDGETKSR
A0A178IDB9      --NLARQHEQRLRSEYAA----AEKQAQD-----------LDRI--TIDYKFLEEDAVSK
A0A290QD69      --NFAKQHELRLRTDYAE----TEKQAQE-----------LDKI--TSEYKYIEDESNIK
A0A6N6ZC77      --QELKAQLENLNIIISE----QEKVALE-----------NSRL--SAEFERLQANLERF
A0A832M896      --EALTIKAANTTKLIEE----WSKKALA-----------ANET--IAEFRRLQANVERT
A0A538NJ59      --QVLKLKMNGIQTSIKE----SLGKVLA-----------ANDR--IADAERMKMNISRI
A0A2A2R3V9      --EGLRLQIQNLQELIKS----EEVKALD-----------VNRR--MADYQRMKSKRQRL
A0A3C1VFY9      --SALALQIKNLENQTKQ----WGRQNIE-----------LGHK--SAEYASLKAKSQRL
A0A2V2SMX4      --KTLELQIANMERDVRE----WDAKCLE-----------ISRK--TAEYQRLKNDSQRV
A0A522AC27      --KSLELQITNVEKDVVE----WDAKNLS-----------ISQR--TAEYQKLKAGQSRV
A0A6M1RFD0      --KSLQLQIENLQKEIKQ----WEARALE-----------ASSK--MAQYQKIRANINRV
A0A7C3HXH0      --KSLALQIENLQKEIKQ----WEARALE-----------ASSK--MAQYQKIRANITRV
A0A432FDF6      --NSSQAQVEQLQRDVDA----AKKRESD-----------MRKT--GREYFDAKRELSNT
A0A2E7VDS1      --SEMASQESEFTKAMDA----VQRESQK-----------LDDI--ETRINEMTREKEIH
A0A7C8D3W3      --HSLKTTQKLLKSQIKNREEELKIALIK-----------QQEL--YQKFNEIENA----
A0A178IFJ2      --EKALENERQLQRQLAD----SEKASLA-----------LDRQ--AVEYNVLRREAETN
A0A357FSP9      --VEAKSNFELASQRLAE----KELELIK-----------LSKT--RVAYSSLQREMDVQ
A0A1T4WWY4      --ARLTEKLEELDGKLPE----YHKAIKS-----------YDTK--KLDYDLMEKSQLAW
A0A3D3LEQ6      --EKLKEQLVELEAKLPD----YYKAAKS-----------YDEK--KLAYELMEKGQLAW
A0A3D3NW23      --EKLKEQLVELEAKLPD----YYKAAKS-----------YDEK--KLAYELMEKGQLAW
A0A522ACN3      --EIARSEVGALKRQVED----AKRVDRD-----------KAEK--CRPYFEKKRELEEA
A0A2A2R174      --QAAIEKEKGLEAAFKE----QEKKLSD-----------LNAR--RSGYEHLQADVTLH
A0A1H2DTI1      --ETLALEIQHLEAMVKE----YEPKAIS-----------LGAK--LAEFERLKSKRSMD
A0A1H1MGC9      --QTAKRNDEEARANLVR----QESESLE-----------LDRY--AVEYSNLVRDYDIN
A0A1V5L462      --SALRNRIDTLLPEINK----WEEEVIQ-----------YSLG--VADLETMNSNLSRL
A0A3D3LGD3      --ESARKRKEALEASNQD----AKSELLG-----------QQSA--FNEYKTAKDDVTDI
A0A350ARX4      --DQLRRQIQNLDAVIAQ----WEKQALS-----------ISRK--SAEFERLQYRLDRS
B5JIS2          --TNVVSLEKRLDDDFRK----KFTESIE-----------VGRL--ADQFLVIGSEVDAK
A0A7Y1UGD7      YWASHLARVGDLDTPGAI----GEMRDLL-----------VSRR--AV----LESEIESQ
A0A2E5K4P7      --LLATVHYKEAQRDVAI----KEQEYLA-----------LEKN--REEYGGLTRKLEQA
A0A842HH73      --LEGKNAYEQAQKRLAE----KEDDIKQ-----------LQRL--AVGYQSLEQDLEVN
A0A2E6NAH3      --SESKSNYEVASLRLAE----KEKELIE-----------LGKT--KIEFNSLLRDLEVQ
A0A2A5VZA5      --IEAKSNFELSSKRLAE----KESELIA-----------LSKT--RVEYNTLLRDLDVQ
A0A424R295      --IEAKSNFELSSKRLAE----KESELIA-----------LSKT--RVEYNTLLRDLDVQ
A0A1H2GQN6      --NVSEEKLKLLEADVASL---RDKLRQE-----------KSDK--MAPFQEAVKERDRQ
A0A858RDL7      YWKGVGLPDDAANP--------GDYLVMA-----------RQKL--LARVGKLDGDIARA
A0A512M3Y3      --EQMAARMQELSKKMPD----YRRVLND-----------FDHY--KREYSLMSSGKLLW
A0A4P5R5J1      --GAIKTQIESLDDNIKT----WETKALD-----------LAKR--VADFDKIKSKIERT
A0A4P5YK43      --EKLRKDEIGLRPRVEE----MRREVFE-----------KSTV--LNEFEKLKKEEDYL
A0A2A2RPW6      --EGAMAKEKKLEQELRE----QEKKLGQ-----------LSLL--RIEYDRLQREAASE
B1ZT68          --RIAAQHEIRLRAELEQ----AERSAHE-----------LDKT--SVDYKFLEQDAATK
W0J7C2          --DVSAHYLQRLQAETTG----SEAQARE-----------LDKI--SIDYKFLEQDANAK
B4D1I7          --EATRLEIENLEKTIKE----WEAKALD-----------LSQR--LAEYGSLQANVTRA
A0A353F286      --DLVEQQVLKMREMVDA----RQEDAIT-----------LSLK--QTSYTQAKEQYEQA
A0A354FSA6      --DLVEQQVLKMREMVDA----RQEDAIT-----------LSLK--QTSYTQAKEQYEQA
A0A3B9GA54      --DLVEQQVLKMREMVDA----RQEDAIT-----------LSLK--QTSYTQAKEQYEQA
A0A520LEH8      --DLVEQQVLKMREMVDA----RQEDAIT-----------LSLK--QTSYTQAKEQYEQA
A0A6B2M0T8      --SQLKARVSNLEEALTQ----AEQESLE-----------LDQV--AIEYNVLRRKLDTD
A0A2D7B7R6      --KYQQEFIEELTQSIEN----QTSKLFE-----------WEQL--YMQQAALEQDLEIG
A0A353DCA1      ----------------------KKDGTVD-----------LSMR--QHQYNSAKEEYEQS
A0A7C5H7K5      --NSLAIQLKNLEKEAAE----ANAKALE-----------VNAK--MVEYQRIKNNLQRV
A0A7V3QF58      --NSLAIQLKNLEKEAAE----ANAKALE-----------VNGK--MVEYQRIKNNLQRV
A0A832FWF3      --NSLAIQLKNLEKEAAE----ANAKALE-----------VNGK--MVEYQRIKNNLQRV
A0A838YJR8      --AMAEQQYENSKESKER----TEKMSLK-----------ERKD--NVRYIEAKKEYELS
A0A6N4WVA3      --QVVGNQIKNLNAEIEI----WEKTALE-----------NGRL--IAEFERLQSRLKRS
A0A0R2XPB1      --SVLNNTAANLTLEIAI----WEKSALE-----------HGRL--IAEFERLQSRLERS
A0A348NQP1      --SVLNNTAANLSLEIAI----WEESALD-----------NGRL--IAEFERLQSRLERS
A0A357FV58      --SVLNNTAANLSLEIAI----WEESALD-----------NGRL--IAEFERLQSRLERS
A0A2G4GZN8      --DNAKARHEAILRNLLA----KEEEISR-----------LQAA--NVDLERVDKEIRAS
A0A348NPT1      --VEAKSNFELASQRLAE----KELELIK-----------LSKT--RVAYSSLQREMDVQ
A0A2E1KV60      --KEAKDNFAQASKRLVE----KERDMIE-----------LSKT--RVEFNSLIRDLEVE
A0A2D7F4D9      --AESRDNFKQASKRLLE----KEREMIE-----------LSKT--RVEFNSLIRDLEVE
A0A3R7RBR8      --AESRDNFKQASKRLLE----KEREMIE-----------LSKT--RVEFNSLIRDLEVE
A0A2E0NH28      --IEAKRNFEVSSQRLAE----KENELIQ-----------LSKT--RVDYNTLYREFEVQ
A0A368BGT4      --SESKSNFEMASLRLAE----KERELIE-----------LGKT--KIEFNSLLRDLEVQ
A0A317ZP96      --IEAQKNYEIATKRLVE----KEKELIE-----------LSRT--RVEYNSLLRDLEVE
A0A350AS32      --SESKSNYEVASQRLAE----KEQELIE-----------LSKT--RVEYNSLLRDLDVQ
A0A7W8DI01      --DHIRQQLASLQKQMPE----YHKLIAG-----------YDDY--RRDFRLQSSGRLAW
A0A6N6PLV8      --ALENKKLADTKASAED----TAKRVIE-----------EKTK--MKDYIEAKNRYIQE
A0A290QE54      --EKSRANEKSLEQEYAL----NEKEQIR-----------LRDL--SIDFKSLENQAAVA
A0A1H1SWX2      --VKLQDTEASYIKEYQA----AEKDNLR-----------LGDL--SVDFKSLENQAQVA
A0A1D8AZK8      --TKVKETEASYQKEYKE----AEMGQLR-----------LGEL--SVEFKSLENQATVA
A0A4Q1C9I5      --ETLKQTEASYVREYKE----AEKEQLR-----------LGEL--SVEFKSLENQAAVA
A0A842HCC8      --KILAGELANLNVVIQE----SEQKALK-----------YSTL--NAEFDRIKSRLASY
A0A1G3ZL71      --EKARDGEQTFEKEYAQ----HEKDQIK-----------LNEL--KPEYGSLENEALAK
A0A556QP09      --ERAVAREKTLEKEYAA----QEKEQLR-----------LRDL--SIEYRSLENQAQVA
A0A2T6DX88      --EKARANEKSLEQEYQL----HEKEQMH-----------LRDL--AVDFRSLENQATVA
A0A2T6CWI7      --AEARQAYESFSAEFAQ----REKDAMR-----------LGEL--RVEFNSLVQQSQVA
A0A3E1E5C8      --SEARQSEANLQTEYDR----AEKESLH-----------LGDL--SVEYNSLENQANVA
B1ZZ74          --NEARENERTLQEQFAK----AEKESLD-----------LGAL--APEFNSLQNQAQVS
A0A2E0V4K6      YWEGVSDQLGTIKDGGEA------EVAIA-----------RRLL--LARTQVLDGETKSR
A0A7W1VQ11      --ATLAAKMRELEATLPA----YHDVMRR-----------YEKA--MQAYKSFDSGQLAW
A0A2V6F9Q9      --KSIGKQMENLQSNIKE----WETKALD-----------LSQR--LAQFNRIKGKMDRT
A0A2V6NZZ3      --KSIGKQMENLQGNIKE----WEVKALD-----------LSQR--LAQFNRIKGKVDRT
A0A2V6EBU2      --KSIGKQMENLRGNIKE----WEVKALD-----------LSQR--LAQFNRIKGKVDRT
A0A2V6EY06      --KSIGKQMENLQGNIKE----WEVKALD-----------LSQR--LAQFNRIKGKVDRT
A0A2V6ME53      --KSIGKQMENLRGNIKE----WEVKALD-----------LSQR--LAQFNRIKGKVDRT
A0A538NUU0      --KSIGKQMENLRGNIKE----WEVKALD-----------LSQR--LAQFNRIKGKVDRT
A0A2V6NIJ1      --KSIGKQMENLQGNIKE----WEVKALD-----------LSQR--LAQFNRIKGKVDRT
A0A2V6C292      --KSIGKQMENLQGNVKE----WEVKALD-----------LSHR--LAQFNRIKGKVDRS
A0A2V6D2X0      --KSIGKQMENLQGNVKE----WEVKALD-----------LSHR--LAQFNRIKGKVDRS
A0A2V5ZUK1      --ESIGKQMENLQGNIKE----WEAKALD-----------LSQR--LAQFNRIKGKSDRL
A0A7W1MVB5      --KSTGKQMENLQTSISE----WEKKALD-----------LSQR--LAAFNRIKDKVDRQ
A0A7W1U7H7      --KSIGKQMENLQTNIAE----WEKKALD-----------LSQR--LAAFNRIKDKVDRQ
A0A2V5XFN9      --ESIGKQMENLQANVKE----WEAKALD-----------LSQR--LAQFNRIKGKVDRL
A0A2V6EZC8      --ESIGKQMENLQANVKE----WEAKALD-----------LSQR--LAQFNRIKGKVDRL
A0A2V6I7Z5      --ESIGKQMENLQANVKE----WEAKALD-----------LSQR--LAQFNRIKGKVDRL
A0A3B9LCP2      --KSIGKQMENLRANIKE----WEAKALD-----------LSQR--LALFNRVKGKVDRL
A0A3C0R669      --KSIGKQMENLRANIKE----WEAKALD-----------LSQR--LALFNRVKGKVDRL
A0A2V6EID2      --KSIGKQMENLQANIKE----WEAKALD-----------LSQR--LAQFNRVKGKVDRL
A0A2V6MHB0      --KSIGKQMENLQANIKE----WEAKALD-----------LSQR--LAQFNRVKGKVDRL
A0A7V9V4N8      --KSIGKQMENLLTNVKE----WEAKALD-----------LSQR--LAQFNRIKGKVDRL
A0A838I5D7      --NSIGKQMENLQANIKE----WETKALD-----------LSQR--LALFNRLKGKVDRL
A0A2W5YWL9      --KSIGKQMENLLGNIKE----WEAKALD-----------LSQR--LGQFNRIKGKVDRT
A0A2V5NH62      --KSIGKQMENLQTNIKE----WETKALD-----------LSQR--LAQFNRIKGKAERL
A0A2W6A620      --KSIGKQMENLQTNIKE----WEAKALD-----------LSQR--LAQFNRIKGKAERL
A0A2V5PIJ4      --KSIGVQMENLEKSIAE----WEKKALD-----------LSQR--LAQFNRIKGKADRL
A0A2V6K2G8      --ESIGKQMENLQTNVKE----WEAKALD-----------LSQR--LAQFNRIKGKVDRL
A0A2V5W206      --ESIGKQMENLQANIKE----WEAKALD-----------LSQR--LAQFNRIKGKVDRL
A0A2V6MW77      --ESIGKQMENLQANIKE----WEAKALD-----------LSQR--LAQFNRIKGKVDRL
A0A838MZM0      --KSIGKQMENLQTNVKE----WEAKALD-----------LSQR--LAQFNRIRGKVDRM
A0A838DHH0      --NSIGKQMENLQTNIKE----WETKALD-----------LSQR--LAQFNRLKGKVDRL
A0A838FJZ1      --TSIGKQMENLQENVKE----WETKALD-----------LSQR--LAVFNRLKGKVDRL
A0A0E3YV65      --AKALNEETQLQSQLAQ----AEKESFR-----------LDEM--AVQFNVLRREAETN
W0J900          --EKAVENERQLQEKLAD----AEKASLG-----------LDRL--AVEYNVLRREAETN
B4CZV9          --QELLNKKHDLEAKLPE----YQELSRK-----------HAKL--LSQLSIFDASRVPY
A0A7X1AX64      --QRARKNLVSAEKALDK----SNEKMLD-----------LAEI--RTGYNSILRDFEVA
A0A3B9FM17      --IQLSAQEKEFADEMEK----VQKQSEQ-----------LSEI--EETLKNFERELAVV
A0A7W7YGS1      --DRLAEKVQELETKLPE----YHKSTKT-----------FDVK--KQDYDLLEKSQLAW
A0A2D7WMI4      --LQLQALANDFTVAMTT----VQDEANF-----------LSKI--DDNISSMERELEIV
A0A2D6VHX5      --IQLDAQEREFMGAMDK----VQTESRR-----------LGHI--EEAISKAERTLAVV
A0A2D8I214      --VQLTAQEKEFQQAMEK----VQQDSMK-----------LSEI--EEWLINKERELTVV
A0A1Z8VL41      --LELQHQEGEFTMAMQE----VQSQSNE-----------LSEI--EERLEDYKRELSVV
A0A2E6TNA4      --LELEHQEGEFTKAMQK----VQLQSNE-----------LSEI--EERLEDYKRELSVV
A0A1Z8RG47      --IHLVAQENEFAKAMQK----VQEDSRK-----------LSEI--EEKLINFERQLAVV
A0A1Z8RJJ5      --IHLVAQENEFAKAMQK----VQEDSRK-----------LSEI--EEKLINFERQLAVV
A0A2D7V631      --IQLNAQEKEFATAMQK----VQEDSRK-----------LSEI--EETLTNFDRQLAVV
A0A354RA24      --IQLNAQEKEFATAMQK----VQEDSRK-----------LSEI--EETLTNFDRQLAVV
A0A2E9RV62      --HQLEAQEQEYANEMDK----VQVEAVE-----------LSEM--EKDLEVLDRKLQIQ
A0A2E4AY96      --NQLLALEDKFSIAMND----VQIEAKD-----------VSLI--DDTLRNFERELQIV
A0A3B9B9P4      --NQLLALEDKFSIAMND----VQIEAKD-----------VSLI--DDTLRNFERELQIV
A0A2D5Y6N6      --IQLTAQEKEFASAMAK----VQEESRT-----------LSEI--EEKLKNLDRQLAVV
A0A2E7HSS8      --IQLSAQEKEFGDEMAK----VQLESEK-----------LSEI--EDRLKNFTRELAVV
A0A2D8VCK3      --IQLSAQEKEFADEMEK----VQKQSEQ-----------LSEI--EETLKNFERELAVV
A0A350QVY4      --IQLSAQEKEFADEMAK----VQKQSEK-----------LSEI--EETLKNFERELAVV
A0A2E4ZYR7      --SELASQEREFTKAMLA----VQKESQK-----------LDDI--EVQILGMTREGLVH
A0A2E6TCV1      --NELNVQKAKFVYLREK----IKKQAQQ-----------LGQK--EQQIARLEQDLTLE
R7E4L8          --GELEKERNELNRLLSD----------------------MASK--DEGLVPLLREQKVM
A0A4P6PCA7      --TLLKTKISQMQSRMENIETELRDLDKQ-----------IADG--KRRLLKLERKRDAA
A0A2T6DSN5      --EVAGQHEKRLRQDFAD----AEKRLQE-----------LDRA--TDRYKFLEDDYNRK
A0A317ZIW7      --LVIERRIDNLNDEIAI----WEQSALE-----------NGRL--IAEFERLQSRLERS
A0A7C4PPT4      --VSLKQKKAELQQRLPE----YEQALLE-----------QKMF--MQELERKGAGNLGF
A0A7C4QZX4      --ASLREKKAELMAKLPE----FEKVLRD-----------SERL--RHDVQYQEVGKGVF
A0A3C1AXQ2      --DFAIKRRASLQNSNED----AKKGMLD-----------QQSA--QNDYKTAADEVAYI
A0A3D4HHL8      --EVLQSKISHLKDVIDE----QEVKALD-----------YSRR--LAEFERINSRLDRQ
A0A366HV03      --LRLGDQLKELEAKLPE----YSEMTEK-----------LNKL--RQDYKLGHEGDLAW
A0A6G6K911      --LRLGDQLKELESKLPE----YSEMTEK-----------LNKL--RQDYKLGYEGDLAW
A0A832HT83      --VSLTNKLAEMKKQLPE----LQKALEE-----------SDRI--KQGVALATAGNIGY
A0A5R8KAF2      --QQQTQKIATLEKRLPE----YYQTNEE-----------AGLA--GEQYMSASQGRAMW
A0A7C4LRZ6      --ESLRRDEESYKPLIEN----LRKQVFE-----------SRGV--QNAFERLKNEEADV
A0A351MR11      --SSSQQRLIAAERSLSG----KEAEIAR-----------LQGA--NIELERIEKEIRLG
A0A388PR45      --VDLRAKLDNAVEILRQ----KDEAINR-----------LQAA--AVELEKIDKDIRAN
A0A388QR61      --LDLQAKLANSVEILRQ----KDEAINK-----------LQAA--AVELEKIDKDIRAN
A0A4P5YHI0      --LDLQAKLANSVEILRQ----KDEAINK-----------LQAA--AVELEKIDKDIRAN
A0A2A2RS01      --QNARSSYDAIVANLER----KDDEIYR-----------LQAA--NNELERVDKEIRGQ
A0A2A2Y1A7      --QNARSSYDAIVANLER----KDDEIYR-----------LQAA--NNELERVDKEIRGQ
A0A388PDH9      --QNARSSYDAIVANLER----KDDEIYR-----------LQAA--NNELERVDKEIRGQ
A0A2G4H1E7      --ENAKARHEAILRNLVA----KEEEISK-----------LQAA--NVELERVDKDIRAS
A0A2G4GZA6      --ENAKARHEAILRNLVA----KEEEISK-----------LQAA--NVELERVDKDTKAS
A0A388P514      --ENAKARLEAILRNLLA----KEEEFSK-----------LQAA--NVELERVDKDIKAS
A0A2A2YG59      --ENAKARLEAILRNLLA----KEEEFTK-----------LQAA--NVELERVDKDIKAS
A0A2G4F7D5      --ENAKARLEAILRNLLA----KEEEFSK-----------LQAA--NVELERVDKDIKAS
A0A7V4IDX4      --EAIGIQIEALRKDIAE----WEGRTLD-----------SSRK--MAEYQKIKANNARL
A0A2V2SDN0      --DGLQLEVKNLEKVFRE----WEGKALE-----------ASRK--MVDYDRLRQDVQRT
A0A4Q3BVY2      --AGLTEKEKQLEARVPE----YHAITEQ-----------VGKS--SHVYSTIAAKQQMW
A0A8A7W4D3      --AGLEEKEKMLQARVPE----YHAITEQ-----------VGKS--SHAYASIAAKQQMW
A0A3R8L982      --EKARAREASLAIEYTA----NEKEHLR-----------LRDL--SVEYKSLENTAAVA
A0A6N6QBS9      --RRLRMREDAYPKLILE----LEEEVFE-----------KNSL--ENDYERLLKKEARV
A0A2V5X6Z6      --QAIELQVQNLEAAFKE----WDAKAIE-----------SSRK--MADYEQIRQNLQRL
A0A2V5VGZ7      --RAIELQVQNLEVAFKE----WDAKAIE-----------SSRK--MADYEQIRQNLQRL
A0A2V5U130      --QAIELQVQNLEAAFKE----WDAKAIE-----------SSRK--MADYEQIRQNLQRL
A0A2V6C237      --QAIELQVQNLEAAFKE----WDAKAIE-----------SSRK--MADYEQIRQNLQRL
A0A2E7HPU9      --YWDKNKSEWDKQDLDQ----LSRLQVA-----------RRLL--TARATVLTSGIASQ
D5EML0          --QTVQKEVSDLTARIQE----TEGRVLV-----------AERS--LLEYKRMERDVDQK
A0A1V6GL40      --ELLAVEIEILEKDLKA----WDARNQE-----------FQHK--NAEYQALKANVQRI
A0A7X7VL75      --ELLAVEIEILEKDLKA----WDARNQE-----------FQHK--NAEYQALKANVQRI
A0A7C4PPJ4      --ESLKRDEESYKPLIED----LRRQVFE-----------SRNI--QNQFDRLKSDETDI
A0A3C1C1M3      --ALYQEQAGSLQKKNEELLETASKLDRD-----------ILEG--EMRITALNRTRSAA
A0A2S7U4L6      --EQAGAKIARLQISKDA----SQSDAKN-----------TAED--YTRFQSYQDEYKDS
A0A2E9EYJ1      --AMAEQQYENSKESKER----TEKMSLQ-----------ERKQ--NVRYIEAKKEYELS
A0A258AXR6      --DASRKKRESLKIYNDD----AKQELQN-----------MSSL--YTEYKTAKDEVTYL
A0A7W7YD86      --DAAKKKRDSLQVYNDD----AKKELQD-----------MTAL--YTEYKTAKDEVTYL
A0A3D3NZQ6      --ESARKRKEALEASNQD----AKSELLG-----------QQSA--FNEYKTAKDDVTDI
A0A1T4WVZ9      --DFSIQRRETLRSSNEE----AKSEMLD-----------QQSA--QNDYKTAADDVAYI
A0A4R7SSI6      --EFAIKRHTALQSSNED----AEKEMFD-----------QQSA--QTDYKTAVDDVAYI
A0A7W8DNH5      --DFATKRRASLQNSNND----AKKDMLD-----------QQSA--QNDYKTAADEVAYI
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ----------------------DLATAQM-------------------------------
A0A660Q3A0      ----------------------ERAEVPT-------------------------------
A0A849Y855      ----------------------EPATAGS-------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      RALYESVLKRLSETNVSNDIAV-SNMQIMQSAERPR---SPDAPNIPINLTMYAALGLFL
A0A3D4CZT6      -------------------------------------------------LSLGAAVGLIF
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      EELYLMLLSKEQENALAMAVTE-SNARVLEAAHGPN---LPISPKTIKYVAGGTAGGALL
A0A2V6N5E0      KTLYDRLTTNLKDIDVSQVTGSEDQVSIMEMATPP----ISVRPGLIKSLLIGFGIGALA
A0A2V6NH44      KLLYDRLTNDLKSVDVSQVIDTGDQISIMEPATPP----VSVRPGLLKSLLLGFGGGALV
A0A3D0IZR7      SQLLEVLMSRYRQQSVESRIET-RPVQVVNRAEPAVRPVKPS---LKLNLALSMVVGLIL
A0A520LRZ3      KEMLNGMQSKLAKEKIDAAGQR-TPMVIHEIAEAADPG-NPARPNIKLHLVLGAAVGLVF
A0A356FSV4      QGFLTAIVSRMTMQKAQINLKN-PNARIVDEALPPLRHSSPN---LFLNIALGAFGGVVV
A0A3D3DET9      RALYDQLLATMQTLDVNKEISP-ESVETIEAASPA----YAARLDLWKGAVNGALLGLAL
A0A355SVK9      QGFLQALVSRLTEEKAQVTLKN-PNSRVIDEALPPMRHSSPN---IPMNLAAGFLGGLAA
A0A2E5D7I3      MSVFNSILVALEESKVNSIDEE-VIAELHSRAAPSDSAVFPNRLRVQ---AVGGIGGVAS
A0A2V5NYE2      QAAHDSLQATMDKLDVGKEAAP-ESVTIHQKASPA----VPNRPQLSRKLATGALVGLAL
A0A353DI77      NELYNTLLSRVGVLKTDA---EGVEAEVIKHEDAPRAW-APFSPNRKKIMVKTTMLGLCG
A0A2V6FIP7      KLLYNIVLQRMKETDLTSKD-KAQNMRVVDKAVVP--M-NPIKPRVVLTLFLGVIGGLGV
A0A3C1UJT2      TKLIDNIKDQIQSIEFTAES-EGTTIELAEKATE---P-STIEPNKTQRIILGVLLGLGL
A0A258AXL1      EAAYVGMKGRLAAMDYTGPE-VQVEFQFKGFTDVRD-D-IPVSPNKQKLLTYALALSIGL
A0A2V5UAD5      QFHYDRVVNLLQNVDISRNI-DQGTLAILDPASE---A-VRSYKQDVSLLAMTLVAGLLA
A0A7Y4QK88      QSVYDRLELLVQNVGISRNI-DQESLSILEPASQ---V-ERSYTREISGLALSVVSGFGL
A0A1V6GCZ3      QRFRQVLDAKIAFEKIDVELPKTLMVEVVDRAMPG--L-RPVRPNKPLNIALGIIIGLVV
A0A7V3WMH6      QVVRERLQWRIYQEKVDAELPKTGIVEVVDPAEPA--L-RAVRPNKALNITLGLIFGLAL
A0A2S7U0Z3      RDKYQSISQRMTEIDVADNQ-SMNNLKVVEPAFI---G-LAKESVRLIYLAAGSIFGIFT
A0A2E6T1E0      ETLYNLALQRLKETELQEKD-IVQNMHVIDLATAQ--M-SPIKPKKLLTLFLGIVGGLGA
A0A5E6MKA7      REMYSSVMRRMRETDITSAL-NASNVEVVESAEVP--N-MPSRPKKARNLLLGFLGGGMG
A0A7W1HKQ4      KSLRDGLRLRAQTQTMEMAM-PRQAVSVKQVAEPA--P-SAARPRVALNMALGALVGLVL
A0A6B3L936      RGRYETFTRRLAEIDVADDEGVNSKVRVNEAATI---P-PPSKYKHLITLAAGSVLGGGV
A0A2N8IR72      EELYLMLLSKEQENALAMAV-TESNARVLETAHGS--N-LPISPKTIKYVAGGTAGGALL
A0A2N8IV96      LDQLKELDSRYKDEIARLRV-PREAIEMYQLPTYP--A-APYKPNVTINLAVGAGAGLLL
R7E1V8          LDQLKDLDSRYKDEIARLRV-PREAIEMYQLPTYP--A-APYKPNVTINLAVGAGAGLLL
A0A2E0R252      QQIYDNLITKLKEGNVSKGF-DSKQFDVVQPPSLP--A-NPTGPNKKKITMKYLFGGAAL
A0A3E1EF48      QGIFENLNTKLKEADVTRGI-ATRQFEIIQPPTLP--G-GPIAPSMNDIVGRFSGGGFLL
A0A2A2PVG8      KAVYDNLILQLKEGNVTRGF-ASRQFEVVQPPTMP--A-APVAPIKTRMLVQFAGGGAAL
A0A2E0R421      QDIYNNLIAKLKEGNVTKNF-AGKQFDIVQPASLP--G-GPIGPNKKSIMSKYTMGGVAV
A0A2E5EJ69      QAMYQRVLGAKQESSVTEGI-QNRTVEVYNPASLP--G-APVSPRKSVIMMVAMIVGCGL
A0A2G4I5Z5      RKLHDTVIQRLKELDIVSGNKNKNEVRIIEPASLP--L-TPIRPNKKMLLIYALALGTAL
A0A4P5QQV6      RAQYENLSRSKGSVEITRNV-DQEIISVRQKATP---A-QTARFGVARTLTTGFVLGLLG
A0A2E7ALI1      MSVFNSILVALEETKVNS---IDDEVIAELHSRSAVPS-SPVFPNRLRVKAVGGLGGIAG
A0A178IDB9      RQAYNSILSRLNETTIVSQL-ENVNIKVLDKALVP--G-APSNSPSSQILLQAGAFGFIL
A0A290QD69      SKNYQDILSRLSEISIISQL-DNVNITIHDKALVP--G-FPDTGTPKEVIKQAAALAFVL
A0A6N6ZC77      RNQHETLLRSLQTIETGQDI-STEIVSVLERPQY---F-GETRMSLQRSLVEGGILGLGF
A0A832M896      KNTYDRLAEMARSLDMSSSL-SQGTIQILQRATP---A-AQLRTGRLEALLKGALAGFAL
A0A538NJ59      QFHYDRVVNLLQNVDISRNI-DQGTLAILDPASE---A-VRSYKQDVSLLAMTLAAGLLA
A0A2A2R3V9      QAFYERLVSSVQSVDLSQNI-DQEMISIMEHPGL---A-QPVHVGMSGMLLNGFLLGLLA
A0A3C1VFY9      QALYDQLLATFQTLNVNKDA-SPETVTIYQPASD---A-FPDTTLLKKGLMFAGLLGLGL
A0A2V2SMX4      QGLYDRLLATMQTLDVNKQI-NPESVTIYEKATQ---A-YPDRVNLPMKLALGAVAGLGL
A0A522AC27      QALYDRLLATMQTLDVNKEI-SPESVTIMEPAFD---A-VPERPPIIQSLFKAGLIGLGA
A0A6M1RFD0      QSLYDRLLQTMQAVGVDKDI-IPESVTILERASV---A-EPDRLSLSVSLALAGLVGLML
A0A7C3HXH0      QNLYDRLLQTMQAVGVDKDI-TPESVAILERASE---A-EPDRLSLSISLTLAGMVGLML
A0A432FDF6      TRIRDTILFRIMQEEVDLALPKESTVEITDDADLP--I-KAVRPNIPLNIALGVVVGLVL
A0A2E7VDS1      EKTHDIMLNRLNEVKVTRAL-PQEDDPLKRDSPAVTPT-SPFEPDKSSIHRTGALIFLAC
A0A7C8D3W3      -------KNRLEEYTQLLAFFQEEPESEFYEILASGVV-EKIDPQRVKKILQGLMFGLAL
A0A178IFJ2      RATYTQVLSRLNEASLTAQL-GNSNIKIAERARPP--T-VPLEPNPKKILLSIGFLGVLI
A0A357FSP9      QGFLQALVQRMTQERAAVNL-KNPNSRVIDEALPP--L-RHSSPNIVMNLAAGFFGGLAV
A0A1T4WWY4      DKAYEKLSQRIESLEFDGDK-APLSLEFRGFTNLRS-E-MPVSPNKSKLFMMGCLLGLGL
A0A3D3LEQ6      DKAYEQLSRQIEGLEFGSDE-SAVSLEFRGFTDIRS-E-APVSPNKSKLLMLGCLLGLGM
A0A3D3NW23      DKAYEQLSRQIEGLEFGSDE-SAVSLEFRGFTDIRS-E-APVSPNKSKLLMLGCLLGLGM
A0A522ACN3      IRLRTILNMRIAQERTDINLPHTTMVEIIDRATPG--A-RPVRPNKPLNIALGVIIGLVV
A0A2A2R174      RSLHDAVIKRLRELDIVSGDKSKSEVRVIEPANLP--L-TPIRPNKKMLLLYALAAGTAL
A0A1H2DTI1      QSLYESLLQSVQKIDLNRRL-DEQRFTLMEPPSD---A-TSIKDQYQVRLLSAGLGGLIV
A0A1H1MGC9      EHLLNSILGRMRETSMSSTI-ETQSARVVDRAAPA--L-KPFSPNIPLNLALGFLGGLAL
A0A1V5L462      LSTRESLIRRKERLDIGRNV-DTELISVLVPATS---A-VLRQVDKRREIAKGGALGLGM
A0A3D3LGD3      EAILRTLKTRYFETKAGLEI-FKSPATIYAKAEPE--G-RPAKPNVALNLALGGILGLMF
A0A350ARX4      RNTYQRLLDSIQAIQSNQNI-EQDTIGILAHASR---A-GVQPPQVGKKVAEGAAFGLAV
B5JIS2          REALTSLLRRVSNANVVSNL----PVDVMRVVDPAFIA-KPKLAKRKLVAAFTVLLAGGA
A0A7Y1UGD7      NSLYRSLLGQIETREVSVKQ-TEAEVAPHEMARP---G-RHVYPQKTRMVIQGTVLGLFA
A0A2E5K4P7      RKSLEHLRMLKFKEDVRTDT-KNSSVNIYVDGVAPT---KHFTPSLTLNLAFGTIGGAGF
A0A842HH73      VGVLSQIVYRLEQERNNIPL-ILPNARIVEKALPTP---EPAKPNVPMNLALGVFGGIAL
A0A2E6NAH3      QSFFQALNQRMTTEKAQVNL-KNPNARIVDEAFPPRED-QPSSPNVVLNLAAGFFGGIAT
A0A2A5VZA5      QSFFQALNSRMTQEKAQVSL-KEANARVVDDAFPPL---RHSSPNITVNLLVGVFGGLAV
A0A424R295      QSFFQALNSRMTQEKAQVSL-KEANARVVDDAFPPL---RHSSPNITVNLLVGVFGGLAV
A0A1H2GQN6      QYILDQYEIRYKQENLDQQSPSQPATVISPANTN---P-NPVRPILWLNITLSGVAGLLL
A0A858RDL7      KKIVDTMETKKKDLELDQ---NAQNVIVEPSSFARVPG-PPSGPDRQKIQTSGAMGGLML
A0A512M3Y3      ESAYADLSKRLTAMDYTGID-VRVEFEWQGFTYLRN-D-VPISPNKQKLLLYGVMLGVGC
A0A4P5R5J1      KVHYDRLNGQLRSMDVYKNL-AQDTVLILEHATK---P-EQIQMELNKLLLIGGFGGLAL
A0A4P5YK43      EKELDRQKRSLLALESTPT--NEETISTVEEGVGL--E-KPVGPNRPKIILLGLLLGLFS
A0A2A2RPW6      RKLYDTVINRLREIDLTGNIEKKSEFRIIEPASLP--S-IPIRPNKKMILLYALMVGMAA
B1ZT68          RATYSRIVDRLNEASVASQM-ENTNIKIFDPAYVP--G-GPIGDALAILIAKASFIGVGL
W0J7C2          RATYARIMDRLTEAGITSRM-ANTNIAIFDPAWVP--D-APSDTGALEIAVKAGAAGLGL
B4D1I7          RAQLESLSRSKGNVEINRNV-DQDIISIRQRASA---A-TPQKPGAVKTVGTGIGLGLFV
A0A353F286      RGMLREMKFKHSEAKILLKM-PRDPITLHEKPKKA--S-KPVFPNFTMNLLLGAGVGLIF
A0A354FSA6      RGMLREMKFKHSEAKILLKM-PRDPITLHEKPKKA--S-KPVFPNFTMNLLLGAGVGLIF
A0A3B9GA54      RGMLREMKFKHSEAKILLKM-PRDPITLHEKPKKA--S-KPVFPNFTMNLLLGAGVGLIF
A0A520LEH8      RGMLREMKFKHSEAKILLKM-PRDPITLHEKPKKA--S-KPVFPNFTMNLLLGAGVGLIF
A0A6B2M0T8      KRLFTQVHQRLNEAILASQL-SDVNLRVVDQAWPA--G-APFTPDVKKIYSVTVFLFLFA
A0A2D7B7R6      TKLIDNIKDQIQSIEFTAES-EGTTIELAEKATE---P-STIEPNKTQRIILGVLLGLGL
A0A353DCA1      RMMYREMSVKQQQQRVLLKM-PRTPITLHERAKKA--K-APAYPNVTLNLLLGAGVGLIF
A0A7C5H7K5      QALYDRLLGTIQNLDVNLKI-TPESVTILEDASE---A-KPARFGIGYHAGFGAAAGLLL
A0A7V3QF58      QVLYDRLLATIQNLDVNLKI-TPESVTILEDASE---A-KPARFGIGFHAGFGAAGGLLL
A0A832FWF3      QVLYDRLLATIQNLDVNLKI-TPESVTILEDASE---A-KPARFGIGFHAGFGAAGGLLL
A0A838YJR8      KEMLNGMQSQLAKETIDSAG-QRTPLVIHELAEPQDVD-KPARPNIKLHLVLGAAVGLIF
A0A6N4WVA3      KEAYASSQDSLRAIDTNQNL-QQDTVSILVNARK---P-VPAGVGLVRQFAMGGLFGFVL
A0A0R2XPB1      KAASVNSQDSLQAIDTNQNL-QQETVSILVNARK---P-IPAGVGLVQQFAMGALFGVVL
A0A348NQP1      KAASVNSQDSLQAIDTNQNL-QQESVSILVNARK---P-IPAGVGLVRRFAMGGLFGLIL
A0A357FV58      KAASVNSQDSLQAIDTNQNL-QQESVSILVNARK---P-IPAGVGLVRRFAMGGLFGLIL
A0A2G4GZN8      EEFLGRMKLSYEDAKLRSST-SGTSTSISILDAPSVSD-KPINKNYYFSALVGIGSGLLF
A0A348NPT1      QGFLQALVQRMTQERAAVNL-KNPNSRVIDEALPPLRH---SSPNIVMNLAAGFFGGLAV
A0A2E1KV60      QMTYQKLISLMAEEKIQVNI-KNANARIIDKAFPPPED-QPSSPNVFLNLAGGFFGGIFF
A0A2D7F4D9      QMTYQKLTALMAEEKIQVNI-KNANARIIDKAFPPRED-RPSSPNVFLNLAGGFFGGMIF
A0A3R7RBR8      QMTYQKLTALMAEEKIQVNI-KNANARIIDKAFPPRED-RPSSPNVFLNLAGGFFGGMIF
A0A2E0NH28      QGFLTAIVSRMTMQKAQINL-KNPNARIVDEALPPLRH---SSPNLFLNIALGAFGGVVX
A0A368BGT4      QSFFQALNLRMTTEKAQVNL-KNPNARIVDEAFPPPED-QPSSPNIVLNLFAGFFGGIAF
A0A317ZP96      QNFYQALNSRMTTEKAQVNL-KNPNARIVDEAYPPADD-NPSSPNVVMNLAAGFFGGLAV
A0A350AS32      QSFFIALTSRMTQEKAQVNL-KNPNARIVDEAFPPMKH---SSPNVVMNLAAGLFGGVAV
A0A7W8DI01      EQAYITMKSRISAMDYTGP--EVQVEFFFKGFTEVRDD-IPVSPNKQKLLTYALALSLGL
A0A6N6PLV8      KKILESSEINLKAERMKRGI-EMDPARVWEKAEPS--L-APDKPNVPVYMVAAAALGLVL
A0A290QE54      KGNYTQILDRLSQATTSSNL---ERISVRPLDPATPAG-APYTPDIRSIAKTSIGLFVLV
A0A1H1SWX2      KSNYLEILNRLNQVTTSKNL---ENIPVKPLDRALPKG-SPDTPNIRNIVKTSIGLGLVV
A0A1D8AZK8      KNNYIEILNRLNQVTTSKNL---ENIPVKPLDRALPAG-APFTPNIRSIIKTSIGLGLLV
A0A4Q1C9I5      KNNYLQILDRLAQATTSKNL---ENIPVKPLDQALPAG-APYTPNLRNIIKTSLGLGLLV
A0A842HCC8      SARHDSYLKMMESLHQSENI-HQEPVTILEPATT---P-TTIPVNMFKQVTSGGLVGLAL
A0A1G3ZL71      RTAYLQVLDRLNQTTTSKNLDSRVPLRVIDRATPS--H-APYTPNLARVVRTSTIVGLLI
A0A556QP09      KSNYSQILDRLSQATTSKYLE-KIPVRPLDPALPA--G-KPYTPDLGRIARTAVGVGVLV
A0A2T6DX88      KSNYSQILDRLSQTTTSSKLE-KIPVRPLDRATPT--P-APYTPNMTRVIRLSVIVGLLV
A0A2T6CWI7      RENYQNIFKRLTDTTTVKNLD-KIPLHPLDHAVAN--R-WPVSPNRQKITRTAIGLGLMV
A0A3E1E5C8      KSNYVQILNRLNETTTTRNLE-KIPLHPLDAAVVP--G-GPYEPDLARIIRTCLGVGLLV
B1ZZ74          KANYLSILDRLNQTTTTKNLE-KIPLHPLDHAVVP--G-APFTPNLNAIIRLCVGVGVMV
A0A2E0V4K6      MSVFNSILVAMEESKVNQ---IDDEVIADLHSRASTPE-TAVYPNRIRSYFAGGAGGAAC
A0A7W1VQ11      SKLHADMEKRLNVLDFAEDKDRDVLKYLGYSESLR--N-NPVSPHRAKLAIYSLLFGFAL
A0A2V6F9Q9      KQLYDRLTNDLKAVDVSQVVDAGDQISIMEPATP---P-VSVRPGLIKSLLLGFGGGAVA
A0A2V6NZZ3      KLLYERLTNDLKSVDVSQVIETGDQISIMEPATT---P-VSVRPGLLKSLLLGFGGGALV
A0A2V6EBU2      KLLYERLTNDLKSVDVSQVIETGDQISIMEPATT---P-VSVRPGLLKSLLLGFGGGALV
A0A2V6EY06      KLLYERLTNDLKSVDVSQVIETGDQISIMEPATT---P-VSVRPGLLKSLLLGFGGGALV
A0A2V6ME53      KLLYERLTNDLKSVDVSQVVDTGDQISIMEPATS---P-VSVRPGLLKSLFLGFGGGALV
A0A538NUU0      KLLYERLTNDLKSVDVSQVVDTGDQISIMEPATS---P-VSVRPGLLKSLFLGFGGGALV
A0A2V6NIJ1      KLLYDRLTNDLKSVDVSQVVDSGDQISIMEPATP---P-VSVRPGLLKSLLVGFGGGALV
A0A2V6C292      KLLYDRLTNDLKSVDVSQVVDSGDQISIMEPATS---P-VSVRPGLLKSLLLGFGGGALV
A0A2V6D2X0      KLLYDRLTNDLKSVDVSQVVDSGDQISIMEPATS---P-VSVRPGLLKSLLLGFGGGALV
A0A2V5ZUK1      KQLYDRLTNNLKEIDVSQVVGGEDQVSIMEMATT---P-VSVRPGLIKSLLIGFGAGALL
A0A7W1MVB5      KTLYDRLTNSLKDVNVSQVVDGGDQVGIMESATA---P-VSVRPGLIKSLLIGLGFGAFV
A0A7W1U7H7      KTLYDRLTNSLKDVNVSQVVDGGDQVGIMERATM---P-VSVRPGLIKSLLIGLGFGAFV
A0A2V5XFN9      KTLYDRLTNNLKEIDVSQVVGGEDQVSIMEMATA---P-ISVRPGLIKSLLIGFGIGALA
A0A2V6EZC8      KTLYDRLTNNLKEIDVSQVVGGEDQVSIMEMATA---P-ISVRPGLIKSLLIGFGIGALA
A0A2V6I7Z5      KTLYDRLTNNLKEIDVSQVVGGEDQVSIMEMATA---P-ISVRPGLIKSLLIGFGIGALA
A0A3B9LCP2      KTLYDRLTNNLKEVDVSQVVDSGDQVGIMDMATP---P-ISVRPGLIKSLLIGLGCGLLA
A0A3C0R669      KTLYDRLTNNLKEVDVSQVVDSGDQVGIMDMATP---P-ISVRPGLIKSLLIGLGCGLLA
A0A2V6EID2      KVLYDRLTNNLKEVDVSQVVDSADQVSVMEMATP---P-ISVRPGLIKSLLIGLGCGLLA
A0A2V6MHB0      KVLYDRLTNNLKEVDVSQVVDSADQVSVMEMATP---P-ISVRPGLIKSLLIGLGCGLLA
A0A7V9V4N8      KALYDRLTNSLKEVGVSQVVDSGDQVAIMEMATI---P-QSVRPGLIKSLLIGLGCGAGA
A0A838I5D7      KTLYDRLSNSVKDVGVSQVVDGGDQVSIMEMATT---P-SSVRPGLLKSLLIGLGCGAFA
A0A2W5YWL9      KQLYDKMTNDLKSVDVSQVVDTGDQISIMEAATA---P-ISVRPGLLKSLLIGLGCGALA
A0A2V5NH62      KTLYDRLTNSLKDVNVSQSVDSGDQVSIMEMASG---P-VSVRPGLIKSLLIGLGIGALA
A0A2W6A620      KTLYDRLTNNLKDINVSQSVDSGDQISIMEMAGA---P-ISVRPGLLKSLLIGLGCGALA
A0A2V5PIJ4      KTLYDRLTNNLKEVNVSQVVDTGDQIAIMENATA---P-VSVRPGLIKSLLMGLGAGILG
A0A2V6K2G8      KTLYDRLTNNLKDIDVSQVTGSEDQVSIMEMATA---P-ISVRPGLIKSLLIGFGIGALA
A0A2V5W206      KTLYDRLTTNLKDIDVSQVTGSEDQVSIMEMATP---P-ISVRPGLIKSLLIGFGIGALA
A0A2V6MW77      KTLYDRLTNNLKEIDVSQVVGGEDQVSIMEMATS---P-VSVRPGLIKSLLIGFGIGALA
A0A838MZM0      KALNDRLTNSLKDVGVTQAVDAGDQVAIMEMATI---P-QSVRPGLIKSLLIGLGVGGLA
A0A838DHH0      KTLYDRLTNNLKEVGVSQVVDGGDQVSIMEMASN---P-QSVRPGLIKSLLIGLGCGALA
A0A838FJZ1      KILYERLTTNLKEVGVSQVVDGGDQVSIMEQATM---P-ISVRPGLLKSLLIGLGIGAFA
A0A0E3YV65      RATYAQLLNRLNETSITAQL-ANSNVRVADGGTPA--G-LPLEPDPRKIAITLLVLGLGV
W0J900          RATYTQVLGRLNETSLTAQL-GNSNIKISERAQIP--T-FPIEPDPKKIFRALGFLGLLI
B4CZV9          DTYLANMQREINEVEFAG---EKERINLKYSGLLEVRD-DPVSPNRLRIMLLSFVGGLVL
A0A7X1AX64      QMNYQQLISQLAAREAETSWKTAQAEIVDRAPIP---M-NPSSPNIPLNLALGVVGGLGL
A0A3B9FM17      QRSTDSIHSRLNDVNIEQALPSEQDEPLRVDSVAYEPG-GPYAPDKNRIREEGMMIFAVL
A0A7W7YGS1      DKAYEKLSQRVESLEFDSDS-SSLTLEFRGFTNLRD-G-VPISPNKSKLLMLGCLLGVGL
A0A2D7WMI4      QTSSGQMQKRLNDVTIEQAFPQDQDDPLQKEQFAFVPG-GPYSPDKNGIYKKSFGIFVGI
A0A2D6VHX5      RSSTDIIRKRLDDVRIEAALPSEQDDPLQKDQLAFTPX-SPYSPDYNKIKQQGVLIFVGI
A0A2D8I214      RTSTDQIQKRLNEVRIEQALPSEQEEPLHKEQYAFLPG-GPYTPDKAKIKRTGIYIFLGL
A0A1Z8VL41      RASTDQIHKRLNDVKIEQSLPSEQDDPLHKENFASLPG-GPFSPDKNAIKQKGLXIFFAV
A0A2E6TNA4      RASTDQIHKRLNDVKIEQSLPSEQDDPLHKEQFASLPG-GPFSPDKNAIKQKGLIIFFVV
A0A1Z8RG47      RKSTDQIHDRLNDVRIEQALPSEQEEPLHKEQFATQPS-APYTPDKNQIRQSGFMIFFSV
A0A1Z8RJJ5      RKSTDQIHDRLNDVRIEQALPSEQEEPLHKEQFATQPS-APYTPDKNQIRQSGFMIFFSV
A0A2D7V631      RKSTDQIQSRLNDVRIEQALPSEQEEPLHKEQFAYQPF-APYTPDKNKIRKSGFIIFFAV
A0A354RA24      RKSTDQIQSRLNDVRIEQALPSEQEEPLHKEQFAYQPF-APYTPDKNKIRKSGFIIFFAV
A0A2E9RV62      RGSTDTIQRRLQDVVIQIELPQEQDDPLHKGNIAY-PG-IQISPNLPEIHKTGFMIFAAL
A0A2E4AY96      QTSSAQMQKRLNDVTIEQAFPQEQDNPLQKEQFASLPA-SAYSPDKAAIQKKAATVFLAI
A0A3B9B9P4      QTSSAQMQKRLNDVTIEQAFPQEQDNPLQKEQFASLPA-SAYSPDKAAIQKKAATVFLAI
A0A2D5Y6N6      TRTTDQIHNRLNDVRIEQALPSEQEEPLNKEQFAYLPG-APFTPDKNKIKRDGTMLGLAI
A0A2E7HSS8      QRSTDGIQSRLNEVKIEQALPSEQDEPLRMESFANEPG-GPYSPDKQKIKEQGIMIFSVL
A0A2D8VCK3      QRSTDSIHSRLNDVNIEQALPSEQDEPLRVDSVAYEPG-GPYAPDKNRIREEGMMIFAVL
A0A350QVY4      QRSTDSIHARLNDVKIEQALPSEQDEPLRVDSVAYEPG-GPYAPDKNRIREEGMMIFAVL
A0A2E4ZYR7      RTTYDQMLKRLNEVKVTRELPQDEDDPLRRGDVAMTPA-TPISPDKAAIRRTGILIFVAC
A0A2E6TCV1      RQTFSSLHKRKKEVEVTGALPEAQTDPLQISDVATVPY-LPVSPDKAAIKTKGILIFFAC
R7E4L8          EELYLMLLKKREENALALAT-TEPSARILEPAFGS--N-APVAPRLSLMTMGGMAGGAFA
A0A4P6PCA7      ETSYRSILQRTENTRLAAEQ-DTAFVKVLREATVP--R-IPVAPDKKKIVIVTVFLFGII
A0A2T6DSN5      NQALNSIEGRLQEATIVSRL-ENVNIRILDRANVP--S-VPANGTPKDTALQASALGLFL
A0A317ZIW7      KAAYERNQEALRAIDTGQSL-SQETVSVLEDASP---A-YPAGQGTVIRLAEGAAYGIVL
A0A7C4PPT4      AAMYKEMATRLSMIDFGADK-ERSQLQFMGHLELRD-E-IPVSPNRLKLVVYSLGLGIFL
A0A7C4QZX4      SRAYGELARRLSMVDYGAER-ERIHLQFLGHLELRD-Q-VPVSPNRMKLLVYSLGLGLLL
A0A3C1AXQ2      ESLLLQLKSTYFQTKAELEL-VKSPATIYAIATPE--G-KPAKPNVALNLALGGVLGLML
A0A3D4HHL8      KSLLENLTASIQSIDINLNL-DQEFLTILENASP---A-YAVRISIVKNLVMGVVAGVFM
A0A366HV03      TKAYTDLSKMIATINFGGDK-DRVDLQFREFALLRD-V-DPVSPTKSKLAILAAVLGLGL
A0A6G6K911      TKAYADLSKMVATINFGGDK-DRVDLQFREFALLRD-V-DPISPTKSKLLILAVVLGLGL
A0A832HT83      DKMYEEMAKRISQLNFGSEK-ERMVFQFMGNLELRD-V-VPVSPNRMKLVLFSFLAGLAL
A0A5R8KAF2      GRARDKLSDKLSMISFTQDL-DWVEMHFKEFVNLRD-V-EPTSPNKMKLLMISLMLAIGG
A0A7C4LRZ6      KADLENLRRQARALEASNTR-ENLLAILEEGLGS---P-SPIGPNRQKIILTGLLAGLGL
A0A351MR11      EDFLNRLKLSYEDAKLRTST-TGTSTSVRILDTPVVSE-RPINKNYYLNVFVGIGLGLAS
A0A388PR45      EEFLGRMKLNYEEAKLRTAT-SGISTSIRVMDKPSVSD-KPVNKNFSVNALAGLALGFFA
A0A388QR61      EEFLGRMKLNYEEAKLRTAT-SGISTSIRVMDKPSVSD-KPVNKNFTFNALAGLLLGLFS
A0A4P5YHI0      EEFLGRMKLNYEEAKLRTAT-SGISTSIRVMDKPSVSD-KPVNKNFTFNALAGLLLGLFS
A0A2A2RS01      EEFLARQKQNYEEQKLRSST-SGTSTSIKIQEMPSVAD-RPVNKNYYMNALTGMGLGLLV
A0A2A2Y1A7      EEFLARQKQNYEEQKLRSST-SGTSTSIKIQEMPSVAD-RPVNKNYYMNALTGMGLGLLV
A0A388PDH9      EEFLARQKQNYEEQKLRSST-SGTSTSIKIQEMPSVAD-RPVNKNYYMNALTGMGLGLLV
A0A2G4H1E7      EEFLGRMKLSYEDAKLRSST-SGTSTSISILDAPSVSD-RPINKNYYYAALIGFGSGLLF
A0A2G4GZA6      EEFLSRMKLSYEEAKLRSSN-SGTSTSINILDAPSVSD-KPINKNYYLNALVGMGSGLLF
A0A388P514      EEFLGRMKLSYEEAKLRSST-SGTSTSISILDQPSVSD-KPINKNYYFNALVGVGSGLLF
A0A2A2YG59      EEFLGRMKLSYEEAKLRSST-SGTSTSISILDAPSVSD-KPINKNYYFNALVGVGSGLLF
A0A2G4F7D5      EEFLGRMKLSYEEAKLRSST-SGTSTSISILDQPSVSD-KPINKNYYFNALVGVGSGLLF
A0A7V4IDX4      QSLYDRLQATMQTLSTDKDI-RPETVTVLERAST---A-LPDTDDAVRSLLIAAGLGLLA
A0A2V2SDN0      QAAYDKLLSVISTVDVGKSV-DQENVSVLEPAS----P-AGRASKLVRNLALAFAMALVL
A0A4Q3BVY2      DKARERLAQKLATVTFAEDF-DWVELRFKGLVSLRD-E-VPISPSKFKVAIIALTLGVAG
A0A8A7W4D3      DQARERLAEKLATITFAEDF-DWVELRYKGHISLRD-D-VPISPNKGKLAILSVALGLAG
A0A3R8L982      KSNYAQILDRLSQVNTSRNL-EKLPVRRLDRALPA--G-APYSPNPRSITQTSVALGLLV
A0A6N6QBS9      KEQLES-QNRNLAATTRLAV-EDEQFNVAESGGGD--P-IPVAPARPQIVLSGVGVGFIL
A0A2V5X6Z6      QTAYDKTLTLIQTVDVSKKV-EQENVGILEPAS----V-AAPTHRLFRNMAIALVGSLLL
A0A2V5VGZ7      QTAYDKTLTLIQTVDVSKKV-EQENVGILEPAS----V-AAPTHRLFRNMAIALVGSLLL
A0A2V5U130      QTAYDKTLTLIQTVDVSKKV-EQENVGILEPAS----V-ATPTHRVLRNMAIALIGSLLL
A0A2V6C237      QTAYDKTLTLIQTVDVSKKV-EQENVGILEPAS----V-ATPTHRRLRNMAIALVGSLLL
A0A2E7HPU9      REVYNSLNTQLAELNAKKGE-TAVEVELDSFSELP--R-KPSSPKQLTTLGAGTILGSVL
D5EML0          REMFNKLMNRYRETRIAQQM-NLNNMLVLDRANLP--M-QPLTMSRTQMVAAAIVLGAVF
A0A1V6GL40      RALYDQLLATMQTLDVNKEI-SPESVETIEAASP---A-YAARLDLWKGAVNGALLGLAL
A0A7X7VL75      RALYDQLLATMQTLDVNKEI-SPESVETIEAASP---A-YAARLDLWKGAVNGALLGLAL
A0A7C4PPJ4      KNELESLRRKARALEASNTR-GDKELAILEEGIGS--P-LPISPNRQKIILVGLFLGLAA
A0A3C1C1M3      DASYLGLLTRIQEARLSADE-NTATVKLASEVAP---A-RQIFPRPARVLLMALLLGLAV
A0A2S7U4L6      VNNLNTLRTSNVIEELQENM-SIEPIEFYSYPQEPEVA-DYVSPNWILNMALGSVAGMIF
A0A2E9EYJ1      KEMLNGMQSQLAKETIDSAG-QRTPLVIHELAEPQDVD-KPARPNXKLHLVLGAAVGLIF
A0A258AXR6      EDLLVKMRSRYFEEKAGIEL-VKSPATIYSDAEPE--G-KPAKPNVPLHLALGGVLGLMF
A0A7W7YD86      EDLIVKMRSRYFEEKAGIEL-VKSPATIYSEAEPE--A-KPAKPNVPLHLALGGVLGLMF
A0A3D3NZQ6      EAILRTLKTRYFETKAGLEI-FKSPATIYAKAEPE--G-RPAKPNVALNLALGGILGLMF
A0A1T4WVZ9      ENLLLQLKSSYFETKAGLEL-VKSPATLYAKAEPE--G-KPAKPNVALNLALGGVLGLML
A0A4R7SSI6      ENLLLQLKSSYFETKAGLEL-VKSPATIYAIATPE--G-KPAKPNVALNLVLGGVLGLML
A0A7W8DNH5      ESLLTQLKSSYFQTKAELEL-VKSPATIYAVATPE--G-KPTKPNVALNLALGGVLGLML
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      ---------------------------------------APIKPKKMLTLFLGIVGGLGA
A0A660Q3A0      ---------------------------------------SPVTPRKLQSIFIAALIGLGL
A0A849Y855      ---------------------------------------APVGPNRTRQLMISGLLGLGI
A0A2D5W0Q9      ------------------------------------------------------------
A0A857ZXX2      -------------------------------------------------MLTAAAGGAIV
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      ---------------------------------------------------------MGX
A0A7C5CZ90      ----------------------------------------------------GIIFGLLI
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      GVGMAFALEYIDSHLNTPEHVWRAVDLNTLGVV---------PDLDS-LGHRPLISYAPA
A0A3D4CZT6      GIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVI---------P-----------------
A0A4V1S9Q4      -VGIAFFLEYLDTSVKSLEDVERYLQVPVLAVI---------P-----------------
A0A355VK99      SILAFMGVAMLNNKVNNKHDLPSVNRQPVIAEL---------P-----------------
A0A2V6N5E0      GLAILILLDRIDDRMASFSEFQHHFSENILGQI---------P-----------------
A0A2V6NH44      GIMILLLLDRIDDRMASYGEFQRHFSENVVGQI---------P-----------------
A0A3D0IZR7      GLSLAFFIEYLDTSIKTMDDVERFLGISVLAVI---------P-----------------
A0A520LRZ3      GIGMAFFLEYLDTSVKSLDEVEHFLELPVLAVI---------P-----------------
A0A356FSV4      GLGLVFGIAFLDDRVKSAFDIEGTIGLPLIGII---------P-----------------
A0A3D3DET9      GLGLLLVLDRLDDRVGSFTELQDLFDENVLGQV---------P-----------------
A0A355SVK9      GAGFVLLIAFLDDRVKSAFDIEGAIGLPLLGVV---------P-----------------
A0A2E5D7I3      GLGLVLLLLXLDNRFXTVSQVEXETGMPVLAAV---------PVLEA-KKLEAAEXSESX
A0A2V5NYE2      SVVLLLILDRLDDRVNSVTELQDLFDEPILGQV---------P-----------------
A0A353DI77      GLALAFMFQFVDNKIHGVADIEQTFGISILSAIQKL------PPEEELLKEMESIRDLPV
A0A2V6FIP7      AMGLAFFVNYLDDSIKSQDDVETYLRLPFLGYV---------PNIK--------------
A0A3C1UJT2      AYGYLYLMNMMDQSIKSVEQAEKILQLPVLAAV---------PVSEI-NGKPT-------
A0A258AXL1      GLGGPVLTERLRFTSSFVGEAEKYCQYPACGIV---------PLMEI-------------
A0A2V5UAD5      GFGCVFLVAVRDDRFITLTDVIEKLGDAVLGQV---------PEVRK-RRRKS-------
A0A7Y4QK88      GLAIIGLIALRDDRLLSVTEANSKLGDSIVAML---------PQIDH-ADGKG-------
A0A1V6GCZ3      GVGLAFFIEYLDTSVKTIDDVERALQCPVLGVI---------PQ----------------
A0A7V3WMH6      GVGLAFFIEYLDTSVKTIDDVERTLQAPVLGVI---------PQ----------------
A0A2S7U0Z3      GFAAAFGLSILDYKIYDVRSAEEATGLTCMAAI---------PASSKFGRQDK-------
A0A2E6T1E0      GFGLAFFVNFLDDSIKSQDDVETYLNLPFLGYI---------PNIK--------------
A0A5E6MKA7      GIGLAIGLAKFDTRLRGKEEVERALGLPVLGMV---------PDTEKLRAKGIDEIPADL
A0A7W1HKQ4      GIGLAFFIEYLDTSVKTMDDVETLLGVPVLAII---------PQ----------------
A0A6B3L936      GVGLVFLLSLMDYKIYDVRSAEEATGLPCLAAI---------PLSSAVDSEDG-------
A0A2N8IR72      SILAFMGAAMLNNKVNNKHDLPAANRQPVIAEL---------PQMSKKESK---------
A0A2N8IV96      GIGLALLLEFMDTSVKTMEDVERALQVPVLGII---------PK----------------
R7E1V8          GIGLALLLEFMDTSVKTMEDVERALQVPVLGII---------PK----------------
A0A2E0R252      GVGIILLLGFLDPTVRTVADLEVLTGTPVIGAM---------PASK---NTER-------
A0A3E1EF48      GIACIFLIGFLDPSIRTVGELERDARLPVIGAV---------PSSSSKGDGTK-------
A0A2A2PVG8      GIAIIMLLGFLDPTLRTVAEVEQFCGIPVVAGL---------PAFK---KRES-------
A0A2E0R421      GVALILLMGFLDLTIRTVSELEGMTGKPVLGAI---------P--D---EKNP-------
A0A2E5EJ69      SFMLVFIVQQLDKTVKSIDEAERLFGVPVVGAV---------PKNPE-IKDDQ-------
A0A2G4I5Z5      SVGLIWLLVQLDTTIKSVDHAERLLGIPVLGAV---------PKNKLIKNG---------
A0A4P5QQV6      GIVCLLGISMFDDRIDSVVDFQATFPDRLLATI---------PHVSC-AVGAV-------
A0A2E7ALI1      GLGLVFLLLRLDNRFRTVSQVEEETGMPVLSAV---------PVLE--------------
A0A178IDB9      FLGLPIGIGLMDTRVKSSHDVETGLDHPLLGGI---------KTMKK-LTEAE-------
A0A290QD69      FFGIPVGLGFLDTRVKSSHDVESGLNQTLLGGI---------KAMKK-LSETE-------
A0A6N6ZC77      GLVLIAGLGLIDNRVVSGEDLRNRFDAPILGLI---------PVED--QRQDG-------
A0A832M896      GCAILFLLDRIDDRVNSFTELKDQFEEQVLGQI---------PREAGAAKR---------
A0A538NJ59      GFGCVFLVAVRDDRFITLTDVIEKLGDAVLGQV---------PEVRK-RRRKS-------
A0A2A2R3V9      GVGILFLLDRIDDRINSFTELRDHFEEPVLGQI---------PMDPTLARKKG-------
A0A3C1VFY9      GLAILILMDRVDDRMSSFTELEELFDEDVLGNV---------PREKS-PDKNT-------
A0A2V2SMX4      SLLVMLFVDRLDDRMASFTELQELFDEEILAQI---------PREGK-AREVS-------
A0A522AC27      SLAILLLLDRLDDRMNSYTDLQDLFDEEVLGQI---------PHEGL-EKGQK-------
A0A6M1RFD0      GMGLLLIVERFDDRMNTFVELQDHFEEPVLGQI---------PRERS-GRNGD-------
A0A7C3HXH0      GVGLLLLVDRFDDRMNTFVELQDHFEEPVLGQI---------PRERS-SRNHD-------
A0A432FDF6      GVGLAFFIEYLDTSVKTIDDVERALNAAVLGVI---------PQ----------------
A0A2E7VDS1      FILIPMAFEFIDNRVKSPWDIEVFLGRDLIAGI---------PKIST-IKEAE-------
A0A7C8D3W3      GLGIVYLCQRLDDRMELAEDIETALELPVLGQI---------PQMNL-KDMNQ-------
A0A178IFJ2      VIGYPVGMELLFNRIKTWTDVERYIGLPLLSEF---------PVLKN-LPGDT-------
A0A357FSP9      GAGLIFVVAFLDDRVKSAFDIEGTVGLSMLGVV---------PRIKK-LDSNS-------
A0A1T4WWY4      AGGVPFLLRRFDSSVVELSEFEGTLGINGIGLV---------PLSDP-KELESLN-----
A0A3D3LEQ6      AGGVPFLLKQMDSTVTDLNEFEETLGIPGIGLV---------PLTDP-EVLEEVN-----
A0A3D3NW23      AGGVPFLLKQMDSTVTDLNEFEETLGIPGIGLV---------PLTDP-EVLEEVN-----
A0A522ACN3      GVGLAFFIEYLDTSVKTIDDVERTLQSPVLGVI---------PQ----------------
A0A2A2R174      SVGVIWLLVQLDTTIKSVDHAERILGLPVLGAV---------PKNKL-IRDG--------
A0A1H2DTI1      GMAILFIIDRFDDRINSTTELRDYFSERILGQM---------PFEVS-LGDRS-------
A0A1H1MGC9      GTAFAFFVAYIDDRVKSSFDIESVVGLPLIGIV---------PEIKR-LDQPE-------
A0A1V5L462      GAAIVFLLAALNNRITSADDLRRMFSSKVIGLI---------PQTKA-------------
A0A3D3LGD3      GFGLAFALEFMDTSIKSLDDVERFLGVPVLAVV---------PK----------------
A0A350ARX4      GIVIIAAISFLDVRIRNSDELAKRFDHPVIGVI---------PEELQ-NANG--------
B5JIS2          FFGVPLGMQLFDQRLKCATDIEKEFGKGLLGGI---------PKLSR-VKVAD-------
A0A7Y1UGD7      GLGLAFLFHVLDNKLHTVADVEKQFNAPVLSAIAAIDAGSMAPKKGR-KPAPKPGEDEAL
A0A2E5K4P7      GLFMVFFTAFIDNRVKSPFDIEQVIKLPLVGVI---------PQIRK-LDSFK-------
A0A842HH73      GLGFVFVIAFLDDRIKSAFDVETAVGLPLIGIV---------PRIKR-LNSLE-------
A0A2E6NAH3      GVGLIFAVAFLDDRVKSAFDIEGTIGLPMLGVI---------PRIKK-LDTST-------
A0A2A5VZA5      GGGLVFIVAFLDDRVKSAFDIEGTIGLPLLGVI---------PRIKK-LDSST-------
A0A424R295      GGGLVFIVAFLDDRVKSAFDIEGTIGLPLLGVI---------PRIKK-LDSST-------
A0A1H2GQN6      GLSVAFFIEYLDTSVKSLNDVEKTLGVPVLGII---------PR----------------
A0A858RDL7      GVGLALLLGRLDNRYHTVAQVSAETGAPVLAAI---------SEIKP-GDLKRAERDQKR
A0A512M3Y3      AAGGCFGLEKLRSTTSLVTETEKLTGLNAVGVV---------PLLAN-SAQVE-------
A0A4P5R5J1      GLLVLFVLDKMDDRIGSFFEFRERFPEPLLGQV---------PRELT-KA----------
A0A4P5YK43      GIGIVYVLYRLDDRLDLAEDIEESLQEPVLGQI---------PAVDR-KNHAD-------
A0A2A2RPW6      SVGLIWLLVQVDSSIKSVDHAERVFGLPVLGAI---------PKNKL-ITDG--------
B1ZT68          FVLIPLGMGLMDTRIKTVSHVEDALGEVLLGAV---------KTIDG-LGEIE-------
W0J7C2          LFVLPLGIGLLDSRLRTPAQVEDSLQEPLLGVV---------KHMGK-LGETE-------
B4D1I7          GLLLLVLIDQLDDRVASYTEFQSYFRERVFAQI---------PHSPS-DGRSE-------
A0A353F286      GIAIALLLEHLDTSVKSLEDVERYLQVPVLAVI---------PK----------------
A0A354FSA6      GIAIALLLEHLDTSVKSLEDVERYLQVPVLAVI---------PK----------------
A0A3B9GA54      GIAIALLLEHLDTSVKSLEDVERYLQVPVLAVI---------PK----------------
A0A520LEH8      GIAIALLLEHLDTSVKSLEDVERYLQVPVLAVI---------PK----------------
A0A6B2M0T8      FSCVPFGIHYLNLNLKTATDIEQQLRVPFLGEI---------RTFPR-RLKKL-------
A0A2D7B7R6      AYGYLYLMNMMDQSIKSVEQAEKILQLPVLAAV---------PVSEI-NGKPT-------
A0A353DCA1      GIGIAFLLEHLDTSVKSLEDVERYLQVPVLAVI---------PK----------------
A0A7C5H7K5      GILLIMILERVDDRICSYSDVVNNFSEPLLGQI---------PNWKS-FRTKQD------
A0A7V3QF58      GILLIMILERVDDKICSYSDVVNNFSEPLLGQI---------PNRKY-FHTKGD------
A0A832FWF3      GILLIMILERVDDKICSYSDVVNNFSEPLLGQI---------PNRKY-FRTKGD------
A0A838YJR8      GIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVI---------PK----------------
A0A6N4WVA3      AGGVLFLLGALDNRILSANELSAQFQHPLIGAI---------PYEKV-NEGDV-------
A0A0R2XPB1      AAGILFVLAAIDNRILTASELSAQFKDPLIGVI---------PFEVN-HDGDV-------
A0A348NQP1      AAGVLFVLAAMDSRILTASELSAQFKDPLIGAI---------PFEAS-NDGDE-------
A0A357FV58      AAGVLFVLAAMDSRILTASELSAQFKDPLIGAI---------PFEAS-NDGDE-------
A0A2G4GZN8      GVVLIIVIGTLDDRIKSAKDVEGSLGLPLIGTI---------PRATV-TSGPD-------
A0A348NPT1      GAGLIFVVAFLDDRVKSAFDIEGTVGLSMLGVV---------PRIKK-LDSNS-------
A0A2E1KV60      GLGLVFAVALLDDKVKSVFDIEASIGLPMLGII---------PKVKK-LDSVS-------
A0A2D7F4D9      GLGLVFAVALLDDKVKSVYDIEASLGLPILGII---------PKVKK-LDSVS-------
A0A3R7RBR8      GLGLVFAVALLDDKVKSVYDIEASLGLPILGII---------PKVKK-LDSVS-------
A0A2E0NH28      GLGLVFGIAFLDDRVKSAFDIEGTIGLPLIGII---------PQIKK-LDSTT-------
A0A368BGT4      GVGLIFSVAFLDDRVKSAFDIEGTIGLPMLGVI---------PRIKK-LDSNA-------
A0A317ZP96      GTALVFAVAFLDDRVKSAFDIEGTIGLPMLGVI---------PRIKK-LDTNT-------
A0A350AS32      GMGLVFIVAFLDDRVKSAFDIEGTIGLPMLGIV---------PRIKK-LDTNS-------
A0A7W8DI01      GIGGPVLTERLRFTSSFVGEAEKYCQYPACGIV---------PLMEP-KA----------
A0A6N6PLV8      GIGLAFFIEYLDTSVKTLDDVERFLQIPVLAVI---------PK----------------
A0A290QE54      FVGVAIGLSFIDDRIKSSWDVEHFIGVHLLGIV---------PDLSG-LKDDD-------
A0A1H1SWX2      FAGVAIGLSFLDDRVKSAWDIEGFIGAHLLGII---------PELGD-VPDTE-------
A0A1D8AZK8      FAAVAIGLSFIDDRVKSAWDIEGFIGAHLLGII---------PELGD-VPDTE-------
A0A4Q1C9I5      FVGVAVGLSFVDDRVKSAWDIEGFIGAHLLGII---------PELGD-VPDTE-------
A0A842HCC8      GVGILFAFAMTDNRLTSVEDVTQRFHAPVLGII---------PLQKQ-RQG---------
A0A1G3ZL71      FFGVAFGLSVVDDRIKSAWDVESYLGVHLLGII---------PELAH-VATDS-------
A0A556QP09      FFGVAIGLSFIDDRIKSAWDIEHFIGANLLGII---------PDLSS-LKDSE-------
A0A2T6DX88      FVAVAFGLSIVDDRIKSAWDVESFIGVTLLGIV---------PDLSS-LKDDE-------
A0A2T6CWI7      FLGVALGLSFIDDRIKSAWDVESFVGANLLGIV---------PDLGN-LKDEE-------
A0A3E1E5C8      FFAAGLGLAFLDDRIKSAWDVESYIGANLLGII---------PDLSA-VTDDD-------
B1ZZ74          FFGVAFGLSFIDDRIKSAWDVESFIGASLLGII---------PDLAA-LKDDE-------
A0A2E0V4K6      GVGLILLLLRIDNRFRTVAQVEEETALPVLAAV---------PVLSA-KRLSAAEKSNKE
A0A7W1VQ11      AIAVPFLLEFLDSRISDLEDAEESLHLRGLGIV---------PQIES-SGSD--------
A0A2V6F9Q9      GILILLVLDRIDDRMASYGEFQRHFLENVVGQI---------PKEKA-KG----------
A0A2V6NZZ3      GIMVLLLLDRIDDRMASYGEFQRHFSENVVGQI---------PKEKV-KG----------
A0A2V6EBU2      GIMVLLLLDRIDDRMASYGEFQRHFSENVVGQI---------PKEKV-KG----------
A0A2V6EY06      GIMVLLLLDRIDDRMASYGEFQRHFSENVVGQI---------PKEKV-KG----------
A0A2V6ME53      GIMILLLLDRIDDRMASYGEFQRHFSENVVGQI---------PKEKV-KG----------
A0A538NUU0      GIMILLLLDRIDDRMASYGEFQRHFSENVVGQI---------PKEKV-KG----------
A0A2V6NIJ1      GIVILLLLDRIDDRMASYGEFQRHFSENVVGQI---------PKEKV-KG----------
A0A2V6C292      GIMILLLLDRIDDRMASYGEFQRHFSENVVGQI---------PKEKV-KG----------
A0A2V6D2X0      GIMILLLLDRIDDRMASYGEFQRHFSENVVGQI---------PKEKV-KG----------
A0A2V5ZUK1      GLGILILLDRIDDRMASFSEFQHHFSENVLGQI---------PKEKA-KG----------
A0A7W1MVB5      GLLILVLLDRIDDRMASFTEFQHQFTENILGQI---------PKEKT-KG----------
A0A7W1U7H7      GLLILVLLDRIDDRMASFTEFQHQFSENILGQI---------PKEKT-KG----------
A0A2V5XFN9      GLAILILLDRIDDRMASFSEFQHHFSENVLGQI---------PKEKT-KG----------
A0A2V6EZC8      GLAILILLDRIDDRMASFSEFQHHFSENVLGQI---------PKEKT-KG----------
A0A2V6I7Z5      GLAILILLDRIDDRMASFSEFQHHFSENVLGQI---------PKEKT-KG----------
A0A3B9LCP2      GIGILILLDRIDDRMASFGEFQRQFSENVLGQI---------PKDKT-KG----------
A0A3C0R669      GIGILILLDRIDDRMASFGEFQRQFSENVLGQI---------PKDKT-KG----------
A0A2V6EID2      GIGILFLLDRIDDRMASFGEFQHQFSESVLGQI---------PKEKT-KG----------
A0A2V6MHB0      GIGILFLLDRIDDRMASFGEFQHQFSESVLGQI---------PKEKT-KG----------
A0A7V9V4N8      GLIILLLLDRIDDRMASFGEFQNHFSENVLGQI---------PKEKT-KG----------
A0A838I5D7      GIAILLLLDRIDDRMASFGEFQHHFSENVLGQI---------PREKT-KG----------
A0A2W5YWL9      GFGILLLLDRIDDRMASFSEFQHHFTENVLGQI---------PKEKS-KG----------
A0A2V5NH62      GIAILLLLDRIDDRMASFGEFQHHFSENVLGQI---------PKEKT-KG----------
A0A2W6A620      GIGILLLLDRIDDRMASFGEFQHQFSENVLGQI---------PKEKT-KG----------
A0A2V5PIJ4      GLAVLFLLDRIDDRMASFGEFQHQFSENVLGQI---------PREKV-KG----------
A0A2V6K2G8      GLAILILLDRIDDRMASFSEFQHHFSENVLGQI---------PKEKT-KG----------
A0A2V5W206      GLAILILLDRIDDRMASFSEFQHHFSENILGQI---------PKEKT-KG----------
A0A2V6MW77      GLAILVLLDRIDDRMASFSEFQHHFSENILGQI---------PKEKT-KD----------
A0A838MZM0      GLVILLLLDRIDDRMASFGEFQNHFSENVLGQI---------PKEKT-KG----------
A0A838DHH0      GIAILLLLDRIDDRMASLSEFQHHFSENVLGQI---------PREKT-KG----------
A0A838FJZ1      GIGILLLLDRIDDRMASLSEFQNHFSENVIGQI---------PREKT-KG----------
A0A0E3YV65      FVAYPVALELIFNRVKGWSDVENYLGLPLLAEL---------PLLNK-IKTEF-------
W0J900          IIGYPVGMELIFNRVKTWTDVERYIGLPLLSEF---------PVLKK-LPDDK-------
B4CZV9          ALGIPFLIEYLDHTMTNLEEVEHSFRLRGLGVV---------PQTEA-TDMFLP------
A0A7X1AX64      GVGFALGLAFLDNRVKSAYDVEEMVGIPLLGIV---------PKIDR-RLSSAD------
A0A3B9FM17      FILIPVCLEFIDNRVKSPWDIEVFVGNDLIGGI---------PKISE-VEERE-------
A0A7W7YGS1      AGGVPFLLKRFDSSVVELNEFEGTLGINGIGLV---------PLSDP-KVLEQLN-----
A0A2D7WMI4      FFVVPFLLEFIDNRIKSPWDIEVFLGRELISGI---------PKISN-IIENE-------
A0A2D6VHX5      FLVIPIALEVIDNRIKSPWDIETFVGEDLLTGI---------QKISE-IDELR-------
A0A2D8I214      FILIPVSLELVDNRVKSPFDVEVFIGKDLIGGI---------PKISD-VEEAH-------
A0A1Z8VL41      FIIVPILLEFVDNRVKSPWDVDVFIGKDLIGGI---------PQISQ-VEETK-------
A0A2E6TNA4      FIIVPILLEIVDNRVKSPWDVDVFIGKDLIGGI---------PQISQ-VEETK-------
A0A1Z8RG47      FFALPILLEFVDNRVKSPWDVEVFVGHDLIGGI---------PKISE-VDERE-------
A0A1Z8RJJ5      FFALPILLEFVDNRVKSPWDVEVFVGHDLIGGI---------PKISE-VDERE-------
A0A2D7V631      FFALPILLEFVDNRVKSPWDVEVFVGHDLIGGI---------PKISE-VEERQ-------
A0A354RA24      FFALPILLEFVDNRVKSPWDVEVFVGHDLIGGI---------PKISE-VEERQ-------
A0A2E9RV62      FVLIPFGFEFIDNRIKSPWDIEVFLGQDLIAGI---------PKISE-VKEVD-------
A0A2E4AY96      FILFPFLLEFIDNRIKSPWDIQVFLGRDLISGI---------PKISN-IDEQE-------
A0A3B9B9P4      FILFPFLLEFIDNRIKSPWDIQVFLGRDLISGI---------PKISN-IDEQE-------
A0A2D5Y6N6      FVIIPFLLEFIDNRVKSPWDVEVFIGRDLIAGI---------PKISE-VEENQ-------
A0A2E7HSS8      FILIPICLEFIDNRVKSPWDVEVFIGNDLIGGI---------PKISE-IEERE-------
A0A2D8VCK3      FILIPVCLEFIDNRVKSPWDIEVFVGNDLIGGI---------PKISE-VEERE-------
A0A350QVY4      FILIPVCLEFIDNRVKSPWDIEVFVGNDLIGGI---------PKISE-VEERE-------
A0A2E4ZYR7      FILIPIGFEFIDNRIKSPWDVEVFIGRDLIAGI---------PKIST-IKEAD-------
A0A2E6TCV1      FVLIPIAFEFIDNRVKSPWDIEVFIGRDLVAGI---------PKIST-IKEAD-------
R7E4L8          SLLALLAGNALNTKVRDKKDLAGLTDLPLAGEL---------PLLSG-KERKK-------
A0A4P6PCA7      GAGLAILMDFMMNRVGSVTDLKD-LGLHVLGIL---------PRESK-YMTRA-------
A0A2T6DSN5      LFGIPLGLGLLDTRVKSPSDVEAGLEQVLLGGI---------KTMKK-LSETE-------
A0A317ZIW7      AIGVLALISFLDNRIFSAADITNHFDEPLLGAI---------PFEKN-HDGDH-------
A0A7C4PPT4      AIGIPFLIEFLDHTVSNVEEMEQNHRLRGLGIV---------PRLEP-SQLPG-------
A0A7C4QZX4      AFGAPFLLEFLDHTVTSVEQIEQHHRLRGLGVV---------PLVAQ-SQGAR-------
A0A3C1AXQ2      GVGLAFFLEYMDTSVKSLDDVERFLGVPVLAVI---------PK----------------
A0A3D4HHL8      GVGILFIISILDSRIISVEDVENRFDQPLMGII---------PFQKY-DGD---------
A0A366HV03      AIGVPLGLEQLNDKITSLAALEKLTGLKGLGIV---------PTSSS-TFLESV------
A0A6G6K911      AIGVPLGLEQLNDKITSLAALEKLTGLKGLGIV---------PTANS-TFLEGV------
A0A832HT83      AIGVPFLLEFLDHTVSNVEEVEHMHRLRGLGIV---------PKLEP-SQLPG-------
A0A5R8KAF2      AIGAPTLVNLMHTGVETLQQLENVTGLTAVGVI---------PRTTK-EVLEDIAR----
A0A7C4LRZ6      GLMIIYLLDRLDDRLELAEDIEAELDQPVLGQL---------PLIGR-RDFRK-------
A0A351MR11      GVGLVVLLGVFDDRVKSAVDIEGGLGLPLVGTV---------PRTTD-TYGPD-------
A0A388PR45      GVGLVLLLGTLDDRLKSVRDLEGGLGIPVLGTV---------PKVSE-TAGPD-------
A0A388QR61      GVGLVVLMGMLDDRIKSVKDIEAGLGVQVLGTV---------PKVAE-TTGPD-------
A0A4P5YHI0      GVGLVLLMGMLDDRIKSVKDIEAGLGVQVLGTV---------PKVAE-TTGPD-------
A0A2A2RS01      GFGLIVLMGSFDDRVKSAKDVEMGLGLPLLGTV---------PKVTE-AVGPD-------
A0A2A2Y1A7      GFGLIVLMGSFDDRVKSAKDVEMGLGLPLLGTV---------PKVTE-AVGPD-------
A0A388PDH9      GFGLIVLMGSFDDRVKSAKDVEMGLGLPLLGTV---------PKVIE-AVGPD-------
A0A2G4H1E7      GIVLVFVLGALDERIKSAADIEGSLGLPLIGTI---------PQVVR-ASGPD-------
A0A2G4GZA6      GVVLIVVIGTLDSRIKSAKDVEGSLGLPLIGTI---------PRVAN-VSGPD-------
A0A388P514      GVVLIVVIGTLDSRIKSAKDVEDSLGLPLIGTV---------PRVAN-VSGPD-------
A0A2A2YG59      GVVLIVVIGTLDSRIKSAKDVEDSLGLPLIGTV---------PRVAN-VSGPD-------
A0A2G4F7D5      GVVLIVVIGTLDSRIKSAKDVEDSLGLPLIGTV---------PRIAN-VSGPD-------
A0A7V4IDX4      ALGLLLLLDRFDDRVTSFTDLQDIFDEPVLCQV---------PREIV-LNENG-------
A0A2V2SDN0      GAGLLWVLSKLDDRFVSSTELAEDLPEKVIGQV---------MDIQL-VKPEG-------
A0A4Q3BVY2      AFGVPTALNLLNTSASTVPQLEQLTGLEGIGIV---------PMTSK-EMLED-------
A0A8A7W4D3      AFGAATLLNLMDTSASTVPQLELATGLRGIGIV---------PLTPR-EVLED-------
A0A3R8L982      FFGVAFGLNLIDDRIKSAWDVEHFIGANLLGII---------PSLGD-IKDHD-------
A0A6N6QBS9      GVVALLLLHKLDDRLDNPERIEEALGEPILGQL---------PEVDK-KHYKE-------
A0A2V5X6Z6      GFGLLYCIGLFRDDFASLAELTHQLSEEVVGQI---------PAISI-KKPKR-------
A0A2V5VGZ7      GFGLLYCIGLFRDDFASLAELTHQLSEEVVGQI---------PAISI-KKPKR-------
A0A2V5U130      GFGLLYCIGLFQDDFASLAELTNQLCEEVVGQI---------PAISI-KKPRR-------
A0A2V6C237      GFGLLYCIGLFQDDFASLAELTNQLCEEVVGQI---------PAISI-KKSKG-------
A0A2E7HPU9      GFALAFLLANLDNKFHTVSQVELMSGLPILATI---------QHIDL-KVLAQLKDEKEK
D5EML0          LVGCPLVIELIDGRLTSFQDVEQGSHKALLGDV---------R--FY-GQKKG-------
A0A1V6GL40      GLGLLLVLDRLDDRVGSFTELQDLFDENVLGQV---------PREKL-VASKR-------
A0A7X7VL75      GLGLLLVLDRLDDRVGSFTELQDLFDENVLGQV---------PREKL-VASKR-------
A0A7C4PPJ4      GCGIIYLLDKLDDRLELAEDIEAELELPILGQI---------PLLT--GKQAK-------
A0A3C1C1M3      GFGLAILTEILEDRVGGIDDIEIGTGVKILAVL---------PHVK--TRKRK-------
A0A2S7U4L6      GIGIAFSLELMDTSVKSLEDVERYLQVPVLAVV---------P---------R-------
A0A2E9EYJ1      GIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVI---------P---------K-------
A0A258AXR6      GLGLAFFLEYMDTTVKSLDDVEHYLGVPVLAVV---------P---------K-------
A0A7W7YD86      GLGLAFFLEYMDTTVKNLDDVERYLGVPVLAVV---------P---------K-------
A0A3D3NZQ6      GFGLAFALEFMDTSIKSLDDVERFLGVPVLAVV---------P---------K-------
A0A1T4WVZ9      GVGLAFFLEYMDTSVKSLDDVERFLGVPVLAVV---------P---------K-------
A0A4R7SSI6      GIGLAFFLEYMDTSVKSLDDVEKFLGVPVLAVI---------P---------K-------
A0A7W8DNH5      GVGLAFFLEYMDTSVKSLDDVERFLGVPVLAVI---------P---------K-------
A0A4Q3AQI1      --------------------RRQDAEAVEAIRR---------PKLADESQPTS-------
A0A6N2CMN7      -----------------------MLGVVPRIKK---------LDTSTKAQAVA-------
A0A432FAS4      GFGLAFFVNFLDDSIKSQDDVESYLKLPFLGYI---------PNIK-TTSVIE-------
A0A660Q3A0      GIGLVFGLEYLDDTIRYPEEVTEGLGLPFFGVI---------PTAQWDPDDLA-------
A0A849Y855      AAFIIFLLERFDDRVKTIEELQELVPETVLGQI---------PMIAGRKDDSM-------
A0A2D5W0Q9      ------------------------------------------PNIK-SQSLVE-------
A0A857ZXX2      CILGFLGLALLNNKIKNRKDLNAVTHLPVVAEL---------PAMT-KKEQRQ-------
A0A7V6ECG3      ------------------------------------------------------------
A0A1Z9KB52      XLVIPIALEVIDNRIKSPWDIETFVGEDLLTGI---------QKIS-EIDELR-------
A0A7C5CZ90      GVGLAFFIEYLDTSVKTIEDVERSLQAPVLGVI---------PQNV-KL-----------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------DDVEHYLGVPVLAVI---------PKDV-GV-----------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      SRAKLLPTRMGQTQLDDISTRGKDLIVAHNPLSI-----Y--------------------
A0A3D4CZT6      -------TDVG-------VLHKQSGMSP-----------D--------------------
A0A4V1S9Q4      -------KDVG-------VLHKQSGMSP-----------D--------------------
A0A355VK99      -----QMSKKE-------SRNTKLFIQDEHSV-------I--------------------
A0A2V6N5E0      --------KEK-------TKGKVDLLQPDDARHV-----F--------------------
A0A2V6NH44      --------KEK-------VKGRMALLQPDDPRHI-----F--------------------
A0A3D0IZR7      --------------------KGAKFLTSDDPNSR-----F--------------------
A0A520LRZ3      -------QAVG-------VLHRQSGLSP-----------D--------------------
A0A356FSV4      -----QIKKLD-------STTKAQAVASNVDRH------V--------------------
A0A3D3DET9      -----REKLVA-------SKRQPSLILPEDTRHS-----F--------------------
A0A355SVK9      -----QIKKLD-------AHSKAQAVASNVDRH------V--------------------
A0A2E5D7I3      SXAKTXEGEGA-------PREMVSLARDVVFRDGLHSSLY--------------------
A0A2V5NYE2      -----QERAPA-------RRAEIKLIEPEDSRHS-----F--------------------
A0A353DI77      SMKHICPTLAV-------PGWKTDFVH---------------------------------
A0A2V6FIP7      ---------------------TNSVLERDLQAHL-----HPQSNA---------------
A0A3C1UJT2      ---------------------DSRLVMIESPNST-----C--------------------
A0A258AXL1      ---------------------DDRRLVPQLPDGK-----ESDAKVTTHA-----------
A0A2V5UAD5      ---------------------PLPLLEIDDDRHV-----Y--------------------
A0A7Y4QK88      ---------------------DLTLLTNDDPRHI-----Y--------------------
A0A1V6GCZ3      ---------------------NVGLLVDEGTESP-----H--------------------
A0A7V3WMH6      ---------------------NVGSLIEEGPESP-----H--------------------
A0A2S7U0Z3      ---------------------WQSILSHDPHSAN--------------------------
A0A2E6T1E0      ---------------------TTSIIERDLQAHL-----HPQSNS---------------
A0A5E6MKA7      ---------------------PMALATHVSPDSA-----I--------------------
A0A7W1HKQ4      ---------------------NIGLLAREGGDTP-----D--------------------
A0A6B3L936      ---------------------EWRSISSSDPNTV-----H--------------------
A0A2N8IR72      ---------------------NTKLFIQDEHSVI--------------------------
A0A2N8IV96      ---------------------NVPILHSSDVMGP-----D--------------------
R7E1V8          ---------------------NVPILHSSDVMGP-----D--------------------
A0A2E0R252      ---------------------KGSLALDAEDEQS-----QS-------------------
A0A3E1EF48      ---------------------RELVLLSRKD--P-----HA-------------------
A0A2A2PVG8      ---------------------RAESLELARDAQS-----KP-------------------
A0A2E0R421      ---------------------GEGVLVLNCKDTP-----LQ-------------------
A0A2E5EJ69      ---------------------GRLFVTKAPNSSC--------------------------
A0A2G4I5Z5      ---------------------KGRLFISDDPQSL-----C--------------------
A0A4P5QQV6      ---------------------DVAPLLPDDERHT-----F--------------------
A0A2E7ALI1      ---------------------LRKIEAAEKSHKK-----KEKEDSGAEASSEKALNFSQD
A0A178IDB9      ---------------------RPNVFRLHKDDAL--------------------------
A0A290QD69      ---------------------RPNVFRLGKDEAL--------------------------
A0A6N6ZC77      ---------------------RVELLQPADDRHM-----F--------------------
A0A832M896      ----------------------LALLQQNDSRQI-----Y--------------------
A0A538NJ59      ---------------------PLPLLEIDDDRHV-----Y--------------------
A0A2A2R3V9      ---------------------GPSLLVQDDRRHV-----Y--------------------
A0A3C1VFY9      ---------------------VLPLLQPDDLRHP-----F--------------------
A0A2V2SMX4      ---------------------GLPLITQNGSPHS-----F--------------------
A0A522AC27      ---------------------HLGLIHAEDPRHQ-----F--------------------
A0A6M1RFD0      ----------------------LPLLRPDDDRHA-----F--------------------
A0A7C3HXH0      ----------------------LPLLRPDDDRHA-----F--------------------
A0A432FDF6      ---------------------NVGSLLDEGDESP-----H--------------------
A0A2E7VDS1      ---------------------RPLIVGNELDDGL--------------------------
A0A7C8D3W3      ---------------------DRILISNLEKHNV-----F--------------------
A0A178IFJ2      ---------------------LNHLVLQDRDPDA--------------------------
A0A357FSP9      ---------------------KAQAVASNIDRHV--------------------------
A0A1T4WWY4      ---------------------RAPTVGANVPNAL--------------------------
A0A3D3LEQ6      ---------------------RSQTVGSKVPNAL--------------------------
A0A3D3NW23      ---------------------RSQTVGSKVPNAL--------------------------
A0A522ACN3      ---------------------NVGYLFEEGSESP-----H--------------------
A0A2A2R174      ---------------------KGRLFISDDPQSL-----C--------------------
A0A1H2DTI1      ---------------------NRRLIQPGDDRHT-----Y--------------------
A0A1H1MGC9      ---------------------KAQIVANNQDKQV--------------------------
A0A1V5L462      ---------------------KITVLRKEADDVF--------------------------
A0A3D3LGD3      ---------------------NVGILHRATGFNP-----D--------------------
A0A350ARX4      ---------------------QIDLLQVNDSRHR-----F--------------------
B5JIS2          ---------------------RPHVVRDNLDLAK--------------------------
A0A7Y1UGD7      VAARQHWD-------------PLLVFHAEGGKTH-----Y--------------------
A0A2E5K4P7      ---------------------KARIIESAKDNHV--------------------------
A0A842HH73      ---------------------KARAVAANVDRRV--------------------------
A0A2E6NAH3      ---------------------KAQAVASNVDRHV--------------------------
A0A2A5VZA5      ---------------------KAQAVAANVDRHV--------------------------
A0A424R295      ---------------------KAQAVAANVDRHV--------------------------
A0A1H2GQN6      ---------------------GVKPLNKEPKDTP-----H--------------------
A0A858RDL7      RNGGTLQDGPE-------EWNKMLLFRPGAANTT-----Y--------------------
A0A512M3Y3      ---------------------TLAINEHGLANAD-----VNI------------------
A0A4P5R5J1      ---------------------GLDLLASNDPRHA-----L--------------------
A0A4P5YK43      ---------------------GPLLANRLEPNSL-----F--------------------
A0A2A2RPW6      ---------------------KGRLFITDDPQSL-----C--------------------
B1ZT68          ---------------------RAHVYRLHKDDGL--------------------------
W0J7C2          ---------------------RARIFLSHASHDL--------------------------
B4D1I7          ---------------------SPAILMPEDERHA-----F--------------------
A0A353F286      ---------------------DVGVLHKQSGMSP-----D--------------------
A0A354FSA6      ---------------------DVGVLHKQSGMSP-----D--------------------
A0A3B9GA54      ---------------------DVGVLHKQSGMSP-----D--------------------
A0A520LEH8      ---------------------DVGVLHKQSGMSP-----D--------------------
A0A6B2M0T8      ---------------------HRLVLDQMDPQA---------------------------
A0A2D7B7R6      ---------------------DSRLVMIESPNST-----C--------------------
A0A353DCA1      ---------------------DVGVLHKQSGMSP-----D--------------------
A0A7C5H7K5      ---------------------AGEIITLNDDRQA-----F--------------------
A0A7V3QF58      ---------------------SGEIITVNDDRQA-----F--------------------
A0A832FWF3      ---------------------SGEIITVNDDRQA-----F--------------------
A0A838YJR8      ---------------------DINVLHKESGLSP-----D--------------------
A0A6N4WVA3      ---------------------HSVLLRKNDDRYV-----F--------------------
A0A0R2XPB1      ---------------------NSVLLRKNDDRYV-----F--------------------
A0A348NQP1      ---------------------NSVLLRKNDDRYV-----F--------------------
A0A357FV58      ---------------------NSVLLRKNDDRYV-----F--------------------
A0A2G4GZN8      ---------------------RALLARQDKDRIA--------------------------
A0A348NPT1      ---------------------KAQAVASNIDRHV--------------------------
A0A2E1KV60      ---------------------KSHIVASSSDRHV--------------------------
A0A2D7F4D9      ---------------------KSHIVTSTTNRHV--------------------------
A0A3R7RBR8      ---------------------KSHIVTSTTNRHV--------------------------
A0A2E0NH28      ---------------------KAQAVASNVDRHV--------------------------
A0A368BGT4      ---------------------KAQAVASNVDSHV--------------------------
A0A317ZP96      ---------------------KAQAVASNVDRHV--------------------------
A0A350AS32      ---------------------KAQAVASNVDRHV--------------------------
A0A7W8DI01      ---------------------KLAIEDGKDGNED-----DFAGSHA--------------
A0A6N6PLV8      ---------------------DITVLMKTTGDSP-----D--------------------
A0A290QE54      ---------------------KYSLVLKNREAPG--------------------------
A0A1H1SWX2      ---------------------KHSLVNSNRTSPG--------------------------
A0A1D8AZK8      ---------------------KHSLVNSNKTSPG--------------------------
A0A4Q1C9I5      ---------------------KHSLVNSNKASPG--------------------------
A0A842HCC8      ---------------------EVTLLQPNDDRLM-----F--------------------
A0A1G3ZL71      ---------------------LHTLAILSKATPG--------------------------
A0A556QP09      ---------------------KYKLVLDNKNTSG--------------------------
A0A2T6DX88      ---------------------KYSLVRRSEEAPG--------------------------
A0A2T6CWI7      ---------------------KYTLMLTEKQVQG--------------------------
A0A3E1E5C8      ---------------------KYSLLLKGPQTPG--------------------------
B1ZZ74          ---------------------KYSLLLSGKQAPG--------------------------
A0A2E0V4K6      RQGEGASRDEE-------HLWDSGIVFRPGLQSS-----LY-------------------
A0A7W1VQ11      ---------------------SQLFVGENASDHY-----F--------------------
A0A2V6F9Q9      ---------------------KMPLLQAEDPRHI-----F--------------------
A0A2V6NZZ3      ---------------------TMALLQPDDPRHI-----F--------------------
A0A2V6EBU2      ---------------------TMALLQPDDPRHI-----F--------------------
A0A2V6EY06      ---------------------TMALLQPDDPRHI-----F--------------------
A0A2V6ME53      ---------------------TMALLQPDDPRHI-----F--------------------
A0A538NUU0      ---------------------TMALLQPDDPRHI-----F--------------------
A0A2V6NIJ1      ---------------------TMALLQPDDPRHI-----F--------------------
A0A2V6C292      ---------------------TMALLQPDDPRHI-----F--------------------
A0A2V6D2X0      ---------------------TMALLQPDDPRHI-----F--------------------
A0A2V5ZUK1      ---------------------RVELLQPDDQRHV-----F--------------------
A0A7W1MVB5      ---------------------KVSLLQPDDARHI-----F--------------------
A0A7W1U7H7      ---------------------KVTLLQPDDARHI-----F--------------------
A0A2V5XFN9      ---------------------KVDLLQPDDARHV-----F--------------------
A0A2V6EZC8      ---------------------KVDLLQPDDARHV-----F--------------------
A0A2V6I7Z5      ---------------------KVDLLQPDDARHV-----F--------------------
A0A3B9LCP2      ---------------------EVTLLQPDDARHV-----F--------------------
A0A3C0R669      ---------------------EVTLLQPDDARHV-----F--------------------
A0A2V6EID2      ---------------------KLTLLQPDDARHI-----F--------------------
A0A2V6MHB0      ---------------------KLILLQPDDARHI-----F--------------------
A0A7V9V4N8      ---------------------KVSLLQPDDARHI-----F--------------------
A0A838I5D7      ---------------------KVSLLQPDDARHI-----F--------------------
A0A2W5YWL9      ---------------------KVQLLQADDPRHT-----F--------------------
A0A2V5NH62      ---------------------RVSLLQPDDARHV-----F--------------------
A0A2W6A620      ---------------------RVTLLQPDDARHV-----F--------------------
A0A2V5PIJ4      ---------------------DVMLLQQDDARHV-----L--------------------
A0A2V6K2G8      ---------------------RVDLLQPDDMRHV-----F--------------------
A0A2V5W206      ---------------------KVDLLQPDDARHV-----F--------------------
A0A2V6MW77      ---------------------KVDLLQPDDARHV-----F--------------------
A0A838MZM0      ---------------------RVTLLQPDDARHI-----F--------------------
A0A838DHH0      ---------------------QVTLLQPDDARHI-----F--------------------
A0A838FJZ1      ---------------------RVTLLQPDDARHI-----F--------------------
A0A0E3YV65      ---------------------LPHLLTRAADQDA--------------------------
W0J900          ---------------------LNHLVLQDTDPDA--------------------------
B4CZV9          ---------------------ATAVASDDTTKHG-----L--------------------
A0A7X1AX64      ---------------------RARAVATNLDSKV--------------------------
A0A3B9FM17      ---------------------RPLIVGNDLDDGL--------------------------
A0A7W7YGS1      ---------------------RSPTIGSTVPNAL--------------------------
A0A2D7WMI4      ---------------------RPLIVGNDLDDGL--------------------------
A0A2D6VHX5      ---------------------RPKIVGDDLDDSL--------------------------
A0A2D8I214      ---------------------RPLIVGNDLDDGL--------------------------
A0A1Z8VL41      ---------------------RPLIVGNDLDDGL--------------------------
A0A2E6TNA4      ---------------------RPLIVGNDLDDGL--------------------------
A0A1Z8RG47      ---------------------RPLIVGNDLDDGL--------------------------
A0A1Z8RJJ5      ---------------------RPLIVGNDLDDGL--------------------------
A0A2D7V631      ---------------------RPLIVGNDLDDGL--------------------------
A0A354RA24      ---------------------RPLIVGNDLDDGL--------------------------
A0A2E9RV62      ---------------------RPLIVGNELDDGL--------------------------
A0A2E4AY96      ---------------------RPLIVGNDLDDGL--------------------------
A0A3B9B9P4      ---------------------RPLIVGNDLDDGL--------------------------
A0A2D5Y6N6      ---------------------RPLIVGNDLDDGL--------------------------
A0A2E7HSS8      ---------------------RPLIVGNDLDDGL--------------------------
A0A2D8VCK3      ---------------------RPLIVGNDLDDGL--------------------------
A0A350QVY4      ---------------------RPLIVGNDLDDGL--------------------------
A0A2E4ZYR7      ---------------------RPLIVGNELDDSL--------------------------
A0A2E6TCV1      ---------------------RPLIVGNELDDSL--------------------------
R7E4L8          ---------------------LPLVVTNGRSFM---------------------------
A0A4P6PCA7      ---------------------DIAKSGIVDSFGP-----M--------------------
A0A2T6DSN5      ---------------------RPNVFRLGKDDSL--------------------------
A0A317ZIW7      ---------------------TMVLLRKSDERYI-----F--------------------
A0A7C4PPT4      ---------------------SPVAG--GHLDRQ-----I--------------------
A0A7C4QZX4      ---------------------SPSIDLKGNPDRQ-----L--------------------
A0A3C1AXQ2      ---------------------DVAVLHRASGFNP-----D--------------------
A0A3D4HHL8      ---------------------ILNPIKADDDRII-----F--------------------
A0A366HV03      ---------------------TRGIESDPRKPNH-----V--------------------
A0A6G6K911      ---------------------TRGIETDPRKPNH-----V--------------------
A0A832HT83      ---------------------YPMMDQKAPPDRH-----L--------------------
A0A5R8KAF2      ---------------------SPSIGAKSPNHL---------------------------
A0A7C4LRZ6      ---------------------SNLIITQMDEHSM-----F--------------------
A0A351MR11      ---------------------RALLARQTKDKMA--------------------------
A0A388PR45      ---------------------RALLARQDKDRQA--------------------------
A0A388QR61      ---------------------RALLARQDKDRLA--------------------------
A0A4P5YHI0      ---------------------RALLARQDKDRLA--------------------------
A0A2A2RS01      ---------------------RALLARQDKDKVA--------------------------
A0A2A2Y1A7      ---------------------RALLARQDKDKVA--------------------------
A0A388PDH9      ---------------------RALLARQDKDKVA--------------------------
A0A2G4H1E7      ---------------------RALLARQESDRIA--------------------------
A0A2G4GZA6      ---------------------RALLARQDKDRIA--------------------------
A0A388P514      ---------------------RALLARQDKDRIA--------------------------
A0A2A2YG59      ---------------------RALLARQDKDRIA--------------------------
A0A2G4F7D5      ---------------------RALLARQDKDRIA--------------------------
A0A7V4IDX4      ---------------------KLDLIHPQDDRHA-----F--------------------
A0A2V2SDN0      ---------------------ELRREALAAQRFE-----F--------------------
A0A4Q3BVY2      ---------------------VARSPAQGASVPN-----Y--------------------
A0A8A7W4D3      ---------------------VARSPAQGASVPN-----Y--------------------
A0A3R8L982      ---------------------RYKLFAVGPNAAD-----ESGGGNNNSEGAPDRRRDPER
A0A6N6QBS9      ---------------------GYLLLHRMKSHTM-----F--------------------
A0A2V5X6Z6      ---------------------RLGVEALEKQRFE-----F--------------------
A0A2V5VGZ7      ---------------------RLGVEALEKQRFE-----F--------------------
A0A2V5U130      ---------------------QLGVEALEKQRFE-----F--------------------
A0A2V6C237      ---------------------RLCVEGLEKQRFE-----F--------------------
A0A2E7HPU9      QLKVSDPPGIE-------LWDSRLIFRPALLQTL-----Y--------------------
D5EML0          ---------------------DAVYQAVLQKDAD-----L--------------------
A0A1V6GL40      ---------------------QPSLILPEDTRHS-----F--------------------
A0A7X7VL75      ---------------------QPSLILPEDTRHS-----F--------------------
A0A7C4PPJ4      ---------------------QRILITQMEEHSM-----F--------------------
A0A3C1C1M3      ---------------------EIATTSLTHQFGE-----L--------------------
A0A2S7U4L6      ---------------------DVGVLYKMSTASP-----D--------------------
A0A2E9EYJ1      ---------------------DINVLXXEXGLSP-----D--------------------
A0A258AXR6      ---------------------EVGVLHRSSGFNP-----D--------------------
A0A7W7YD86      ---------------------DVGVLHRSSGFNP-----D--------------------
A0A3D3NZQ6      ---------------------NVGILHRATGFNP-----D--------------------
A0A1T4WVZ9      ---------------------DVAVLHRTSGFNP-----D--------------------
A0A4R7SSI6      ---------------------DVAVLHRASGFNP-----D--------------------
A0A7W8DNH5      ---------------------DVAVLHRASGFNP-----D--------------------
A0A4Q3AQI1      ---------------------YLLDREKSTETNL--------------------------
A0A6N2CMN7      ---------------------SNVDR------HV--------------------------
A0A432FAS4      ---------------------RDLQSHLHPQSNS--------------------------
A0A660Q3A0      ---------------------THLLSNIASNSGV--------------------------
A0A849Y855      ---------------------PLLMANLPEHNNF--------------------------
A0A2D5W0Q9      ---------------------RDLQAHLHPQSNA--------------------------
A0A857ZXX2      ---------------------VARMFTDE-HSVI--------------------------
A0A7V6ECG3      ---------------------MLITNGIESGSVF--------------------------
A0A1Z9KB52      ---------------------RPKIVGDDLDDSL--------------------------
A0A7C5CZ90      ------------------------LINEGADSGY--------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------LHKQSGMSPD--------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------MYGK--------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      ------------SEAYRTI--RTA--L-L-L--SQ-PGGNRKVILLTSPSPGEGKTATTL
A0A3D4CZT6      ------------AEAYRIL--RTN--I-E-F--NR-NNPEDNSITIVSGGAGEGKSTTLV
A0A4V1S9Q4      ------------AEAYRIL--RTN--I-E-F--NR-KNPEDNAITVVSGGAGEGKSTTLV
A0A355VK99      ------------AECFHIL--RNN--VDSML--PR-PEQGGHVILVTSTLPGEGKTFTSA
A0A2V6N5E0      ------------AESYRNI--RSS--I-FFM--PY-DGPRPKSFLVTSAVPSEGKSTLSA
A0A2V6NH44      ------------AESYRNI--RSS--L-LFM--PY-QGPRPKTILVTSAVPNEGKSTVSA
A0A3D0IZR7      ------------AEGYRIL--CAK--L-N-L--TG-ARASARTITVLSGGPGEGKSTTTF
A0A520LRZ3      ------------AEAYRIL--RTN--I-E-F--NR-KTADANSMTIVSGGAGEGKSTTLV
A0A356FSV4      ------------TETFRSI--HSA--I-R-L--NE-ESKNAKVFLTTSTVPSEGKSFVSS
A0A3D3DET9      ------------VEAYRNL--RSS--L-LYM--TE-AGNRPKTILVTSSVPNDGKSITAA
A0A355SVK9      ------------TETFRTI--HSS--L-R-L--NE-ESKNAKILVTTSTVPGEGKSFVSS
A0A2E5D7I3      ------------AESYRIL--RAA--V-M-L--LG-DEKKRKISAFSXALPGEGKTTTSV
A0A2V5NYE2      ------------LEAYRNL--RSS--L-LYM--VK-ASERPRTLLVTSSEPNEGKSLTSA
A0A353DI77      ------------SEMFRVL--RAS--I-SLL--GD--TNQRKITMITSSVPGEGKTFCAA
A0A2V6FIP7      ------------AEGFRTI--RAA--I-ALA--PK--SDQYHLLAITSTIPAEGKSLVAS
A0A3C1UJT2      ------------SEAFRSL--RVN--I-ESM--TR--KKSHKVVLFTSSIPSEGKTFTSI
A0A258AXL1      ------------NESFRII--RSS--L-PFY--AL-PDNPKQVIMVTSARPNDGKTTVAA
A0A2V5UAD5      ------------AESYRNL--RSA--L-LYQ--GT-DGQRPRVLLVTSAVPNEGKSTVAA
A0A7Y4QK88      ------------AEAYRSL--RSA--L-LFL--TP-ENERPKVILITSATPNEGKSTIAA
A0A1V6GCZ3      ------------AEAYRVL--RTN--L-LFS--RK--DDKLNTIAIVSAGAGEGKSTTVF
A0A7V3WMH6      ------------AEAYRVL--RTN--I-LFA--QK--DPKLNTLTAISGGAGEGKSTTLF
A0A2S7U0Z3      ------------AESIRNL--RAS--V-ILL--GK--HDNNKVLLVTSAIPGEGKTTVAA
A0A2E6T1E0      ------------AESFRTV--RAA--I-ALS--QR--AGDLHLMAVTSTVPSEGKSLVAS
A0A5E6MKA7      ------------SNSFRQI--RTL--L-HYS--IP--DGRPQVMMFTSSQMGEGKSSTCV
A0A7W1HKQ4      ------------AEAYRIL--RTN--I-EFN--RK--SPDANTISLVSGGPGEGKSTTLA
A0A6B3L936      ------------AESIRNL--RAS--I-TLL--GR--KENNKVLVVTSAMPGEGKTTTAA
A0A2N8IR72      ------------AECFHIL--RNN--V-DSM--LPRPEQGGHVILVTSTLPGEGKTFTSA
A0A2N8IV96      ------------AEAYRIL--RTN--I-EFN--KK--GLEEISLTFVSGSAGEGKTTTLC
R7E1V8          ------------AEAYRIL--RTN--I-EFN--KK--GLEEISLTFVSGSAGEGKTTTLC
A0A2E0R252      ------------AEAIRTL--RAG--L-TFL--GT--SEERRTFLITSAVPGEGKSWVAS
A0A3E1EF48      ------------SEAIRTL--RTG--L-TLL--GD--SEERRIFVVTSSLPGEGKSWISA
A0A2A2PVG8      ------------AESIRTL--RTG--L-TFL--GT--AEERCTFLIASSVPGEGKSWVAS
A0A2E0R421      ------------AEAIRTL--RAG--L-TFL--GT--PESKRTFLITSSVPNEGKSWVAS
A0A2E5EJ69      ------------AEAFRTL--RAS--I-SLL--GR--EEERRVILFTSAVPSEGKTFCSV
A0A2G4I5Z5      ------------AEAFRSM--RAS--L-GLL--GR--DEDRKVVFFTSAVPSEGKSFCCV
A0A4P5QQV6      ------------VESMRSL--RSS--I-FFL--PV-EGPPPRTFLVTSAVPNEGKSTVAL
A0A2E7ALI1      VVFRDGLYSSLYAESYRIL--RAA--V-MLL--GD--EKERKITAFSSALPGEGKTTTSI
A0A178IDB9      ------------AEAYRGI--FSE--I-EIR--SP--VPFPKRILITSSVPGEGKSLTAS
A0A290QD69      ------------SEAYRGV--FSE--V-EIR--SI--VPYPKRILFTSSIPSEGKSLTAS
A0A6N6ZC77      ------------AEACRTL--RSS--L-FFM--GA-DADRPEVILVTSSVPEEGKSTVAM
A0A832M896      ------------SEAFRNI--RSS--L-LYM--AI-EGERPRVLAITSAIPGEGKSTIAL
A0A538NJ59      ------------AESYRNL--RSA--L-LYQ--GT-DGQRPRVLLVTSAVPNEGKSTVAA
A0A2A2R3V9      ------------AESFRNV--RSS--L-LFM--AI-DGTRPKTLLITSAIPNEGKSTFAS
A0A3C1VFY9      ------------VESYRNL--RSS--L-LYM--AE-TGTRPHTLLITSAVPNDGKSVTAA
A0A2V2SMX4      ------------VEAYRNL--RSS--L-LYM---G-NGSRPRTLLITSSAPGEGKSLTAE
A0A522AC27      ------------VEAYRNL--RSS--L-LYM--NE-GGNKRRTLLVTSSVPNDGKSMTAA
A0A6M1RFD0      ------------AEAYRNV--RSS--L-LFMPAGN-GSEKPRLLLVTSSIPNDGKSMTTA
A0A7C3HXH0      ------------AEAYRNV--RSS--L-LFMQPTN-GDARPSLLLVTSSIPNDGKSLTTA
A0A432FDF6      ------------AEAYRVL--RTN--I-LFA--GR-QSEKQTTFSVVSGGAGEGKTTTMF
A0A2E7VDS1      ------------MESFRSM--FSR--I-QMN--ST--ADGPKSILITSAIPSEGKSLLAA
A0A7C8D3W3      ------------SESLRGV--RSA--I-MFD--PE--SKKNQMIAVTSAIPGDGKTTFTV
A0A178IFJ2      ------------GEVVRGL--YAQ--L-KLS--SR--LDAPKTLLVTSTIPGEGKSFVAS
A0A357FSP9      ------------TEAFRSI--HSA--L-KIS--EE--SKNAKVIVTTSTVPGEGKSFISS
A0A1T4WWY4      ------------LENFRLI--RSS--I-LLN--GS-PKGDGRVIMLTSARPSEGKTTVSS
A0A3D3LEQ6      ------------LENFRLI--RSS--I-LLN--RS-PMGEARVIMLTSARPGEGKTTVSA
A0A3D3NW23      ------------LENFRLI--RSS--I-LLN--RS-PMGEARVIMLTSARPGEGKTTVSA
A0A522ACN3      ------------AEAYRVL--RTN--L-LFS--RK--DDKLNSIAIVSAGAGEGKSTTVM
A0A2A2R174      ------------AEAFRSM--RAS--L-GLL--GR--EEDRKVVFFTSAVPSEGKSFCCV
A0A1H2DTI1      ------------SESFRNL--RSA--L-MFM--EV-DGARPRTILFTSASPDEGKTTVAT
A0A1H1MGC9      ------------VESFLTL--HSS--L-RLK--DE--SKRAQAILVTSTIPGEGKSFTTT
A0A1V5L462      ------------AESFRAL--RSS--I-LLH--RQDSKEPRQVFLVTSCAPAEGKSTVSS
A0A3D3LGD3      ------------AEAYRIL--RTN--I-EFN--RK--NRDANCITVTSGGAGEGKSTTLC
A0A350ARX4      ------------AEACRTL--RSTILL-KQS--DA-VHTSSQSILITSATPSEGKSTISA
B5JIS2          ------------VESFMAV--VAQ--L-ELT--SK--QEGPKSFVVTSTTTSEGKSTIAA
A0A7Y1UGD7      ------------AEMFRVL--RTS--I-SLL--GP--PEQRKITMVTSALPSEGKTFVAA
A0A2E5K4P7      ------------KEAFRSI--FST--L-GVN--DA--SKDAQVILNTSTIPGEGKSFVST
A0A842HH73      ------------TESFRAI--HSA--L-KIN--EA--SRNAKVIVSTSTSPSEGKSFVTT
A0A2E6NAH3      ------------TETFRSI--HSA--L-KLS--DH--SKNAKVILTTSTVPGEGKSFVSS
A0A2A5VZA5      ------------TETFRSI--HSS--L-KLN--DE--SKNAKIILATSTVPSEGKSFVSS
A0A424R295      ------------TETFRSI--HSS--L-KLN--DE--SKNAKVILATSTVPSEGKSFVSS
A0A1H2GQN6      ------------AESYRIL--RAR--I-DLQ--AH--SGPGNTLTMISGGPGEGKSTTLF
A0A858RDL7      ------------AEMFRVL--RAS--V-SLL--GD--ETKRKVTLFTSALPGEGKSSIST
A0A512M3Y3      ------------GETFRII--RSS--I-PLY--VP-GENKCQVIMVTSSRPSEGKTMVSS
A0A4P5R5J1      ------------LESFRTL--RSS--I-IFL--PI-EGARPKTILVTSATPGEGKTTIAA
A0A4P5YK43      ------------AESIRGV--RSA--V-MFG--TQ--SKKKQVMVITSALPGDGKTTFSV
A0A2A2RPW6      ------------AEAFRTL--RAA--L-SLL--GR--DEDRKVVLFTSAVPSEGKSFTGA
B1ZT68          ------------TESYRGI--YSA--I-DIH--ST--EPFPKAIISTSSMPGDGKSLTAS
W0J7C2          ------------SEAYRGI--FSE--I-EVR--SP--LAFPKALLVTSSVPAEGKSLLCC
B4D1I7          ------------AEAFRSL--RSS--I-AFL--PV-AGAPPKVILITSAVPNEGKSTVAV
A0A353F286      ------------AEAYRIL--RTN--I-EFN--RK--NPDNNSITVVSGGAGEGKSTTLV
A0A354FSA6      ------------AEAYRIL--RTN--I-EFN--RK--NPDNNSITVVSGGAGEGKSTTLV
A0A3B9GA54      ------------AEAYRIL--RTN--I-EFN--RK--NPENNSITVVSGGAGEGKSTTLV
A0A520LEH8      ------------AEAYRIL--RTN--I-EFN--RK--NPENNSITVVSGGAGEGKSTTLV
A0A6B2M0T8      ------------SELFRQI--HSQ--I-LLK--NK-KLQPGHTFVVTSALPKEGKSFFSI
A0A2D7B7R6      ------------SEAFRSL--RVN--I-ESM--TR--KKSHKVVLFTSSIPSEGKTFTSI
A0A353DCA1      ------------AEAYRIL--RTN--I-EFN--RK--NPEDNSITVVSGGAGEGKSTTLV
A0A7C5H7K5      ------------IEAYRTV--RSA--I-IYQ--TR--NRPIKTILVTSSLPGEGKSVTAA
A0A7V3QF58      ------------IEAYRTV--RSA--I-IYQ--TR--NRPIKTILVTSSLPGEGKSVTAT
A0A832FWF3      ------------IEAYRTV--RSA--I-IYQ--TR--NRPIKTILVTSSLPGEGKSVTAT
A0A838YJR8      ------------AEAYRIL--RTN--I-EFN--RK--NADANSITLVSGGAGEGKSTTLV
A0A6N4WVA3      ------------AEACRNL--RTS--V-FFM--GD-EHVKPSVFAVTSAVPSEGKSTVAA
A0A0R2XPB1      ------------AEACRNL--RTS--V-FFM--GD-EHVKPSVFAVTSAIPSEGKSTVSA
A0A348NQP1      ------------AEACRNL--RTS--V-FFM--GD-EHEKPSVFAVTSAIPSEGKSTVSA
A0A357FV58      ------------AEACRNL--RTS--V-FFM--GD-EHEKPSVFAVTSAIPSEGKSTVSA
A0A2G4GZN8      ------------TEAVRSI--YSA--L-KVN--PA--VSKTRVFLVTSTRPSEGKTFVAT
A0A348NPT1      ------------TEAFRSI--HSA--L-KIS--EE--SKNAKVIVTTSTVPGEGKSFISS
A0A2E1KV60      ------------IENFRSM--LSY--L-KIS--EH--SKNSNVFLITSTTPSEGKSFISS
A0A2D7F4D9      ------------TENFRSM--LSY--L-KIN--DQ--TKNSNVFLLTSTVPSEGKSFISS
A0A3R7RBR8      ------------TENFRSM--LSY--L-KIN--DQ--TKNSNVFLLTSTVPSEGKSFISS
A0A2E0NH28      ------------TETFRSI--HSA--I-RLN--EE--SKNAKVFLTTSTVPSEGKSFVSS
A0A368BGT4      ------------TETFRSI--HSA--L-KLN--DQ--SKNAKIILATSTVPGEGKSFVSS
A0A317ZP96      ------------TETFRTI--HSA--L-KLN--DE--SKNAKVIITTSTVPGEGKSFISS
A0A350AS32      ------------TETFRSI--HSA--L-KLN--DE--SKNAKVIVTTSTVPGEGKSFVSS
A0A7W8DI01      ------------HESFRII--RSS--L-PFY--AP-GDNRKQVIMVTSARPSDGKSTVAM
A0A6N6PLV8      ------------AEAYRIL--RAA--V-EFN--KP--HRDANTYTLISGGPGEGKSTTMN
A0A290QE54      ------------VESFLSV--YSS--A-KIH--SK--LDYPKSILVTSTIPGEGKTLVSS
A0A1H1SWX2      ------------SEAFLSV--YSA--V-KIQ--SK--LDFPKSILVTSTIPGEGKTMISC
A0A1D8AZK8      ------------SEAFLSV--YSA--V-KIQ--SK--LDFPKSVLVTSTIPGEGKTMISC
A0A4Q1C9I5      ------------SEAFLSV--YSA--V-KIQ--SK--LDFPKSILVTSTIPGEGKTMISC
A0A842HCC8      ------------AESCRNI--RSS--L-LFM--DR-QGPRPQTILVTSSIPAEGKSTLSS
A0A1G3ZL71      ------------VESFLSV--YSA--V-KIQ--SK--IDYPKVILVTSTIPGEGKTLVSC
A0A556QP09      ------------VEPFLGV--YSS--V-KIH--SK--LDFPKSILVTSTIPGEGKTLISS
A0A2T6DX88      ------------TESFLSI--YSS--V-KIH--SK--LDFPKAILVTSTIPGEGKTLVSC
A0A2T6CWI7      ------------AESFLSV--YSS--I-KIH--SK--LDFPKSVLVTSTIPGEGKTLISC
A0A3E1E5C8      ------------AEAFLSV--YSS--V-KIH--SK--LDFPKSILITSTIPGEGKTLIAC
B1ZZ74          ------------VEAFLSV--YSS--V-KIH--SK--LDFPKTVLVTSTIPGEGKTLISC
A0A2E0V4K6      ------------AESYRIL--RAS--V-VLL--GD--EKERKVSLFFSALPGEGKTTTSI
A0A7W1VQ11      ------------QENFRVI--RAN--L-GMN--SE-TGALPQVIIVTSAMPQEGKTVVSS
A0A2V6F9Q9      ------------AESYRNI--RSS--I-LFM--SY-EGPRPKTILVTSAIPNEGKSTVSA
A0A2V6NZZ3      ------------AESYRNI--RSS--L-LFM--PY-EGPRPKTILVTSAVPNEGKSTVSA
A0A2V6EBU2      ------------AESYRNI--RSS--L-LFM--PY-EGPRPKTILVTSAVPNEGKSTVSA
A0A2V6EY06      ------------AESYRNI--RSS--L-LFM--PY-EGPRPKTILVTSAVPNEGKSTVSA
A0A2V6ME53      ------------AESYRNI--RSS--L-LFM--PY-EGPRPKTILVTSAVPNEGKSTVSA
A0A538NUU0      ------------AESYRNI--RSS--L-LFM--PY-EGPRPKTILVTSAVPNEGKSTVSA
A0A2V6NIJ1      ------------AESYRNI--RSS--I-LFM--PY-EGPRPKTILVTSAVPNEGKSTVSA
A0A2V6C292      ------------AESYRNI--RSS--I-LFM--PY-AGPRPKTILVTSAVPNEGKSTVSA
A0A2V6D2X0      ------------AESYRNI--RSS--I-LFM--PY-AGPRPKTILVTSAVPNEGKSTVSA
A0A2V5ZUK1      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKSFLITSAVPSEGKSTVSS
A0A7W1MVB5      ------------AESYRNV--RSS--I-FFM--PY-EGPRPKTLLITSAVPNEGKSTISA
A0A7W1U7H7      ------------AESYRNV--RSS--I-FFM--PY-EGPRPKTLLITSAVPNEGKSTISA
A0A2V5XFN9      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKSFLVTSAVPGEGKSTVSA
A0A2V6EZC8      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKSFLVTSAVPGEGKSTVSA
A0A2V6I7Z5      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKSFLVTSAVPGEGKSTVSA
A0A3B9LCP2      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKTLLVTSAVPNEGKSTIAA
A0A3C0R669      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKTLLVTSAVPNEGKSTIAA
A0A2V6EID2      ------------AESYRNV--RSS--I-FFM--PY-EGPRPKTLLVTSAVPNEGKSTIAA
A0A2V6MHB0      ------------AESYRNV--RSS--I-FFM--PY-EGPRPKTLLVTSAVPNEGKSTIAA
A0A7V9V4N8      ------------AESYRNI--RSS--I-FFM--PY-DGPRPKTFLVTSAVPNEGKSTISA
A0A838I5D7      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKTLLITSAVPNEGKSTISA
A0A2W5YWL9      ------------AESYRNV--RSS--I-FFM--PY-DGPRPKTLLITSAVPSEGKSTISA
A0A2V5NH62      ------------AESYRNV--RSS--I-FFM--PY-EGPRPKTMLVTSSVPNEGKSTISS
A0A2W6A620      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKTLLITSSVPNEGKSTISS
A0A2V5PIJ4      ------------SESFRNV--RSS--I-FFM--PY-EGPRPKTFLVTSAIPNEGKSTVSA
A0A2V6K2G8      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKSFLVTSAVPSEGKSTVSA
A0A2V5W206      ------------AESYRNI--RSS--I-FFM--PY-DGPRPKSFLVTSAVPSEGKSTLSA
A0A2V6MW77      ------------AESYRNI--RSS--I-FFM--PY-DGPRPKSFLVTSAVPSEGKSTISA
A0A838MZM0      ------------AESYRNI--RSS--I-FFM--PY-DGPRPKTILITSAVPNEGKSTVSA
A0A838DHH0      ------------AESYRNI--RSS--I-FFM--PY-DGPRPKTLLITSAVPNEGKSTISA
A0A838FJZ1      ------------AESYRNI--RSS--I-FFM--PY-EGPRPKTLLVTSAVPNEGKSTISA
A0A0E3YV65      ------------AETIRNL--YGQ--L-KAG--SR--LDLPKILLVTSTLPGEGKSFVAS
W0J900          ------------GEIIQTL--YSQ--L-RLN--SR--LDAPKTLIVTSTVPGEGKSFVAS
B4CZV9          ------------VENFRVI--RTN--I-LSM--GE-LSKPPHVVMVTSAMPKEGKTVVSS
A0A7X1AX64      ------------TESFRTI--HSS--I-SLS--DE--GKLAQVIAVTSTLPAEGKSFIAT
A0A3B9FM17      ------------TEAFRSM--YSR--I-QMN--SQ--TDYPKLILVTSAIPSEGKSLISA
A0A7W7YGS1      ------------LENFRLI--RSS--I-LLN--KS-PKGDGRVIMITSARPSEGKTTVSS
A0A2D7WMI4      ------------GESFRSM--FSK--I-QMY--SK--TDYPKIILVTSAIPSEGKSLISA
A0A2D6VHX5      ------------TESFRSM--YGK--I-QMN--SH--VTGSKSILVTSAIPSEGKSLISA
A0A2D8I214      ------------TESFRSM--FSR--I-QMN--SQ--TEYPKTILITSAIPSEGKSLISA
A0A1Z8VL41      ------------TESFRSM--YSR--I-QMN--SN--ADYPKIILVTSAIPSEGKSLISA
A0A2E6TNA4      ------------TESFRSM--YSR--I-QMN--SN--ADHPKIILVTSAIPSEGKSLISA
A0A1Z8RG47      ------------TESFRSM--YSR--I-QMN--SN--ADYPKVLLVTSAIPSEGKSLISA
A0A1Z8RJJ5      ------------TESFRSM--YSR--I-QMN--SN--ADYPKVLLVTSAIPSEGKSLISA
A0A2D7V631      ------------TESFRSM--YSR--I-QMN--SN--SDYPKVLLVTSAIPSEGKSLISA
A0A354RA24      ------------TESFRSM--YSR--I-QMN--SN--SDYPKVLLVTSAIPSEGKSLISA
A0A2E9RV62      ------------TEAFRSM--YSR--I-QMN--SK--TDYPKTILITSAIPSEGKSLLAA
A0A2E4AY96      ------------AESFRSM--FSK--I-QVN--SL--VDFPKVILVTSAIPSEGKSLIST
A0A3B9B9P4      ------------AESFRSM--FSK--I-QVN--SL--VDFPKVILVTSAIPSEGKSLIST
A0A2D5Y6N6      ------------TESFRSM--FSR--I-QMN--SL--NDYPKTILVTSAIPSEGKSLISA
A0A2E7HSS8      ------------TESFRSM--YSR--I-QMN--SL--SDYPKLILVTSAIPSEGKSLISA
A0A2D8VCK3      ------------TEAFRSM--YSR--I-QMN--SQ--TDYPKLILVTSAIPSEGKSLISA
A0A350QVY4      ------------TEAFRSM--YSR--I-QMN--SQ--TDYPKLILVTSAIPSEGKSLISA
A0A2E4ZYR7      ------------MESFRSM--FSR--I-QMN--SH--VEYPKSMLITSAIPSEGKSLLAA
A0A2E6TCV1      ------------MESFRSM--FSR--M-QMN--SH--IDYPKSMLITSAIPSEGKSLLAA
R7E4L8          ------------EECFHIL--RNNAEL-MLL--PN-PEEAPRILFLTSTRAGEGKTFTAL
A0A4P6PCA7      ------------VEVFVGI--NGY--I-LSE--KY--KEQSRVLMISSAGPGEGKTISSC
A0A2T6DSN5      ------------SEAYRGV--FSE--I-EIR--SV-VPF-PKRLLVTSSVPSEGKSLTAS
A0A317ZIW7      ------------AEACRNL--RTS--V-FFM--GD-ESWKPSVFAVTSAVPSEGKSTVSA
A0A7C4PPT4      ------------VENFRVI--RTN--L-LSM--GA-VTHDPQAIVIASAMPEEGKTVVSY
A0A7C4QZX4      ------------TENFRVI--RTN--L-LSM--GA-VTRNPQALVVASAMPEEGKTMVSF
A0A3C1AXQ2      ------------AEAYRIL--RTN--I-EFN--RR-NPD-ANCITVTSGGAGEGKSTTLC
A0A3D4HHL8      ------------AEACRNL--RSS--V-LFG--GD-ENEAHQVVAVTSSVPGEGKSTMAA
A0A366HV03      ------------LECYRVL--RAH--L-GLQ--LG-NREGAKVVMFTSARPSEGKTVTAA
A0A6G6K911      ------------LECYRVL--RAH--L-GLQ--LG-NREGAKVVMFTSARPSEGKTVTAA
A0A832HT83      ------------VENFRVI--RTN--L-LSM--GA-TVRDPQAIVVASAMPEEGKTVVSY
A0A5R8KAF2      ------------LESFRLI--RSH--I-LLH--PN-SKGKSQVIMVTSARPSEGKTSQAA
A0A7C4LRZ6      ------------AESVRVV--RSA--V-MLG--VE-GGK-KQVQVITSAVPGDGKTTFSV
A0A351MR11      ------------IESLRAI--HSV--M-KIN--PS-AAN-AKVLLTTSTRPGEGKTFVTT
A0A388PR45      ------------TEAVRAI--YSA--M-KIN--PA-SAA-GRVFLVTSTRPGEGKTFVAT
A0A388QR61      ------------TESVRAI--YSA--M-KIN--PA-TAA-GRVFLVTSTRPGEGKTFVAT
A0A4P5YHI0      ------------TESVRAI--YSA--M-KIN--PA-TAA-GRVFLVTSTRPGEGKTFVAT
A0A2A2RS01      ------------TEAVRAI--YSA--M-KVS--PA-TAN-SRVFLVTSTRPGEGKTFVVT
A0A2A2Y1A7      ------------TEAVRAI--YSA--M-KVS--PA-TAN-SRVFLVTSTRPGEGKTFVVT
A0A388PDH9      ------------TEAVRSI--YSA--M-KVS--PA-TAN-SRVFLVTSTRPGEGKTFVAT
A0A2G4H1E7      ------------TEAIRSI--YSA--L-KVN--PA-VSK-ARVFLLTSTRPSEGKTFVAT
A0A2G4GZA6      ------------TEAVRSI--YSA--L-KVN--PA-VSK-ARVFLVTSTRPSEGKTFVAT
A0A388P514      ------------TEAVRSI--YSA--L-KVN--PA-VSK-ARVFLVTSTRPSEGKTFVAT
A0A2A2YG59      ------------TEAVRSI--YSA--L-KVN--PA-VSK-ARVFLVTSTRPSEGKTFVAT
A0A2G4F7D5      ------------TEAVRSI--YSA--L-KVN--PA-VSK-ARVFLVTSTRPSEGKTFIAT
A0A7V4IDX4      ------------AESYRNL--RSS--L-LYM--GE-GNKLPKLLVVTSSIPGEGKSVTAA
A0A2V2SDN0      ------------LESFRNI--RSC--L-WFM--HQ-NGNKPKSLLIGSSVPQEGKSTVAL
A0A4Q3BVY2      -----------LLECFRVI--RAN--I-IMH--PN-RRNRSQVVLVTSARPQEGKTTQAT
A0A8A7W4D3      -----------LLECFRVI--RAN--I-ILH--PN-SQNRSQVVLVTSARPQEGKTTQAT
A0A3R8L982      DPHTNDGQGEHATEAFLSI--FSA--V-KIH--SR--LDFPKSILVTSTIPGEGKTLISC
A0A6N6QBS9      ------------AESLRGI--RSA--L-LLS--PE-GTS-KRLLAVTSAVPGDGKTTFTA
A0A2V5X6Z6      ------------LEAFRSI--RSS--L-LFM--SN-GGTKPKTIVVASSVPEEGKSTVAL
A0A2V5VGZ7      ------------LEAFRSI--RSS--L-LFM--SN-GGTKPKTIIVASSVPEEGKSTVAL
A0A2V5U130      ------------LEAFRSI--RSS--L-LFM--SN-GGTKPKTIIVASSVPEEGKSTVAL
A0A2V6C237      ------------LEAFRSI--RSS--L-LFM--SN-GGTKPKTIIVASSVPEEGKSTVAL
A0A2E7HPU9      ------------TEAYRIL--RAS--V-TLL--GK-EDE-RKVSLFTSSIPGEGKTTTSS
D5EML0          ------------LESFRSI--YSS--I-RMR--ADLSAKRKASFVITSSVPNEGKSMVAC
A0A1V6GL40      ------------VEAYRNL--RSS--L-LYM--TE-AGNRPKTILVTSSVPNDGKSITAA
A0A7X7VL75      ------------VEAYRNL--RSS--L-LYM--TE-AGNRPKTILVTSSVPNDGKSITAA
A0A7C4PPJ4      ------------AESIRVV--RSA--I-MLG--VD-SPQ-KQVQLITSAVPGDGKTTFSV
A0A3C1C1M3      ------------AEAFAGL--RSV--L-DSP--LY-RDH-SQIVLVASSLPEEGKTTTSC
A0A2S7U4L6      ------------AEAYRIL--RTN--I-EFN--RP-SQD-DNAITVVSGGAGEGKSTTLV
A0A2E9EYJ1      ------------AEAYRIL--RTN--X-EFN--RK-NAD-AXAITLVSGGAGEGKSTTLV
A0A258AXR6      ------------AEAYRIL--RTN--I-EFN--RK-TPD-ANCLSVVSGGAGEGKSTTMV
A0A7W7YD86      ------------AEAYRIL--RTN--I-EFN--RR-NPD-ANCISVVSGGAGEGKSTTMV
A0A3D3NZQ6      ------------AEAYRIL--RTN--I-EFN--RK-NRD-ANCITVTSGGAGEGKSTTLC
A0A1T4WVZ9      ------------AEAYRIL--RTN--I-EFN--RK-NPD-ANCITVTSGGAGEGKSTTLC
A0A4R7SSI6      ------------AEAYRIL--RTN--I-EFN--RR-NPD-ANCITVTSGGAGEGKSTTLC
A0A7W8DNH5      ------------AEAYRIL--RTN--I-EFN--RR-NPD-ANCITVTSGGAGEGKSTTLC
A0A4Q3AQI1      ------------IENFRVI--RTN----LLS--MGALTKAPHVIMVTSALPREGKTVVSS
A0A6N2CMN7      ------------TETFRSI--HSA-----LR--LNDESKNARIILTTSTVPSEGKSFISS
A0A432FAS4      ------------AESFRTI--RAA-----IS--LSQRAGDLQVMAVTSTIPAEGKSLVAS
A0A660Q3A0      ------------AEAYRNV--RSA-----LI--FSGAEEYTKALVVTSAVPLEGKTTTCL
A0A849Y855      ------------SESFRNV--RSS-----LM--FSPIGGQARTIAITSAIPNDGKTTCSV
A0A2D5W0Q9      ------------AEGFRTV--RAA-----VS--LVHKSDKFKVLSMTSTIPSEGKSLVAS
A0A857ZXX2      ------------SEYFQILCHNAD-----SM--LPVTRNQGHVILLTSTMQGEGKTFISA
A0A7V6ECG3      ------------AESIRGV--RSS-----LL--FGCNREKKNILLVTSAIPGDGKTTFAV
A0A1Z9KB52      ------------TESFRSM--YGK-----IQ--MNSHATGSKSILVTSAIPSEGKSLISA
A0A7C5CZ90      ------------AEAYRIV--RTN-----LL--FSRKDERFNTICVVSAGAGEGKSTTVI
A0A257LYL4      ---------------------RTN-----IE--FNRKNPEDNAITVVSGGAGEGKSTTLV
A0A4Q2XXY1      ------------AEAYRIL--RTN-----IE--FNRKSADANAITVVSGGAGEGKSTTLV
A0A4P6PD26      ---------------MVSC--ASN----KPC--FLRGGSHRGAFAVLSSGAGEGKSTTCF
A0A1Z8SVB5      ------------IQMNSNV--RGS-----------------RSILVTSAIPSEGKSLISA
A0A2V5W3Y0      ------------AESYRNV--RSS----IFF--MPYEGPRPKTMLVTSSVPNEGKSTISS
                                                                    :**:    

A0A2V5U7A0      NLGIALAQD-GYRILIIDADLRRGSCHSRIGLRNH---R-GLSNVLGGE-MPIE--QLIQ
A0A3D4CZT6      NLAYVCAQG-GYTTLMIDADLRRPNVHTFFDINNS---V-GLSNYLTTD-LMLE--DVIL
A0A4V1S9Q4      NLAYICAQG-GYTTLMIDADLRRPRLHTFFDINNS---V-GLTNYLTTE-LMLE--DVIL
A0A355VK99      NLAAAFAYA-GKKVLLIDGDLRKSSLTRRLGGSGR---K-GLTSILLRQ-NPDT--AGVI
A0A2V6N5E0      NLAITMALS-GARTLLIDCDLRRGALRETFGISSK---I-GFSEVLKQE-VNWR--EVVV
A0A2V6NH44      NLAIALALS-GARILLIDGDLRRGALREQFGSDSR---L-GFSEVLQQE-VPWQ--EVVM
A0A3D0IZR7      NLGWVCAQS-GMKVLLIDGDIRRPNMHNALQIENT---L-GLGEYLAGQ-ASLD--ELIQ
A0A520LRZ3      NLAYVCAQG-GYNTLMIDGDLRRPQLHTFFNINNS---V-GLTNYLTTD-LALE--DVIL
A0A356FSV4      NLALTFANN-GDKTLLLDGDLRLPNIARSLQVSND---N-GLIDYIDHD-VDIN--AVIV
A0A3D3DET9      NLAITMANA-GSRVLLVDADLRKGTLHRLFGVSPE---P-GLSDVLAKG-TAWE--TTVS
A0A355SVK9      NLALTFANH-GERTLLLDADLRLPNVAKSLQLEND---Y-GLLNHVDKG-VSLD--ELII
A0A2E5D7I3      NYALALASQ-GKKTLLMDMDLRKPKVHRQFNLRRGDLET-GMSEVLSNQ-CDAS--EAV-
A0A2V5NYE2      NLAITMANS-GSRVLLVDADLRKGVLHTLFGLPSG---P-GLSEALSQG-LNWS--EAVQ
A0A353DI77      NLALAYAKQ-GTRTLLVDFDLRKPAVHKIFNEERA--ARPGIVNVLNGTAAANQ--AITV
A0A2V6FIP7      NLAIVTAQT-GLKTLLVDADLRRPSVHKVFRLQS---PV-GLSSYLMEKVSRVD--EFIH
A0A3C1UJT2      NYASSLAQQ-GHRTLLVDMDLRKPAVGPEFKLGE---EYVGVSDLLQSE-------DKLG
A0A258AXL1      HLAKSFSDS-GERVLLIDADLRRGTLHKAFNLGN---KNLGLMEILADR-VKWN--DAVR
A0A2V5UAD5      NLARILALG-GSRVLLVDGDLRKGALHELMGMNH---EP-GLSEMLRCP-EDLE--KIIQ
A0A7Y4QK88      NLARMLALG-GSRVLLVDADLRKGHLHNLLELEC---EP-GLIELLHKQ-SEPQ--AVIQ
A0A1V6GCZ3      NLAAVFAQS-GQRTIIVDSDLRRPTLHKMLRVTN---AI-GLTNYLLRQ-NTLE--EVIQ
A0A7V3WMH6      NLAAVFAQN-GQRVLLVDSDLRRPSLHKMFKVSN---AI-GLTNYLLKQ-NTLE--EVIQ
A0A2S7U0Z3      ELAAAFAMN-KERTLLVDLDLRRPALSGTFPDLD---GGPGIVEVLAGQ-ASIQ--DVFS
A0A2E6T1E0      NHAIVMAQT-GVKTLLVDFDLRRPSVHKAFQLQS---PR-GLSSYLLGKVDSID--AIVH
A0A5E6MKA7      NTATVLGQQ-GT-VLLIDADLRRPSLHKTLGLRP---HP-GLSELLTNQ-APLE--QAVQ
A0A7W1HKQ4      NLAFICAQG-GYSTLVVDADLRRPVQHTLFDLEA---KN-GLTNYLTTE-IPLD--DVIY
A0A6B3L936      ELAELFALE-GERTVLIDFDLRKPRVHELYPKLK---GQPGTVDVLIGH-AQFD--DVVA
A0A2N8IR72      NLAAAFAYA-GKKVLLIDGDFRKSSLTRRLGGSG---RK-GLTSILLQQTTDTT--GIIR
A0A2N8IV96      NLAYICAQG-GYATLMIDADLRRSKLHRYYELDN---EV-GLTSYLLED-YPLE--EVIF
R7E1V8          NLAYICAQG-GYATLMIDADLRRSKLHRYYELDN---EV-GLTSYLLED-YPLE--EVIF
A0A2E0R252      NLALSFASQ-GDRTLLIDGDLRKPVQSQVFDYDK---EHPGLSDHLSLN-RPLK--EVVM
A0A3E1EF48      NLACGFAQQ-GERTVLIDADLRKGVLHSTFNLSR---EAPGVTNLLSRT-SSLA--EVIH
A0A2A2PVG8      NLAHSFALQ-GDRTLLIDADMRRPVQGEVFGYGR---EPKGLADVLSLG-TPLK--EVIL
A0A2E0R421      NLALAFAKQ-NERTLLIDGDLRRPRIHKIFGFDR---DEAGLSDHLSLR-TPLN--KVVK
A0A2E5EJ69      NYAIANASQ-GKKTLIMDFDLRRPSVGDTFHIDR---KTPGVTDLLLAN-KTLD--EVAL
A0A2G4I5Z5      NYAVCYAQQ-GRRTLIIDFDLRKPTLAESFGVEG---EHFGVSDVLLGK-VPLD--QCVQ
A0A4P5QQV6      NFAITMAMF-DVRVLLVDGDLRRGELHHALDLPN---GA-GFGDVLNGD-CALQ--SAVQ
A0A2E7ALI1      NYALATASQ-GKKTLLLDMDLRKPKVHRQFNLRRSELEK-GMSEVLSNQ-CTPE--EALT
A0A178IDB9      NMAAVFAAH-GRRTLLVDCDFRRPSLRRYFGTAP---GT-GLLSWLRAHPDDGA--DTPL
A0A290QD69      NMAAVFAAH-GKKTLLVDCDFRRPTLRRYFGTQS---GV-GLLPWLRENGSNAA---AQV
A0A6N6ZC77      NLAAAIALT-SSKVLLVDADLRRGQIAPTLHAAR---AP-GLAEVLQQQ-VALD--AAIQ
A0A832M896      NLAITMAFA-GSRVLIVDADMRKGVLHEDLAASH---TP-GLSELLSRQ-HAWR--DLLQ
A0A538NJ59      NLARILALG-GSRVLLVDGDLRKGALHELMGMNR---EP-GLSEMLRCP-EDLE--KIIQ
A0A2A2R3V9      NLAITMAFA-GSRVLLVDADLRRGRIHDAFSVSN---QR-GLSDVLSNQ-MNWR--DAIQ
A0A3C1VFY9      NLAITLATG-GSRVLLVDGDLRKGSLHSRFKIQA---DT-GLSESLAQG-MDWH--KAVK
A0A2V2SMX4      NLGAILANT-GSRVLLVDGDLRKGVLHSRFGLDA---MP-GLTEVLADG-KPVR--DVIR
A0A522AC27      NLAITLAIT-GSRTLLVDADLRKGLLHARFGLKP---ET-GLSEVLLAK-KDWR--NCIC
A0A6M1RFD0      NLAITLALG-GARVLLVDADLRKGVLHRRFGVEN---SS-GFSEVLQQK-TDWR--EVVR
A0A7C3HXH0      NLAITLALG-GSRVLLVDADLRKGVIHRRFKLEN---TA-GFSEVLQQK-AKWN--DVVR
A0A432FDF6      NLAVVFAQQ-GDRVLVVDSDLRRPSMHRFFKLSN---KI-GLTNYLLGQ-ATIE--EVIQ
A0A2E7VDS1      NLAYSCANH-GRRTILLDFDLRRPGLHKFCGVSN---DK-GLLTLINEIHGEHG-----T
A0A7C8D3W3      NFAATMASA-GHRVLLVDADMRRGNIHNYFETDR---SP-GLSELLNGE-LHWA--DVIN
A0A178IFJ2      NLATAFAAH-GLRTLIIDGDLRRPVQHRLADAPN---TH-GLLRWLDKG-GKSG--GPLA
A0A357FSP9      NLALTFANH-GEKTLLLDGDLRLPNVARSLQLEN---DF-GMLDHIEKE-VALD--EVIM
A0A1T4WWY4      NVAWAFSSL-GEKTLLIDCDLRRGRVHEVIGASN---AV-GMTDLLTGR-ASLS--ECVQ
A0A3D3LEQ6      NVAWAFSSM-GEKTLLIDCDLRRGRVHNVAGVPN---LP-GLTRLLTGQ-ATLE--ECLV
A0A3D3NW23      NVAWAFSSM-GEKTLLIDCDLRRGRVHNVAGVPN---LP-GLTRLLTGQ-ATLE--ECLV
A0A522ACN3      NLATVFAQA-DSRVVVVDSDLRRPTLHKMLGVSN---SL-GLTNYLLKQ-NKLE--EVIQ
A0A2A2R174      NYAVAYAQQ-GKRTLIIDFDLRKPTLAESFGIKE---DHFGVSDVLLNK-AQLE--QAVQ
A0A1H2DTI1      NFAITLAML-EGRVLLVDADLRRGGLNRLLDIDA---PL-GFTDVLLHG-ADWR--KAVV
A0A1H1MGC9      NLALTFAAH-GEKVVIVDCDLRKPNIHKSFRLEN---LK-GVIDVCAGT-QTVD--QVLC
A0A1V5L462      NLAVTLAYS-GAKTLLIDCDLRRGHLHNKFGIDR---DP-GLAELLEHPEMDVQ--DVIL
A0A3D3LGD3      NLAVVCAQG-GYSVLLIDADLRRPSMHTHFDAGN---TT-GLTNFLTTN-VRME--DVVV
A0A350ARX4      NLAIALSHL-GKRVLLIDADMRRGGVHHLFSLSA---EN-GLSDLLSCE-SDFD--GYVQ
B5JIS2          NVASGFVQI-KRKTIIIDGDLRRPCLHQFNRIKK---SG-GLIRWAEEG-YPMD--DIYG
A0A7Y1UGD7      NLAVALAQQ-GLNTLLVDFDLRKPSVHTMFGRSKDG-QA-GTVDLLTGQADLST--AICV
A0A2E5K4P7      NLAFTYAES-GNRVLLLDCDLRLPNIAKSLQLEL---TT-GLLDYVQGT-ATLE--EVIV
A0A842HH73      NLALTFAIH-GEKTLIVDGDLRMPNVGKSLEIDG---EQKGIIQYFNNE-LSLD--EAIV
A0A2E6NAH3      NLSLTFANH-GEKTLLLDCDLRLPNVARSLQIEN---DL-GMLDYVENG-VSLD--EVIV
A0A2A5VZA5      NMALTFANH-GERTLLLDADLRLPNIASSLQLPN---EF-GLLDHIEQG-SRLD--DMIV
A0A424R295      NMALTFANH-GERTLLLDADLRLPNIASSLQLPN---EF-GLLDHIEQG-SRLD--DMIV
A0A1H2GQN6      NLAHVCAEA-GQSVIILDADLRRPSQHTILDIAS---GP-GLADHLIRG-VPIA--DLIR
A0A858RDL7      NFALAAASQ-GKRTLLIDFDLRKPSLHRLLGSDRNPPGG-GLTDFLANQ-APLH--EVAV
A0A512M3Y3      LLARSFADA-DQKTLLIDADMRRGRVHRVFDMEP---GI-GLSGFLAGEVSQLT--DAVI
A0A4P5R5J1      NLAITFAFS-GARTLLVDADLRLGRIAKAFKIES---EL-GLSDVLRQR-THWR--EVIV
A0A4P5YK43      NFASTLANA-GLKVLLIDSDLRRGTVSNYFNQPR---TP-GFSEVLAGD-RPWQ--QSVR
A0A2A2RPW6      NYAVAHAQQ-GKKTLIIDLDLRKPSLSETFGVSS---NQIGATDVMLGR-EPFE--KGVQ
B1ZT68          NLAAAFAAH-GRRTLLVDCDLRRPVLHRYFGVDL---SN-GWIRALATSAAGGQ-----P
W0J7C2          NLAAVFASH-KRRTLLVDCDLRRPTLHRLFGVKP---DT-GWVDWLETDPA--Q-----R
B4D1I7          NFAITLALA-GSRVLLVDGDLRRGELHRSFGLTN---DA-GFGDVLSGR-KSLD--DAIQ
A0A353F286      NLAYVCAQG-GYTTLMIDADLRRPRLHTFFDINN---SV-GLTNYLTTD-LALE--DVIL
A0A354FSA6      NLAYVCAQG-GYTTLMIDADLRRPRLHTFFDINN---SV-GLTNYLTTD-LALE--DVIL
A0A3B9GA54      NLAYVCAQG-GYTTLMIDADLRRPRLHTFFDINN---SV-GLTNYLTTD-VALE--DVIL
A0A520LEH8      NLAYVCAQG-GYTTLMIDADLRRPRLHTFFDINN---SV-GLTNYLTTD-LALE--DVIL
A0A6B2M0T8      NLAASFGRH-HYKTLLIDCDFRRPSIGERM-------EE-DLVKLLEQREDPEK--PLVL
A0A2D7B7R6      NYASSLAQQ-GHRTLLVDMDLRKPAVGPEFKLGE---EYVGVSDLLQSE-------DKLG
A0A353DCA1      NLAYVCSQG-GYTTLMVDADLRRPRLHSFFDINN---SV-GLTNYLTTD-LALE--DVIL
A0A7C5H7K5      NLAIALAMA-NAKVLLVDADLRKGRLHDWIGVEP---TP-GLSHVLNGP-EQWD--TTIV
A0A7V3QF58      NLAITLAMA-NAKVLLVDADLRKGRLHDWIGVEP---TP-GLSHVLCRP-EQWD--TAIV
A0A832FWF3      NLAITLAMA-NAKVLLVDADLRKGRLHDWIGVEP---TP-GLSHVLCRP-EQWD--TAIV
A0A838YJR8      NLAYVCAQG-GYNTLMIDGDLRRPQLHTFFNINN---SV-GLTNYLTTD-LKLE--DVIL
A0A6N4WVA3      NLAVALSFA-HSKVLLVDADLRRGRLHHLLKLNR---EN-GFSDILDGR-LTLD--TALQ
A0A0R2XPB1      NLAVALSFA-HSKVLLVDADLRRGRLHHLMQLNR---EN-GFSDILEGS-LTLD--SAVQ
A0A348NQP1      NLAVALSFA-HSKVLLVDADLRRGRLHHLMQLNR---EN-GFSDILDGN-LTLD--NAVQ
A0A357FV58      NLAVALSFA-HSKVLLVDADLRRGRLHHLMQLNR---EN-GFSDILDGN-LTLD--NAVQ
A0A2G4GZN8      NLALLFAQH-SERVLVIDADLRLPNVGPSLGFTG---DG-GLSKWFNAE-MTLD--DAIV
A0A348NPT1      NLALTFANH-GEKTLLLDGDLRLPNVARSLQLEN---DF-GMLDHIEKE-VALD--EVIM
A0A2E1KV60      NLALSFSAH-GEKVLLLDADLRLPNVAKSLQLEN---DS-GVIDFINGD-DSIS--NFIV
A0A2D7F4D9      NLALSFASN-GEKVLLLDGDLRLPNVAKSLQLEN---ES-GVLDYIQGE-GTFD--SYIA
A0A3R7RBR8      NLALSFASN-GEKVLLLDGDLRLPNVAKSLQLEN---ES-GVLDYIQGE-GTFD--SYIA
A0A2E0NH28      NLALTFANN-GDKTLLLDGDLRLPNIARSLQVSN---DN-GLIDYIDHD-VDIN--AVIV
A0A368BGT4      NLSLTFANH-GEKTLLIDGDLRLPNVARSLQLKN---DL-GLLDHVEKG-VSLE--DIII
A0A317ZP96      NMALTFANH-GEKTLLLDGDLRLPNVARSLQLEN---EK-GLLDHVEQG-KDLD--DVIV
A0A350AS32      NLALTFANH-GEKTLLLDGDLRLPNVARSLQLEN---DF-GLLDHVDKD-VAID--EVII
A0A7W8DI01      HLAKSFAES-GDKVLLIDCDLRRGTLHRLLDLDR---KQDGLAELLDGQ-AKLA--DAIQ
A0A6N6PLV8      NLAYICAKG-GYNVLVVDADLRRATQHKLFGVSN---EF-GLTDYLVGR-AEID--EIIK
A0A290QE54      NLAASFARH-GKRTLLIDCDLRRPMVHRHFNQPN---DN-GLITWFEHG-ASLD--GDLT
A0A1H1SWX2      NLAGSFARH-GKKVLLIDCDMRRPMLHRHFKLTN---EA-GLIAWFEAG-AKIP--ADPF
A0A1D8AZK8      NLAASFARH-GKRVLIIDCDMRRPMLHRHFKLTN---EV-GLIAWFEAG-AKIP--ADPF
A0A4Q1C9I5      NLAASFARH-GKRVLIIDCDMRRPMLHRHFQLPN---EA-GLLAWFEAG-AKIP--EDPF
A0A842HCC8      NLAITLAFA-SSKTLIIDADLRRGKAHRAFGLNA---NV-GLSELLNDTELKPE--DVIQ
A0A1G3ZL71      NLAGSFARH-GRSTLIIDCDMRRPMLHRHFKMEN---DA-GLLAWAEAG-ASLD--GDLT
A0A556QP09      NLAGSFARH-GKSVLLIDCDLRRPMMHRHFELAN---EA-GLITWYEKG-ASLD--GDLT
A0A2T6DX88      NLAASFARH-GKSTLIVDCDLRRPMLHRRFGKEN---EA-GLLTWFEKG-GKVE--GDLA
A0A2T6CWI7      NVAGCFARH-GKKTLLIDCDLRRPMLHRHFKQEN---KN-GLITWFESG-AMLD--SNLT
A0A3E1E5C8      NLAGSFARH-GKRTLLIDCDLRRPMLHRNFKQEN---LH-GLITWFEGG-AKLD--GDLS
B1ZZ74          NLAGSFARH-GKNTLLIDCDLRRPMLHRHYKQQN---NA-GLITWFEAG-SPLD--GELA
A0A2E0V4K6      NYALATASQ-GRKTLLLDMDLRKPRVHRQLGRRRSEQGK-GMAEILARQCPPEE--AVCQ
A0A7W1VQ11      NLALSFATK-GDRTLLIDADLRRGRLHRVFKAQN---KP-GLSDILAEK-RPIE--DAFR
A0A2V6F9Q9      NLAIALALS-GARVLLIDGDLRRGTLREQFNSNS---RL-GFSEVLRQE-VPWS--EVVM
A0A2V6NZZ3      NLAIALALS-GARTLLIDGDLRRGALREQFGSNS---RV-GFAEVLQQE-VPWQ--EVVM
A0A2V6EBU2      NLAIALALS-GARTLLIDGDLRRGALREQFGSNS---RI-GFAEVLQQE-VPWQ--EVVM
A0A2V6EY06      NLAIALALS-GARTLLIDGDLRRGALREQFGSNS---RI-GFAEVLQQE-VPWQ--EVVM
A0A2V6ME53      NLAIALALS-GARTLLIDGDLRRGALREQFGSNS---RV-GFAEVLQQE-VPWQ--EVVM
A0A538NUU0      NLAIALALS-GARTLLIDGDLRRGALREQFGSNS---RV-GFAEVLQQE-VPWQ--EVVM
A0A2V6NIJ1      NLAIALALS-GARTLLIDGDLRRGALREQFGSNS---RV-GFAEILQQE-VPWQ--EVVM
A0A2V6C292      NLAIALALS-GARTLLIDGDLRRGVLREQFGSNS---RV-GFSEVLQQE-VPWQ--EVVM
A0A2V6D2X0      NLAIALALS-GARTLLIDGDLRRGVLREQFGSNS---RV-GFSEVLQQE-VPWQ--EVVM
A0A2V5ZUK1      NLAITMALS-GAKVLLIDCDLRRGAIREAFGIDS---KI-GFSEVLKGE-VNWR--EVVV
A0A7W1MVB5      NLAITMALS-GAKTLLIDGDLRRGALREAFEIQS---KI-GFSEVLKQE-VNWR--EVVV
A0A7W1U7H7      NLAITMALS-GAKTLLIDGDLRRGALRDAFEIHS---KI-GFAEVLKQE-VNWR--DVVV
A0A2V5XFN9      NLAITMAFS-GARTLLIDCDLRRGALCEAFGITS---KI-GFSEVLKQE-VNWR--EVVV
A0A2V6EZC8      NLAITMAFS-GARTLLIDCDLRRGALCEAFGITS---KI-GFSEVLKQE-VNWR--EVVV
A0A2V6I7Z5      NLAITMAFS-GARTLLIDCDLRRGALCEAFGITS---KI-GFSEVLKQE-VNWR--EVVV
A0A3B9LCP2      NLAITMALS-GAPTLLIDADLRRGALREAFGISS---EI-GFSEVLKQE-VNWQ--EVVV
A0A3C0R669      NLAITMALS-GAPTLLIDADLRRGALREAFGISS---KI-GFSEVLKQE-VNWQ--EVVV
A0A2V6EID2      NLAITMALS-GARTLLIDADLRRGALREAFGISS---KL-GLSEVLKQE-VNWQ--EVVV
A0A2V6MHB0      NLAITMALS-GARTLLIDADLRRGALREAFGISS---KL-GLSEVLKQE-VNWQ--EVVV
A0A7V9V4N8      NLAITFALS-GARTLLIDGDLRRGAQREAFDISS---RI-GFAEVLKQE-VNWQ--DVVV
A0A838I5D7      NLAITFALS-GARTLLIDGDLRRGAQREAFDLSS---KI-GFSEVLKGE-VNWQ--EVIV
A0A2W5YWL9      NLAITMALS-GARTLLIDGDLRRGALREQFGVSS---RI-GFAEALKQE-VNWR--EVVV
A0A2V5NH62      NLAITMALS-GARTLLIDGDLRRGALREAFGISS---KI-GFSEVLKQE-VNWQ--EVVV
A0A2W6A620      NLAITMALS-GARTLLIDGDLRRGALRESFGVSS---KI-GFSEVLKQE-VNWQ--EVVV
A0A2V5PIJ4      NLSITMALA-GARTLLIDGDLRRGALRDAFGVSS---KI-GFSEVLQQE-VNWR--QVVV
A0A2V6K2G8      NLAITMALS-GARTLLIDCDLRRGALREAFGITS---KI-GFSEVLKQE-VNWR--EVVV
A0A2V5W206      NLAITMALS-GARTLLIDCDLRRGALRETFGISS---KI-GFSEVLKQE-VNWR--EVVV
A0A2V6MW77      NLAITMALS-GARTLLIDCDLRRGGLREAFGISS---KI-GFSEVLKQE-VNWR--EVVV
A0A838MZM0      NLAITFALS-GARTLLIDGDLRRGAQREAFDISS---RV-GFAEVLKQE-VNWQ--DVVV
A0A838DHH0      NLAITFALS-GAKTLLIDGDLRRGAQREAFDIGS---KI-GFSEVLKGE-VNWQ--EVVV
A0A838FJZ1      NLAITFALS-GAKTLLIDGDLRRGAQREAFDISS---KI-GFAEVLKGE-VNWQ--EVVV
A0A0E3YV65      NLAASFASH-GIKTLLVDTDFRRPTLHRYYGQSN---DA-GLLRWLDTK-SKTE--PALL
W0J900          NLATAFAAH-GMRTLIIDGDLRRPVQHRLAGAPN---TH-GLLRWLDKG-GRSD--GPLA
B4CZV9          NLAASFALT-GAKTLLIDTDLRRGRLHRLFGYRK---EP-GLSNVLLGE-CTLE--DAFR
A0A7X1AX64      NLALTFAGQ-GQRTLIVDCDMRLPNVAKSFGIKP---KS-GMYDFFFGD-KTLD--DVII
A0A3B9FM17      NLAYSCANH-GRKTILVDFDLRRPGLHKFCNLEN---SK-GLLSLVNDV-GKPG--QDVQ
A0A7W7YGS1      NISWAFSSL-GERTLLIDCDLRRGRVHQVVDASN---AV-GMTDLLTGR-ASLD--DCIQ
A0A2D7WMI4      NLAYTCANH-GKNTILIDFDLRRPGLHKFAGLDN---ES-GIITLVNE-MSQNP--NFID
A0A2D6VHX5      NFAHTCANH-GSKTILIDFDLRRPGLHNFCDESN---DE-GVMTILNT-PNATE--EEVT
A0A2D8I214      NLAYSCANH-GRRTVLVDFDLRRPGLHKFCGIEN---KT-GLVSLVN--VASSK--ENLK
A0A1Z8VL41      NLAXSCANH-GRKTILIDFDLRRPGLHKFCSITN---DN-GLLTLINE-AKNGV--ENLR
A0A2E6TNA4      NLAFSCANH-GRKTILIDFDLRRPGLHKFCSISN---DK-GLLTLINE-AKNGV--ENLH
A0A1Z8RG47      NLAFSCANH-GRKTILIDFDLRRPGLHNLCNITN---EK-GIVTLVNE-VVKGS--KDID
A0A1Z8RJJ5      NLAFSCANH-GRKTILIDFDLRRPGLHNLCNITN---EK-GIVTLVNE-VVKGS--KDID
A0A2D7V631      NLAYSCANH-GRKTILIDFDLRRPGLHNFCNITN---EK-GIVSLVNE-VVKGS--SDID
A0A354RA24      NLAYSCANH-GRKTILIDFDLRRPGLHNFCNITN---EK-GIVSLVNE-VVKGS--SDID
A0A2E9RV62      NLAYSCANH-GRKTILVDFDLRRPGLHKFCGVNN---DR-GLLTLINETVANPT--PNYN
A0A2E4AY96      NLAFTCANH-GKKTILIDFDLRRPGLHKFVGLEN---EG-GLIPIINK-SAEQP--NYIK
A0A3B9B9P4      NLAFTCANH-GKKTILIDFDLRRPGLHKFVGLEN---EG-GLIPIINK-SAEQP--NYIK
A0A2D5Y6N6      NLAYSCANH-GKKTILIDFDLRRPGIHKFCNITN---EK-GLLSLINS-EKTDL--KELQ
A0A2E7HSS8      NLAHSCANH-GRKTILIDFDLRRPGLHKFCNMEN---ER-GLLSLVNE-VSQKG--GDID
A0A2D8VCK3      NLAYSCANH-GRKTILVDFDLRRPGLHKFCNLEN---SK-GLLSLVND-VGKPG--QDVQ
A0A350QVY4      NLAYSCANH-GRKTILVDFDLRRPGLHKFCNLEN---SK-GLLSLVND-VGKPG--QDVQ
A0A2E4ZYR7      NLAYSCANH-GRRTILIDFDLRRPGLHKFCGVSN---DR-GLLTLVNE-I--NG--EHDT
A0A2E6TCV1      NLAYSCANH-GRRTILIDFDLRRPGLHKFCGVSN---DR-GLLTLVNE-I--NG--EHGT
R7E4L8          NLAAAYAQT-GKKVLLIDGDLRKASLSAFYGGKN---AR-GLVHLLMNPQVSPD--SVLQ
A0A4P6PCA7      NLAISLARN-GLKTLLIDADLRRPQIGNIFEIPA---EHPSLLEWLSSGSSELERSELVS
A0A2T6DSN5      NLAAVFAAH-GRRTLLVDCDFRRPTLRRYFGATA---GV-GLLPWLREN-AHRP--DVQI
A0A317ZIW7      NLAVALSFS-HSKVLLVDADLRRGRLHKLMNLDF---DG-GLTDVLEGR-KEME--EVIQ
A0A7C4PPT4      NLARSFAQM-GEKTLIIDADLRRGRLHRIFGQRS---AP-GLSNILMQH-ADWR--DVIR
A0A7C4QZX4      NLAQSFAQM-GEKTLLIDADLRRGRLHRVFNQRS---AP-GLSNILMQG-LDWR--EVVR
A0A3C1AXQ2      NLAFVCAQG-GYSVLLIDADLRRPRMHTLFDVSN---SV-GLTNFLTTN-VQLE--EVVV
A0A3D4HHL8      NLAVTLAFA-GKKTLLLDADLRRGVLHNAFNVPN---DK-GLSDVIRER-ISFD--DAIQ
A0A366HV03      NLAWTLQSI-GAKTLLVDLDFRKGRVHNLFGVDR---YP-GFCQALTGE-LVLE--DVVR
A0A6G6K911      NLAWTLQSI-GVKTLLVDLDFRKGRVHNLFGVNR---SP-GFCQALTGE-LALE--DVIQ
A0A832HT83      YLAASFAQM-GEKTLLIDADLRRGRLHRLFNYRS---AP-GLSNILSES-LNWR--DIVR
A0A5R8KAF2      NLAWAFQSM-GSRTLLIDCDLRRGRVHQVLDVAN---DI-GITQLLLNR-FPVQ--EAVL
A0A7C4LRZ6      NFAITLAIA-GHRVLMVDADMRRGNIHNYFDLTR---EN-GLSELLNGE-AHWL--DVVK
A0A351MR11      NIALTFAQH-GERVLVVDADLRLPNVAPSMGIET---DN-GISKYFNNE-ITLD--EAIL
A0A388PR45      NLALAFAQH-AERVIVVDADLRLPNVGPSLGFAG---DG-GVSRWFNGE-MTLD--EAIV
A0A388QR61      NLALTFAQH-SERVIVVDADLRLPNVGPSLGFAG---DG-GVSRWYNGE-MTLD--EAIV
A0A4P5YHI0      NLALTFAQH-SERVIVVDADLRLPNVGPSLGFAG---DG-GVSRWYNGE-MTLD--EAIV
A0A2A2RS01      NLALSFAQH-AERVLVIDADLRLPNVGPSLGFSG---DG-GVSRWFNGE-MTLD--EAIV
A0A2A2Y1A7      NLALSFAQH-AERVLVIDADLRLPNVGPSLGFSG---DG-GVSRWFNGE-MTLD--EAIV
A0A388PDH9      NLALSFAQH-AERVLVIDADLRLPNVGPSLGFSG---DG-GVSRWFNGE-MTLD--EAIV
A0A2G4H1E7      NLAMIFAQH-SERVLIIDADLRLPNVGPTLGFTG---DA-GLSKWFNGE-IPLD--DAII
A0A2G4GZA6      NLALIFAQH-SERVLIIDADLRLPNVGPSLGFTG---DG-GLSKWFNAE-MSLD--EAIV
A0A388P514      NLALIFAQH-SERVLIIDADLRLPNVGPSLGFTG---DG-GLSKWFNGE-MSIE--EAIV
A0A2A2YG59      NLALIFAQH-SERVLIIDADLRLPNVGPSLGFTG---DG-GLSKWFNGE-MSID--EAIV
A0A2G4F7D5      NLALIFAQH-SERVLIIDADLRLPNVGPSLGFTG---DG-GLSKWFNGE-MSID--EAIV
A0A7V4IDX4      NLGITLAEA-GGKVLIVDADLRKGTLHEYFKFPA---GP-GLTEALSAE-TPWP--QLVR
A0A2V2SDN0      YLAATMAIG-GSKVLLIDGDMRRAKLHRHFGVAS---SP-GLAEILNQE-TYPN--YGIV
A0A4Q3BVY2      NLAWAFQSM-GEKTLLLDCDLRRGRIHGVVDIDK---AP-GMTRLLLGE-CTLE--QAIH
A0A8A7W4D3      NLAWAFQSM-GERTLLIDSDLRRGRVHGVTGLDN---SP-GMTRLLLGE-CTKE--EAIS
A0A3R8L982      NLAGAFARH-GRRTLLIDCDLRRPTIHRHFGIEN---NA-GLLAWFEAG-APFD--DLLP
A0A6N6QBS9      NFAITLANS-GHKTLLVDADLRRGNIHGYFEQPL---ER-GLSEVLEGT-LGLS--DAIR
A0A2V5X6Z6      YLAATLAKG-NSRVLLIDADMRRTALHKFFGAAS---SP-GLAEVLNEE-ISFA--EAIV
A0A2V5VGZ7      YLAATLARA-NSRVLLIDADLRRATLHTFFGTAS---SP-GLAEILNEE-ISFK--EAIV
A0A2V5U130      YLAATLARA-NSRVLLIDADLRRATLHTFFGTAP---RP-GLAEILNEE-ISFA--EAIV
A0A2V6C237      YLAATLARA-NSRVLLIDADLRRATLHTFFGTAS---SP-GLAEILNEE-ISFK--EAIV
A0A2E7HPU9      NFAIAAAQQ-GKKTILVDFDLRKPAVHKAFGLKRRDLPT-GLTEVLTGKATLAE--AIQE
D5EML0          NLSAVIAKH-NYRVLLVDCDLRNPSLHRAHGVED---DA-GLCPWFDSGSTDME--DLLG
A0A1V6GL40      NLAITMANA-GSRVLLVDADLRKGTLHRLFGVSP---EP-GLSDVLAKG-TAWE--TTVS
A0A7X7VL75      NLAITMANA-GSRVLLVDADLRKGTLHRLFGVSP---EP-GLSDVLAKG-TAWE--TTVS
A0A7C4PPJ4      NYAITLALA-GNRVLMVDADLRRGNINGFFNLER---DQ-GLAEVLAGE-VHWL--DVIK
A0A3C1C1M3      NLATACALN-GQKTLLIDFDLRRPRVGNIFPRPE---AVCGLLEYLDSDQMKPE--EIVY
A0A2S7U4L6      NLAYICAQG-GYSTLMIDADLRRPRLHTFFDINN---SV-GLTNYLTTT-LPLE--DVVL
A0A2E9EYJ1      XLAYVCAQG-GYNTLMIDGDLRRPQLHTFFNINN---SV-GLTNYLTTD-LXLE--DVIL
A0A258AXR6      NLAYVCAQG-GYNVLLIDADLRRPSLHTHFDVSH---AT-GLTNFLTTD-IRLE--DVVL
A0A7W7YD86      NLAYVCAQG-GYNVLLIDADLRRPSLHTHFDVSH---AT-GLTNYLTTD-VRLE--DVVL
A0A3D3NZQ6      NLAVVCAQG-GYSVLLIDADLRRPSMHTHFDAGN---TT-GLTNFLTTN-VRME--DVVV
A0A1T4WVZ9      NLAFVCAQG-GYSVLLIDADLRRPRMHTLFDVSN---AV-GLTNYLTTN-VTLE--EVVV
A0A4R7SSI6      NLAFVCAQG-GYSVLLIDADLRRPRMHTLFDVSN---AV-GLTNYLTTN-VQLE--EVVV
A0A7W8DNH5      NLAFVCAQG-GYSVLLIDADLRRPRMHTMFDVSN---TV-GLTNYLTTN-VQLE--EVVV
A0A4Q3AQI1      NLSISFAQT-GARTLLMDTDLRRGRLHRLFGYRK---SP-GLSNVLLGE-CTLD--E---
A0A6N2CMN7      NLSLTFANH-GEKTLLLDADLRLPNVARSLQLEN---DY-GLLDHIDKG-VSLD--E---
A0A432FAS4      NHAIVMAQT-GAKTLLVDFDLRRPSVHKAFQLQS---PR-GLSSYLLGK-IDSI--EE--
A0A660Q3A0      NVGISLGQA-GSRVLLVDADLRRGTMHKFFGVEA---DR-GLTDILVGR--AKP--EA--
A0A849Y855      NLACCLAQVEGGRTLLIDADMRKMSVHHFFDMEN---GA-GLSEALSGQ--ASL--DS--
A0A2D5W0Q9      NLAIVTAQT-GVKTLLIDADLRRPSMHKAFQMQS---PI-GLSAYLTGQ-ITDP--SE--
A0A857ZXX2      NLAMSFANI-GKRVLVIDGDLRKASLSKQLDGKG---RK-GLSTILLRK-VEDP--FSV-
A0A7V6ECG3      NFAITLMMA-KHKVLIIDSDMRRGGIHNFLDVYK---SP-GLSDYLLGK-ADIR--DII-
A0A1Z9KB52      NFAHTCANH-GSKTILIDFDLRRPGLHNFCDESN---DE-GVMTILNTP-NATE--EEVT
A0A7C5CZ90      NLAVTFALA-GDRVLLVDSDFRRPSLHKLLGVSN---KI-GLTDLLFRE-KKLD--D---
A0A257LYL4      NLAYICAQG-GYTTLMIDGDLRRPRLHTFFDINN---SV-GLTNYLTTE-LMLE--D---
A0A4Q2XXY1      NLAYICAQG-GYNTLMIDGDLRRPKLHTFFDINN---SV-GLTNYLTTA-LQLE--D---
A0A4P6PD26      NLAFVCAQQ-GEKVLLIDADLRRPVQHTILGVSN---RF-GLTNVLLRD-VPVE--EAI-
A0A1Z8SVB5      NYAHTCANH-GSKTILIDFDLRRPGLHNFCNESN---DA-GVMTILNTP-NATE--EQIS
A0A2V5W3Y0      NLAITMALS-GARTLLIDGDLRRGALREAFGVSS---KI-GFSEVLKQE-VNWQ--EVV-
                  .           :::* *:*                  .                   

A0A2V5U7A0      PTSI-------AGLSLVT---RGVC-PP-----NPSELLGTRKMKELVMDLRESYDFILL
A0A3D4CZT6      QTPV-------DNLYFLP---SGIL-PA-----DAAGLLNSRRMSELIQDVKQRFDLVLV
A0A4V1S9Q4      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELIQDVKQRFDLVLV
A0A355VK99      RPVG-------EDTRGMDVLYTGPT-VP-----NPVTLLSHPLLGQILSILKKQYDAVII
A0A2V6N5E0      PTAY-------ETLFVLP---RGKT-LS-----QPSEHLLRESTEALLKEMYQHYDYIII
A0A2V6NH44      PTTY-------PSLFLLT---RGKA-LP-----QPSEHLLRDSTDQFLKEIYHQYDYIII
A0A3D0IZR7      STAI-------PNLEILT---AGSL-GP-----EELGGFSRSRLATLMEACRPNYDVILV
A0A520LRZ3      QTAY-------ENLFFMP---SGIL-PS-----DAAGILNSRRMSELIADVKSRFDLVLV
A0A356FSV4      NEVY-------PHLDVLP---AGGK-SK-----NPTQILNSAKYSSLLGSLREKYDRIVI
A0A3D3DET9      ATKI-------ANLHILP---AGTF-TA-----RSSELFISEATQRFLRDAASRYDYVIF
A0A355SVK9      KEVY-------PNLDVLP---TGGK-SK-----NPTQVLNSAKFEAMLADLRERYDRIVI
A0A2E5D7I3      -TKT-------PGIERLDAIFAGGK-AP-----NPGELLREEAISKLFAWAREHYDHIVI
A0A2V5NYE2      ATRT-------PNLFLLP---RGAI-TH-----KSSEFFIGEVTERFLRDAAAKYDYVMI
A0A353DI77      YPGL-------DTLSVIY---SGPK-SP-----NPGELLEPGRLRDLVEMFSSNFDHIVI
A0A2V6FIP7      TTEV-------PHLDVVC---CGAV-PS-----SPSELAGSKRMRQFLEEVRNRYDRVIL
A0A3C1UJT2      QFPDLAIYEATEKLFVLH---GGSH-IS-----NPSEHISGSAIEELILKARQNFDRIVI
A0A258AXL1      SSGV-------ENLDFIS---RGND-SA-----RGHDLLSSSRFKEFLDALKHHFDRIIV
A0A2V5UAD5      TNSL-------PNFFFVS---SGGR-LS-----NPGDLFLNPALSQVLAWARQHFDYVLI
A0A7Y4QK88      TNSL-------HNFYFIA---RGKL-SG-----NPGDLFLDSALDQILARWRQEYDYVVI
A0A1V6GCZ3      TTSL-------PTLDFLS---SGKL-PS-----SSLGILSSTQMKDLIGELKQRYDFVFF
A0A7V3WMH6      TTPL-------PTLDFMP---SGKL-PS-----SSLGLLSSQQMKDLIRDLKRRYDFVFF
A0A2S7U0Z3      DTEI-------ENLTVVC---SGAK-AP-----NPSELLNEGEFNSLLEDLIPEFDRIIL
A0A2E6T1E0      QTEV-------PNLDVIC---CGAV-PN-----NPSELSGSQRMRDFVEEVRTKYQKIVF
A0A5E6MKA7      ATAL-------PNVWAIG---AGRT-PC-----HPADLLGAAAMAYLCQWARSHFGYVLL
A0A7W1HKQ4      PTKV-------ENLSLLP---SGAL-PS-----DAVGILNSQRMSDLIAELKTRFDMILF
A0A6B3L936      PTRV-------EGLFVVP---SGKK-PP-----NPLGLLQPDEIMELVDEASKEFDRVII
A0A2N8IR72      PLGENS-----RGMDILY---TGPM-VP-----NPVTLLSHPLLGHILGILKKQYDAVII
A0A2N8IV96      QTPI-------ENLYVMP---AGPT-PF-----DPSGALNSRKFNELLQEVKQRFDIVLV
R7E1V8          QTPI-------ENLYVMP---AGPT-PF-----DPSGALNSRKFNELLQEVKQRFDIVLV
A0A2E0R252      KTRES------ENLFIMP---AGSR-SA-----NPSELLAGKGLKGAIGALEEYFDRIII
A0A3E1EF48      QT-EI------ENLWFVP---GGGK-SA-----NPAELLGGRHLGTFLADLCRDFDRVVI
A0A2A2PVG8      RSEVS------EDLFLIP---AGSW-SA-----NPAELLSGKSLRPLLEKLSEYFDRIVI
A0A2E0R421      PTDKS------GKLYVLL---AGSP-SA-----SPSELLASKALPALVDKLGKYFDRIII
A0A2E5EJ69      KTDF-------ENLTLIP---AGST-VP-----NPSELIASDHVKKLIDDVVGKYDQVVI
A0A2G4I5Z5      KTRF-------DNLFLLT---AGTM-VP-----NPAELLSGQWTAKLIQEASAKFDHVVL
A0A4P5QQV6      QTRV-------PGLSLLS---RGST-VQ-----NPGELFLSTDTDRFLRAADAQYDYVIM
A0A2E7ALI1      KTPGI------ETLDAIF---AGGK-AP-----NPGELLREGMIEKLFDWAREHYDHVVI
A0A178IDB9      DLATLGIATVENNLHLLP---AGHA-IK-----NPTEIIDQIAHSELFNKLSKSYEVIII
A0A290QD69      ETQKMGIVTIAPGLDLLP---AGDA-IK-----NPTEVIDQLAHCDLFNKLSKIYDLVII
A0A6N6ZC77      PTEI-------ENLSFLA---SGAY-PQ-----RPGELLLSRRMDEILTQAREAYDYVVI
A0A832M896      KTPY-------PGLDYIP---RGKS-AP-----HVGELLISPAAELFVRETKEAYDYVIF
A0A538NJ59      TNSL-------PNFFFVS---SGGR-LS-----NPGDLFLNPALSQVLAWARQQFDYVLI
A0A2A2R3V9      ESAA-------YHFHIIP---RGPT-PP-----NPGELFLSSLVPSIFQEMRDEYDYVVV
A0A3C1VFY9      ETTV-------GNLFLLP---RGAS-TQ-----HSSELFLGPVMGKFLQETIKEYDYVLI
A0A2V2SMX4      ETTI-------PNLWLLP---RGST-TH-----HSSELFISQAAADFLKNAAMQYDYVIM
A0A522AC27      KTGV-------ANLDLLP---RGGT-TQ-----RSSELFVHQDTKDFLKAAAAEYDCVVV
A0A6M1RFD0      PTSV-------PNLWVVP---SGTP-TQ-----NSSELFLQPVTRRVLEEMAAAYDYVVL
A0A7C3HXH0      PTSI-------PNLWVIT---SGSP-TQ-----KSSELFLQPLTRTVLQEMAAQYDYVVL
A0A432FDF6      TTEL-------PSLHFIP---SGKL-PS-----SSMGILSSAKMKEFVAEMKSRYDYVFL
A0A2E7VDS1      EPERNALTEIYPNLYVLP---SGGK-TR-----AATEMLARPDFDILLSNLKKLCDILII
A0A7C8D3W3      STPI-------ETLETIN---TGRL-PN-----NPGELLVSPITQQFLDEARNHYEYIII
A0A178IFJ2      NDPDLDLLRPAPNLFVLR---AGGT-SR-----RISELLDNEKLKGLFEQARREFDILVI
A0A357FSP9      KAVY-------PNLDVLP---SGGK-SK-----NPTQVLNSAKFEAMLADLRDRYDRIVI
A0A1T4WWY4      KVEA-------ENLWAIT---RGMV-VP-----GTTELLNSGVFAAILEELKKKYDRIIL
A0A3D3LEQ6      KSPA-------ENLWLLP---RGQV-IA-----GTTELLNTEVFSQLLDTLRKQFSRIIL
A0A3D3NW23      KSPA-------ENLWLLP---RGQV-IA-----GTTELLNTEVFSQLLDSLRKQFSRIIL
A0A522ACN3      HSNV-------ANLDFLP---SGKL-PS-----SSLGILSSNQMKDLISGLKQRYDYVFL
A0A2A2R174      TTRF-------DNLFLLT---AGTT-VP-----NPAELLSGQWTSKLIKEASAKFDHVVL
A0A1H2DTI1      PSKH-------KNLSVMV---CGKY-TS-----QGAELFLSPITDGILREMYNEFDYIIF
A0A1H1MGC9      RNVH-------PNLDVIP---AGGR-AK-----NPTQILNSKNFELMLSELRKRYDRIFI
A0A1V5L462      VGDQEL-----GNLSVIS---AGRP-QE-----NPGDLFLNERMDAILEACRKQYDFVIL
A0A3D3LGD3      RTAV-------ENLYFLP---SGLL-PA-----DSAGILNSQRMSDLIEDAKSRFDIVLI
A0A350ARX4      QTQH-------AKLDLIA---NGRS-LL-----NSGELLLSERMDNLLEWARERYTYVIV
B5JIS2          EDSPLGIQKLKGGAYLLP---AGGV-FP-----LPSKLLVSTKIDALLRKLEETFEVIIV
A0A7Y1UGD7      ESGQ-------ADLSLML---SGPK-AP-----NPGELLESGRLERTLELFEQYYDHIVL
A0A2E5K4P7      PGVF-------TNLDILP---AGGR-SR-----TPMTIFNNEYFPFLMNEIRQYYDKIII
A0A842HH73      SELY-------PNLDVLM---AGGK-AK-----NPTQILNSPRYEEMLHELRSRYDRIII
A0A2E6NAH3      KEVY-------PNLDVLS---TGGK-SK-----NPTQVLNSAQFEAMFSDLRNRYDRIVV
A0A2A5VZA5      SEVY-------PNLDVLP---SGGK-SK-----NPTQVLVSAQFEAMLADLRDRYDRIVV
A0A424R295      SEVY-------PNLDVLP---SGGK-SK-----NPTQVLVSAQFEAMLADLRDRYDRIVV
A0A1H2GQN6      ETAI-------PNLHIIP---AGED-AH-----DAISRFDNQVLREIIVELKEKYQVIFI
A0A858RDL7      PVPGT------THLHLVA---SGNR-AP-----NPGELMDAVKIRELLILACRHFDVVVL
A0A512M3Y3      KTDS-------PKLEVLS---RGKN-SA-----PRFEILSAARFVNTINDLRKQYDRIII
A0A4P5R5J1      PSST-------PNLSILP---RGKT-LP-----HPAEHFLGKVTDQLLQEVYAEFDYIIF
A0A4P5YK43      ETPI-------PTLHLLT---TGQL-IA-----NPGELLMGEVAHKVISEARQFYDHVII
A0A2A2RPW6      TTRF-------ENLFLMT---AGKM-VP-----NPAELLAGPWAKQLIEEASKRYDKVVL
B1ZT68          PPLPTTIA-FSENLDLLP---SGGV-AK-----NPTETLERFVTSGMLKRLLERYDLVIL
W0J7C2          PTLPVGIVPVADHLDLLP---AGRS-LG-----RPTELLDQLSRRETLQPLLDNYDLILF
B4D1I7          LTLV-------PGLMLLS---RGRG-VP-----NPGELYLGRSADEFLKTVHAEFDYVVL
A0A353F286      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A354FSA6      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A3B9GA54      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A520LEH8      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A6B2M0T8      S----------EGLHILP---FENS-TV-----EATELIESPAFRQSIEKFQEQYDIIII
A0A2D7B7R6      QFPDLAIYEATEKLFVLH---GGSH-IS-----NPSEHISGSAIEELILKARQNFDRIVI
A0A353DCA1      QTPV-------DNLYFLP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A7C5H7K5      ATPY-------QNLWFMP---RGES-VL-----NASELFLSDRCDSFLQQASEQFEFVVF
A0A7V3QF58      ATPY-------QNLWFIP---RGES-VL-----NASELFLSDRCDSFLQQASEQFEFVVF
A0A832FWF3      ATPY-------QNLWFIP---RGES-VL-----NASELFLSDRCDSFLQQASEQFEFVVF
A0A838YJR8      QTAY-------ENLYFMP---SGIL-PA-----DAAGILNSRRMSELIADVKSRFDLVFI
A0A6N4WVA3      SSRY-------EHLDFVS---IGGY-PD-----HPAELLMSENMDAFIREARERYDFVIF
A0A0R2XPB1      SSSY-------EHLDFVS---IGGY-PD-----HPAELLMSKYMDQFIRDARAQYDFVIF
A0A348NQP1      STSY-------KHLDFVS---IGGY-PD-----HPAELLMSEYMDQFISEARERYDFVIF
A0A357FV58      STSY-------KHLDFVS---IGGY-PD-----HPAELLMSEYMDQFISEARERYDFVIF
A0A2G4GZN8      RDVA-------PGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIEELRGRYDRIFI
A0A348NPT1      KAVY-------PNLDVLP---SGGK-SK-----NPTQVLNSAKFEAMLADLRDRYDRIVI
A0A2E1KV60      KDVY-------PNFDVLP---SGGK-SK-----NPTAVLSDEKYQSMMLELRDRYDKIIV
A0A2D7F4D9      KEVY-------PNLDILA---SGGK-AK-----NPTAILNDSKFESMLLQLRDRYDKIII
A0A3R7RBR8      KEVY-------PNLDILA---SGGK-AK-----NPTAILNDSKFESMLLQLRDRYDKIII
A0A2E0NH28      NEVY-------PHLDVLP---AGGK-SK-----NPTQILNSAKYSSLLGSLREKYDRIVI
A0A368BGT4      KDVC-------PNLDVLP---TGGK-SK-----NPTQVLNSAQFEEMLAVLRDRYDRIVI
A0A317ZP96      KEVY-------PNLDVLP---SGGK-SK-----NPTQILNSASFESMLAELRDRYDRIII
A0A350AS32      KEVY-------PNLDVLP---SGGK-SK-----NPTQVLNSAKFEAMFADLRDRYDRIVV
A0A7W8DI01      STKT-------PGLSLVA---RGKS-KS-----VSPELLSRNQFQHLIDSLRPDFDRIIV
A0A6N6PLV8      TTKI-------DNLSFIP---AGEL-PG-----DSEGILNSQRMTDLIAKVKGQYDLVFF
A0A290QE54      ENQHLGITRLSENFSLLC---SGGR-SK-----TPTEILENPAFGQLLARLKKHFDLIIV
A0A1H1SWX2      TDASLGFTKVDENLFLLR---SGGR-SK-----SPTELLETAVFGQFIEAMKQHFDLIVV
A0A1D8AZK8      TDAALGLAKVDENLYLLR---SGGR-SK-----SPTELLENPVFGQFIEAMKQHFDLIVV
A0A4Q1C9I5      TDASLGLTKAEENLFLLR---SGGR-SK-----SPTEFLENPIFGQFIEAMKQHFDLIVV
A0A842HCC8      QTSY-------EGLDLIA---TGEY-PE-----RPGELLMSTRFDQIMDELKKRYDYIIL
A0A1G3ZL71      TDPKLGLARIADNLMLLR---SGGR-SK-----VPTELLEKPEFGELILQLKKRFDLIVI
A0A556QP09      INPSLGITSIGENLSLLS---SGGR-SK-----SPTQLLESPIFGQLLEKLKKHYDLIVV
A0A2T6DX88      NDPTLGIVKLEDNLSLLR---SGGR-SK-----IPTELLEDPRFGQLIAKLKNQYDLVVV
A0A2T6CWI7      THPSLGIVPVAENLWLLC---SGGR-SK-----SPTELLENPVFGQLLERLKKEFDLVIV
A0A3E1E5C8      TDPSLGIIKLADNLSLLC---SGGR-AK-----SPTELLENPAFGQLLEKLKKDYDLVVV
B1ZZ74          STPALGIIKISENLSLLC---SGGR-SK-----SPTEFLENPVFGQLLERLKREYDLVII
A0A2E0V4K6      DVGH-------GNLDAVF---AGGK-VR-----NPGELLKPGAIRELLQWAREHYDHVVI
A0A7W1VQ11      PGGH-------ENLTLVT---CGKH-VD-----FACELLDGPSFAALLGDLRKKYDRIII
A0A2V6F9Q9      PTAY-------HSLSLLT---RGKP-LT-----QPSEHLLRDSTDQFLKEIYHQYDYIII
A0A2V6NZZ3      PTAY-------PSLLLVT---RGKT-LA-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A2V6EBU2      PTAY-------PSLLLVT---RGKT-LA-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A2V6EY06      PTAY-------PSLLLVT---RGKT-LA-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A2V6ME53      PTTY-------PSLFLVT---RGKT-LP-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A538NUU0      PTTY-------PSLFLVT---RGKT-LP-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A2V6NIJ1      PTVY-------PSLFLLT---RGKA-LT-----QPSEHLLRDSTDQFLKEIYHQYDYIII
A0A2V6C292      PTAY-------PSLFLLM---RGKA-LA-----QPSEHLLRESTDQFLKEIYHQYDYIII
A0A2V6D2X0      PTAY-------PSLFLLM---RGKA-LA-----QPSEHLLRESTDQFLKEIYHQYDYIII
A0A2V5ZUK1      PTAY-------ETLFVLP---RGKT-LG-----QPSERLLHETTDVLLREIYQHYDYVII
A0A7W1MVB5      PTSL-------SSLFVLP---RGNT-IS-----QPSEHLLRESTDAFLKDIYNHYDYIII
A0A7W1U7H7      PTSL-------SSLFVLP---RGDT-IS-----QPSEHLLRESTDAFLKDVYNHYDYIII
A0A2V5XFN9      PTAV-------PTLFVLP---RGKP-LS-----QPSEHLLRESTEALLKEIYQNYDYVII
A0A2V6EZC8      PTAV-------PTLFVLP---RGKP-LS-----QPSEHLLRASTEALLKEIYQNYDYVII
A0A2V6I7Z5      PTAV-------PTLFVLP---RGKP-LS-----QPSEHLLRESTEALLKEIYQNYDYVII
A0A3B9LCP2      PTFY-------PSLFVLP---RGKI-SA-----QPSEHLLRDSTDAILKEMYNYYDYIII
A0A3C0R669      PTFY-------PSLFVLP---RGKI-SA-----QPSEHLLRDSTDAILKEMYNYYDYIII
A0A2V6EID2      PTSY-------PSLFILP---RGKS-LS-----QPSEHLLRDSTDVLLKEMYKHYEYILI
A0A2V6MHB0      PTSY-------PSLFILP---RGKS-LS-----QPSEHLLRDSTDVLLKEMYKHYEYILI
A0A7V9V4N8      PTTY-------PSLFVMP---RGKA-LS-----QPSEHLLRESTEALLREMYNHYDYIII
A0A838I5D7      PTAY-------PSLFVLP---RGKT-LS-----QPSEHLLRDTTDRLLQEIYNHYDYIII
A0A2W5YWL9      PTSC-------SNLSLLP---RGKT-VA-----QPSEHLLRDSTDQMLKDMYQQYDYILI
A0A2V5NH62      PTTY-------ENLFVLP---RGKT-LG-----QPSEHLLRDSTDALLRDMYNHYDYIII
A0A2W6A620      PTSY-------PNLYLMP---RGKT-LG-----QPSEHLLRESTDQLLKEMYNHYDYILI
A0A2V5PIJ4      PTSY-------PNLFLMP---RGKT-IG-----QPSEFLLRESTDALLREINTFFDYIII
A0A2V6K2G8      PTAV-------STLFVLP---RGKT-LG-----QPSEHLLRESTEALLKEIYQDYDYVII
A0A2V5W206      PTAY-------ETLFVLP---RGKT-LS-----QPSEHLLRESTEALLKEMYQHYDYIII
A0A2V6MW77      PTAY-------ETLFVLP---RGKT-LS-----QPSEQLLRDSTEALLKELYQHYDYVII
A0A838MZM0      PTAY-------PSLFVMP---RGKT-LS-----QPSEHLLRPSTEALLREMYSHYDYIII
A0A838DHH0      PTAY-------PSLFVLP---RGKT-LA-----QPSEHLLRDSTDRLLQEVYNQYDYIII
A0A838FJZ1      PTAY-------PSLFVLP---RGQA-LS-----QPSEHLLRDTTDRLIQDLYLHYDYIII
A0A0E3YV65      RDPALGITAFGPSLHLLR---SGGT-TR-----RSTEILDSAAFRDLLDFLHKQYDAVII
W0J900          GDPDLGLLRPAPNLFVLR---AGGI-SR-----RISELLESKKLKALIEQAQREFDILLI
B4CZV9          PSGQ-------ENLTVLS---AGRH-LD-----HGTELLGSAQFSELLNSLRGRFDRIVI
A0A7X1AX64      KEVT-------PNCDILP---TERA-PD-----NPTQVLNSVEFEQLLIQLRHRYHKIVI
A0A3B9FM17      NCISESLTEVHPNLFLLP---SGGK-TR-----AATEMLEQNDFSTVIDLLRRNAEVIII
A0A7W7YGS1      KAAA-------DNLWTIS---RGAV-VP-----GTTELLNSGVFAAIIEELKSKFDRIIL
A0A2D7WMI4      SGLKKHLKNIHPNLNMLT---SGGK-TR-----SVTELIERKEFGILLDKLKAESDVIVV
A0A2D6VHX5      DKLKKVLCSIHPNLFLLP---SGGK-TR-----AATEIIEKKEFELLLTCLKKLADVVIF
A0A2D8I214      NSINDSVQEIHPNLYILP---SGGK-TR-----AATEMLEQKEFDIVHNELKEMFDVIIV
A0A1Z8VL41      ELTDKTLHPIHDNLYILP---SGGK-TR-----AATEILESAEFEMVTNHLKSLAEVIII
A0A2E6TNA4      ELADKTLHPIHDNLYILP---SGGK-TR-----AATEILESTEFEMVTNHLKSLAEVIII
A0A1Z8RG47      THIQESLHETHPNLHVLP---SGGK-TR-----AATEMLERAEFDLVMNKLRQIADVIIV
A0A1Z8RJJ5      THIQESLHETHPNLHVLP---SGGK-TR-----AATEMLERTEFDLVMNKLRQIADVIIV
A0A2D7V631      EQIKSCLHEIHPNLHVLP---SGGK-TR-----AATEMLERSEFDYVMNKLRQIAEVIIV
A0A354RA24      EQIKSCLHEIHPNLHVLP---SGGK-TR-----AATEMLERSEFDYVMNKLRQIAEVIIV
A0A2E9RV62      FWDSGTLVEIYPNLLILP---SGGK-TR-----AATEMLEKPEFDKMLFSLRQNAEIIII
A0A2E4AY96      ENLDSELHDIHPNLKMLT---SGGK-TR-----SVTELIEKNQFHELLGKLKSSADIIVV
A0A3B9B9P4      ENLDSELHDIHPNLKMLT---SGGK-TR-----SVTELIEKNQFHELLGKLKSSADIIVV
A0A2D5Y6N6      ELAQSTVTQIHPNLLVLP---SGGK-TR-----AATELLESNSFDRIHKILRTIADVIII
A0A2E7HSS8      QSVTETLTEIHPNLFVLP---SGGK-TR-----AATEMLEHNDFSVVIDSLKRHAEVIII
A0A2D8VCK3      NCISESLTEVHPNLFLLP---SGGK-TR-----AATEMLEQNDFSTVIDLLRRNAEVIII
A0A350QVY4      NCISESLTEVHPNLFLLP---SGGK-TR-----AATEMLEQNDFSTVIDLLRTNAEVVII
A0A2E4ZYR7      EAERNALTEIYPNLYVLP---SGGK-TR-----AATEMLERPDFDILLNNLKKLCDILII
A0A2E6TCV1      EAERNALTEIYPNLYVLP---SGGK-TR-----AATEMLERPDFDHLLNNLKKLCDILII
R7E4L8          SGKRF------PGFDLVT---AGPV-PP-----NPVALLTQGRLEELLRYWRARYDRIIL
A0A4P6PCA7      RNVI-------EHLDVIT---SRPLKNV-----NPAEMLGRKELAELIKWARDEYDRVII
A0A2T6DSN5      DAHKMGIMNIGPAFDLLP---AGDA-IK-----NPTEVIDQIASCDLFNKLSKHYDIIVI
A0A317ZIW7      RSTY-------DNLDFVS---IGGH-PD-----HPAELLMSDSMEQFIKHAREHYDFIVF
A0A7C4PPT4      PTDH-------ENLFLMA---CGKH-LE-----GATELVGSPVFEKLLAELRQEFRRIII
A0A7C4QZX4      TTDK-------ENLLLLT---CGKH-LD-----GATELVGSPIFEKILQEFRQEFKRIVI
A0A3C1AXQ2      RTPV-------ENLYFLP---SGML-PA-----DSAGVLNSQRMSELIADAKSRFDLVLI
A0A3D4HHL8      RPGI-------ENLDFVA---HGTT-TK-----RPGELLSGVYFATMLEGLRKRYDFIVF
A0A366HV03      HTHL-------ANFHYCT---RGNT-SA-----GSAELLCRLSLEENVAIWRQQYDWIIL
A0A6G6K911      HTHL-------TNFHFCT---RGNT-SA-----GSAELLCRLGLEESINIWRQQYDWIIL
A0A832HT83      STEK-------PNLFVLT---CGKH-SS-----SATELIGTSAFSELLAELRKEFKRIII
A0A5R8KAF2      KTSN-------PLLDVIP---RGPI-IT-----GTTELLCQKGFVDLVERFRGEYDQIVI
A0A7C4LRZ6      QTSV-------PTLKLIS---TGRL-PP-----NPGELLIGPITKELIEQARKEFDYIVF
A0A351MR11      KDFE-------PNLDILP---VGGI-CK-----NPTQVINSPRFDELIRELRTRYDRIFI
A0A388PR45      KDVA-------PGLDVLP---VGLS-CR-----NPTQVINHPRFGEMIDELRRRYDRVFI
A0A388QR61      KDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFAEMIDELRRRYDRVFI
A0A4P5YHI0      KDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFAEMIDELRRRYDRVFI
A0A2A2RS01      RDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFLAMLDEMKTRYDRIFI
A0A2A2Y1A7      RDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFLAMLDEMKTRYDRIFI
A0A388PDH9      RDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFLAMLDEMKTRYDRVFI
A0A2G4H1E7      REVA-------PGLDVLP---VGLS-CK-----NPTQVINHPKFLAMIDGFRERYDRIFI
A0A2G4GZA6      HDVS-------PGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIDELRGRYDRIFI
A0A388P514      HDVS-------PGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIDELRGRYDRIFI
A0A2A2YG59      HDVS-------PGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIDELRGRYDRIFI
A0A2G4F7D5      HDVA-------SGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIDELRGRYDRIFI
A0A7V4IDX4      ATTT-------PGLNVLT---RGRT-AR-----NPSELFLSPLTKQFLAEVTAAYDIVLL
A0A2V2SDN0      TTAL-------ENLSFLP---AGAP-TL-----EPGELVLRSQFSSLLSDVYSRFDYIII
A0A4Q3BVY2      SMGQ-------GGFDVIP---RGPV-IA-----GTTELLCQDVFSNMLEHFRKTYDRIVI
A0A8A7W4D3      SISP-------ESFDVIT---RGPV-IA-----GTTDLLCQQVFRDLLEDFRGSYDRIVI
A0A3R8L982      ENPHLGVIKIGENFDLLR---SGGR-SR-----TPTEFLESAAFTQLLTKLKKHYDLVIV
A0A6N6QBS9      ETPI-------KNLSLMV---AGAR-PG-----NPSELLIGAATKDLIMELRRQFDYVVF
A0A2V5X6Z6      PTGL-------ENLALLP---AGEA-RQ-----NPGELALSPVWLSFLAEAKSQFDYVLV
A0A2V5VGZ7      PTGL-------ENLALLP---AGEA-NR-----NPGELVLSQVWPGFLAEAKPQFDYILV
A0A2V5U130      PTGL-------ENLALLP---AGEA-NR-----NPGELVLSQVWPGFLAEAKPQFDYILV
A0A2V6C237      PTGL-------ENLALLP---AGEA-NR-----NPGELVLSPVWPGFLAEAKPQFDYILV
A0A2E7HPU9      QAGQ-------ENFSIIF---AGQKAP------NPGELLTTEGVVAVLKELKQEFDVIVI
D5EML0          NESL-------GILKLSP---SLSLLRAGGGCEHPTELLGDLRVSALFSKLKDLYDIVVF
A0A1V6GL40      ATKI-------ANLHILP---AGTF-TA-----RSSELFISEATQRFLRDAASRYDYVIF
A0A7X7VL75      ATKI-------ANLHILP---AGTF-TA-----RSSELFISEATQRFLRDAASRYDYVIF
A0A7C4PPJ4      DTSV-------SHLKLLT---TGKL-PG-----NPGELLIGPITAQFIAEARKHFDFVVF
A0A3C1C1M3      ASEC-------RNLSVIS---SRVVGRS-----RPAELVGGAKVAALLAWARAHFDRIVL
A0A2S7U4L6      QTSI-------ENLYFMP---SGIL-PA-----DASGILNSRRMSELIQEVKSRFDLVLV
A0A2E9EYJ1      QTAY-------ENLYFMP---SGIL-PA-----DAAGILNSRRMSELIAXVKSRFDLVFI
A0A258AXR6      RTQV-------ENLFFLP---SGLL-PA-----DSAGLLNSQRMVDLIAEVKSRFDLVLI
A0A7W7YD86      RTQV-------ENLFFLP---SGLL-PA-----DSAGLLNSQRMADMINEVKSRFDLVLI
A0A3D3NZQ6      RTAV-------ENLYFLP---SGLL-PA-----DSAGILNSQRMSDLIEDAKSRFDIVLI
A0A1T4WVZ9      RTPV-------ENLYFLP---SGML-PA-----DSAGVLNSQRMTELIEDAKSRFDIVLI
A0A4R7SSI6      RTPV-------ENLYFLP---SGML-PA-----DSAGVLNSQRMSELIADAKSRFDLVLI
A0A7W8DNH5      RTPV-------ENLYFLP---SGML-PA-----DSAGVLNSQRMSELIADAKSRFDLVLI
A0A4Q3AQI1      ----ALRPTVSENLTVLS---AGKH-LD-----TGTELLGSPRFTEIMQTLRERFDRIVM
A0A6N2CMN7      ----VIIKDVYPNLDVLP---TGGK-SK-----NPTQVLNSAQFEAMFAELRDRYDRIVV
A0A432FAS4      ----IVHHAEVPNLDVIC---CGAV-PN-----NPSELAGSQRMKDFIEEIRSKYDKIMF
A0A660Q3A0      ----VIQRTPIPNVDFIG---SGPY-PP-----NPAELLMRPELSAFLDYARRTYDRVMF
A0A849Y855      ----CVVETRIPNLHLLR---AGNA-PP-----NPGELLLSENFRQLLAQMSQYYHRIVI
A0A2D5W0Q9      ----ITQTTEVPNLDLIC---CGAV-PN-----NPSELVGSKRMGELLDSLRDRYDRIFV
A0A857ZXX2      ----IRTLPEHPGVDILY---AGPQ-VP-----NPVTLLSLPEMEELIRLFKERYDAVII
A0A7V6ECG3      ----RVGTGNLDKLNFIT---CGPV-TN-----NPGELLVGERFKQLVAYVRSEFEYVII
A0A1Z9KB52      DKLKKVLCSIHPNLFLLP---SGGK-TR-----AATEIIEKKEFELLLTCLKKLADVVIF
A0A7C5CZ90      ----VIVHTKLETLDFIP---SGRI-ST-----SALGLLNSNQMKSLISELKRRYDYVFF
A0A257LYL4      ----VILQTPVDNLYFMP---SGIL-PA-----DAAGILNSRRMSELIQDVKQRFDLVLV
A0A4Q2XXY1      ----VILQTPVENLYFMP---SGIL-PA-----DAAGILNSRRMSELIADVKNRFDLVLI
A0A4P6PD26      ------KATSVPNLHFLP---SGRL-PR-----TSLGVLDPKRIGELISSLKSKYDVVLI
A0A1Z8SVB5      EKIEKCLCNIHPNLFLLP---SGGK-TR-----AATEIIEKKEFELLLAAXKKMADVVIF
A0A2V5W3Y0      ------VPTSYPNLFLLP---RGKT-LG-----QPSEHLLRDSTDALLADLYNHYDYIII
                                                                         :..

A0A2V5U7A0      DTPPAIAVSDPAILSSVADGIILVFHARKTTVHSARQVKERFDAVRGPILGVILNGI---
A0A3D4CZT6      DSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLVRVKQAVENVGGHVIGVVLNNVD--
A0A4V1S9Q4      DSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLLRVKQAVENVGGNVIGVVLNNVD--
A0A355VK99      DAPPYGILADTAILASLSDITLYTVRSGKIDKRYLTQIQQLADQGKLPNMAYIINGVN--
A0A2V6N5E0      DSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALELLYGRQVNIPGVILNFV---
A0A2V6NH44      DSSPVLAADDTTSLAPKIDATLLVVRLSHTSARLTKKALESLYSRQVNVPGIILNYV---
A0A3D0IZR7      DSPPVLGISDASVISQEVDVSLLLIQHRRYPRNVSQRAKRVIEDVGGKLFGVILNNVN--
A0A520LRZ3      DSPPILGVSDASVLASEVDLTIIVIQHRKLPRGMLIRVKQAIENVGGKALGVVLNNVD--
A0A356FSV4      DSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRRLWESNTPVFGSVLNNV---
A0A3D3DET9      DTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVRLLGLVFNAVR--
A0A355SVK9      DSPPLGAVSDALNLLPLVDGVIYVVKFNTVKRKTAMVNARRMAESNTPVFGAILNNI---
A0A2E5D7I3      DSAPILPVPDTRIIFPLVDNPCLVIRANVVPKPAVFRALDVMEEDGSRIVGVVLNGYR--
A0A2V5NYE2      DTAPVMAADDVTSLAPHLDGVLFVIRAERTSARVGRAALELLYHRQVSVLGLVFNGVR--
A0A353DI77      DSAPLLPVPDTRILAPLVDNLALVIRAEHTPVKSIQRAFDMLEDDGVFSSGVILNDFT--
A0A2V6FIP7      DCPPVSAVSDPLIIASLSDGVAFVTKFNKIRRDHASRTIQRIQDAGIHILGVVLNDID--
A0A3C1UJT2      DSAPLGPIGDTLSVARLADMLCLVVRSGKTTSKVVLRIIDYLHRHGHTPSGIVLNFLR--
A0A258AXL1      DTPPLLGLADSLLISKAVDGLIFVIRADQTTQRDVATASEILHQSGAQVYGFVLNCVN--
A0A2V5UAD5      DSSPVFAADDTATLAPMVDGTLFVVRNRFSRPRPAREALELLFQRQAKVLGLVFNRAD--
A0A7Y4QK88      DSSPLFAADDASCLAAKVDGTLFVVRNHHSSARAVREALNILAQRQARVLGLVYNGAD--
A0A1V6GCZ3      DSPPIMGVSDASILASEVDMTIQVIQYRRYPQPMNIRAKQLIEKVGGNLVGIVLNNIN--
A0A7V3WMH6      DSPPIMGVSDASILASEVDMVLQVIQYRRYPQHMTIRAKQMVEKVGGNLLGIVLNNIN--
A0A2S7U0Z3      DSAPVLPVADSRLLAKHAHAVILVVRTRKTPIGAMIRACDLLKASGAKLGGVVVNGMK--
A0A2E6T1E0      DCPPVSAVSDPLIIAAATDGIIFVNKFNKIRREHARKTVQRIQDAGINIVGVCINDLD--
A0A5E6MKA7      DCPPLTGMPDAAVVGTLADGAVLVIRDGYVDRSEARRVVETLLGVNTRILGAVLNRVQ--
A0A7W1HKQ4      DSPPMLGVSDASVLASEVDQTIIIVQHRRFPRAMLTRVKQAIIGVGGSVLGVVLNNVD--
A0A6B3L936      DSPPVLPVSDTRLVAQHAHKVILVVRALKTPVGAVLRAKDLLLGAKLDLAGVVVNALK--
A0A2N8IR72      DAPPYGILADTAILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVN--
A0A2N8IV96      DSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVD--
R7E1V8          DSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVD--
A0A2E0R252      DSAPLVPVSDSLPLAKLAESVVLVCRVGKTPRGAIKRAIRVLEANHSAPVGVVANGLP--
A0A3E1EF48      DTAPLVPVSDTLPIAKRAQSVIMVYRMGKTPRKALFRGLKTLRSNHAEPVGIVANLLP--
A0A2A2PVG8      DSAPLVPVSDSIPIAKLVQSVVLVVRMGSTPKGAIKRAIRVLSDNGSHPVGIVANGLP--
A0A2E0R421      DSAPIVSVSDTYPLAKIAQSVVLVCRMSMTSRSSIMRALRILKVNQSDPVGIVANGLP--
A0A2E5EJ69      DNAPVTAVSDTLLILEYVQTICMVTRAAKTSYRLIGRALELVRRSGKNVSGLVLNFVP--
A0A2G4I5Z5      DNAPINAVSDALLIVKEAQTVCLVANAGKTSYRVVLRALEMLRRAGAKPSGVVLNFLP--
A0A4P5QQV6      DSAPVTAADDTSSLAPKVHATLFVFRFATSSMRISQKALDTLRERQVNVLGLVCNDVD--
A0A2E7ALI1      DTAPVLAVPDTRIIXPLVSNPXLVVRANVVPKPAVFRALEMLEEDGSRVVGIILNGYRES
A0A178IDB9      DTPPAAVFPDALLLSRFCAELVYVCRFRTVRRKLIKKTLSKFTESGISILGVVLNRMP--
A0A290QD69      DTPPAAVFPDALLLSRFCTEMIYVCRFKTVRKAVIRKALEKFQESGITILGVVLNCMP--
A0A6N6ZC77      DSAPILATDDTTSLAQRVDVALFVVRTNYTQTRQIKNSLERLRLRGAKIGGFVLNYVN--
A0A832M896      DTPPVLAADDTPSLAPKMDGVIMVMRASYTSSRMTQSSLDILYHRQVNVLGMVFNFID--
A0A538NJ59      DSSPVFAADDTATLAPMVDGTLFVVRNRFSRPRPAREALELLFQRQAKVLGLVFNRAD--
A0A2A2R3V9      DSAPILATDDTASLAPKLDGTIFLMRTSYTSARLSRNAMDLLYQRQVNILGLVMNFVD--
A0A3C1VFY9      DTAPVMAADDVTSLAPRVDGVIFVVRAEFTSARVVRASLDMLYQRKARVLGLVFNAVR--
A0A2V2SMX4      DTAPVMAADDVASLAPNMDSTIFLVRAEHTSARVARAALDILYQRRVKVMGLVFNAVR--
A0A522AC27      DTAPVMAADDVTSLAPLIDGTIFVIRAGETSGRVARAALELLYQRNVPVLGLVFNAVQ--
A0A6M1RFD0      DTPPVMAADDVTTLAPLAHGVIFVVRAQHTSARVARAALDLLYQRNVKVLGLVFNAVN--
A0A7C3HXH0      DTPPVMAADDVTTLAPLTHGVIFVIRAQHTSARVARAALDLLYQRNVHVLGLVFNAVN--
A0A432FDF6      DAPPIMGVSDASVLASMVDMCVLVVQYRKYPQLMTQRAKDMVTKVGGELVGVVLNNIN--
A0A2E7VDS1      DSPPVGLFPDSMAMARKVDEVLCVIRYGKVSRKVVKNLLAKVDETGANVLGVVLNDLP--
A0A7C8D3W3      DSPPVTAIDDTFSFVKIVDAFTFIVKAGETPMRFAKNAINEIIRRGAYISGIVVNGIK--
A0A178IFJ2      DTPPAGIFPDAFDLVPFASELVYVVRFNHVSRPQVHRVTERFRSTGLEMPGIVLNMMP--
A0A357FSP9      DSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNIS--
A0A1T4WWY4      DTPPVLGLSETAFLQHHADGVAIVVRCGKTLRKDVEDAVQSLQKLGAHFYGFILNGVD--
A0A3D3LEQ6      DTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQLEKLGGHFFGFVLNRVD--
A0A3D3NW23      DTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQLEKLGGHFFGFVLNRVD--
A0A522ACN3      DSPPIMGVSDASILASEVDITLQVIQYRRYPQPMNIRAKQLIEKVGGNLVGIVLNNIN--
A0A2A2R174      DNAPINAVSDALMIVKEAQTVCLVANARKTSYRAVLRALEMLRRAGAKPSGVVLNFLP--
A0A1H2DTI1      DTSPVMAADDATSLAPKIDGTIFVLRASMTSARAARNALDQLYHRQVNVLGLVLNSVN--
A0A1H1MGC9      DTPPLAAVSDALIILPLLDGSLFTIFFNRVRRKAAQFSARKLLEVNVPCFGAVLNGLN--
A0A1V5L462      DTAPILAVDDTIGLLRRADDVIFVVKSGQTNFRQVKISLERLSVTKTKVWGFVMNYVK--
A0A3D3LGD3      DSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQTVENVGGTVLGVVLNNVD--
A0A350ARX4      DAPPILAVNDTIGLSNKTDSMMFVVRASQTSTRQVQSSLERLSSRTSKIMGLVFNCAP--
B5JIS2          DTPPVGLYPDALIFAKSVGETLLVARESKAPISQIRQVIGDIDSTGAPVLGLVLNDYSFG
A0A7Y1UGD7      DTAPLLAVPDSRILAPFADNLVVVARAEMTPRGAVKRAVQVLESSGVSPSGIVLNGYV--
A0A2E5K4P7      DSPPLAAVSDALNIVPFVDGILFVVKYNTVKRNTASLTVRKLAEAGKPIFGVILNNMA--
A0A842HH73      DSPPIGAVSDVLTILPHADGIIYVIKFNAVKRRTAKANLRRIIESNTPVFGAVLNQIS--
A0A2E6NAH3      DSPPLAAVSDALNLLPMVDGILYVIKFNTVKRKTAVINVRRLWESNTPVYGAILNNIT--
A0A2A5VZA5      DSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRRLWESNTPVFGAILNNIT--
A0A424R295      DSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRRLWESNTPVFGAILNNIT--
A0A1H2GQN6      DSPPALGVSDASVIAHEVDKVVMVIQHRRYPREISIRTKKAIEEVQGNLVGVALNSVA--
A0A858RDL7      DTAPLLSVPDTRILLPLVNNACLVVRAEYTRKKAFERALSIFDEDRSSLSGVVVNAYR--
A0A512M3Y3      DTPPLLGLADSIMVSKCVDGAIFVIRAEQTTQRDIATAMEVLVGTRTPIYGFVLNGVD--
A0A4P5R5J1      DSPPVMAADDVLSLSPKIDGTIFVVRFSTSSARRSRTAINLLVQRQANLLGIVCNDVR--
A0A4P5YK43      DCPPITAIDDTFCLIPITDGLLFVVKSGQTSMRFAKSALGALRHRGAEILGVVLNGIT--
A0A2A2RPW6      DNAPVNAVSDTLLICKEAQTICLVMHSRRTPVRVVSRALEMLRRAGGKPSGVVLNFLP--
B1ZT68          DTPPVAVFPDALLLSRYCKELIFVCKYGSVRLNSVRKTLARVHETGIKVLGLVINQMP--
W0J7C2          DTPPAAVFPDALMLARCCHEMIYVCRYRTVRPAIIRKVIDRFHGTGISLLGVVLNRLP--
B4D1I7          DSSPVMAADDTTSLAPKADAAVFVFRFTSSSTRASRKALELLRERQTNVIGIVCNDVS--
A0A353F286      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD--
A0A354FSA6      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD--
A0A3B9GA54      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD--
A0A520LEH8      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD--
A0A6B2M0T8      DTAPAGLFPDAGLIGNYAQNFIFLTQLNKHRKATLKAILGRLSQSKAEILGVVVNKVS--
A0A2D7B7R6      DSAPLGPIGDTLSVARLADMLCLVVRSGKTTSKVVLRIIDYLHRHGHTPSGIVLNFLR--
A0A353DCA1      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLLRVKQAVENVGGQVIGVVLNNVD--
A0A7C5H7K5      DSVPVLVSDDAGSLGPKIDGVIFVVRSGTTSARLAKAALDQLNVRGAKVLGLVLNALR--
A0A7V3QF58      DSVPVLVSDDAASLGPKMDGVIFVLRSETTSARLAKAALDQLNVRGTKILGLVLNALR--
A0A832FWF3      DSVPVLVSDDAASLGPKMDGVIFVLRSETTSARLAKAALDQLNVRGTKILGLVLNALR--
A0A838YJR8      DSPPILGVSDASVISSEVDLTIIVIQHRKLPRGMLLRVKQAIQNVGGTALGVVLNNVD--
A0A6N4WVA3      DTAPILATDDTSGFAGKVDAVLFTIRCAYTQVRQIKPAMARLRERNIDVSGLILNYVD--
A0A0R2XPB1      DTAPILATDDTCGFAAKMDAVLFTIRCAHTQVRQIKPAMARLRERKIDISGLILNYVD--
A0A348NQP1      DTAPILATDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMARLRERNIEISGLILNFVD--
A0A357FV58      DTAPILATDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMARLRERNIEISGLILNFVD--
A0A2G4GZN8      DSPPIGAVSDALHILPKTDGVIYVVRYNVVNARNAVSCISRLRDAHAPILGVVLNSMS--
A0A348NPT1      DSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNIS--
A0A2E1KV60      DSPPLAAVSDALNVVPYIDAVLFVIKYDSVKKSLVNSCVRRLWESKKPVLGAILNNVS--
A0A2D7F4D9      DSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRRLWESKTPLLGAVLNNVS--
A0A3R7RBR8      DSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRRLWESKTPLLGAVLNNVS--
A0A2E0NH28      DSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRRLWESNTPVFGSVLNNVS--
A0A368BGT4      DSPPLAAVSDALNLLPLVDGVIYIIKFNTVKRKTAVLNVRRLWESNTPVFGAILNNIT--
A0A317ZP96      DTPPLAAVSDALNLLPLVDGILYVIKFNTVKRKTAVVNVRRLWESNTPVFGAVLNNIT--
A0A350AS32      DSPPLAAVSDALNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPVFGAILNNIT--
A0A7W8DI01      DTPPLLGLADSLLISKVVDGLIFVIRADQTTQRDVATASEILHQAGAPVYGFVLNCVN--
A0A6N6PLV8      DSPPILGLSDGAVLASEVDVTIMVVQHRRFPRAMLQRVKQAVLGVGGRLIGVVLNNVD--
A0A290QE54      DSPPMGAVTDSLLIAERTDEVVYVCRFNKAYRKHIKLYIRALHNGKNDILGIVLNGLS--
A0A1H1SWX2      DSPPMGAVTDSLLIAERTDEVIYVCRFNRAYRKHIRLYIKQLKESKNELLGIVLNGLS--
A0A1D8AZK8      DSPPMGAVTDSLLISERTDEIIYVCRFNRAYRKHIRLYIKQLRESKNELLGIVLNGLS--
A0A4Q1C9I5      DSPPMGAVTDSLLISERTDEVIYVCRFNRAYRKHIRLYIKQLRESKNELLGVVLNGLS--
A0A842HCC8      DCPPVLATDDTPSLATKADAVLFIIRSTYTRTRQIKSAVDTLELRGTKIRGFVLNFVD--
A0A1G3ZL71      DSPPLGAVTDSLLIAEQTDEVIYVCRFNRALRKHIKVFVRTLREGKNAFLGIVLNGLT--
A0A556QP09      DSPPLGAVTDSLLIAERVDEVIYVCRFNRAFRKHIRLYIKALRSGKNEILGVVLNGLS--
A0A2T6DX88      DSPPMGAVTDAMLVAERTDEVVYVCRFNHAARKHIRLYIRALQSGKNEILGIVMNGMS--
A0A2T6CWI7      DSPPLGAVTDSVLIAERVDEIVYVCRFNRAYRKHIRLYMRTLRQGKNEVLGIVLNGLS--
A0A3E1E5C8      DSPPLGAVTDSLLIAERTDEVIYVCRFNCAAKKHVRLYMKTLRNGKNEVLGVVLNGLS--
B1ZZ74          DSPPLGAVTDSMLIAERTDEIIYVCRFNRAYRKHIRLYMKALRDAKNEVLGVVLNGLS--
A0A2E0V4K6      DTAPVLAVPDTRIILPQADNRCLVIRANVVPKPAVFRAIDLLEEDGVKLAGVVMNGYR--
A0A7W1VQ11      DTPPVLGLAETSIIQRLADGVVFVIWGGFTPMRNVKSAIQSLEMNGTKFLGFVLNRLD--
A0A2V6F9Q9      DSSPVLAADDTTSLAPKVDATLLVVRLSHTSARLTKKALELLYSRQVNVPGIILNFVD--
A0A2V6NZZ3      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVGVPGVILNCVD--
A0A2V6EBU2      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVGVPGVILNCVD--
A0A2V6EY06      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVGVPGVILNCVD--
A0A2V6ME53      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVNVPGVILNFVD--
A0A538NUU0      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVNVPGVILNFVD--
A0A2V6NIJ1      DSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYSRQVNVPGIILNYVD--
A0A2V6C292      DSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKAFELLYSRQVNVPGVILNFVD--
A0A2V6D2X0      DSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKAFELLYSRQVNVPGVILNFVD--
A0A2V5ZUK1      DSSPVLAADDTTSLAPKIDATLFVVRLAYTSARLTKKALELLYSRQVNVPGVILNFVD--
A0A7W1MVB5      DSSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYNRQVNVPGVILNYVD--
A0A7W1U7H7      DSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALELLYNRQVNVPGVILNYVD--
A0A2V5XFN9      DTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVNVPGVILNFVD--
A0A2V6EZC8      DTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVNVPGVILNFVD--
A0A2V6I7Z5      DTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVNVPGVILNFVD--
A0A3B9LCP2      DSPPVLAADDTTSFAPKIDATLFVVRLSHTSARLARKGLELLYDRQVNVPGIILNFVD--
A0A3C0R669      DSPPVLAADDTTSFAPKIDATLFVVRLSHTSARLARKGLELLYDRQVNVPGIILNFVD--
A0A2V6EID2      DSSPVLAADDTASLAPKIDATLFVVRLSYTSARLIRKGLELLYGRQVNVPGIILNFVD--
A0A2V6MHB0      DSSPVLAADDTASLAPKIDATLFVVRLSYTSARLIRKGLELLYGRQVNVPGIILNFVD--
A0A7V9V4N8      DSSPVLAADDTTSLAPKIDATLFVVRLSHTSARLTRKSLELLYNRQVNVPGVILNYVD--
A0A838I5D7      DSSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKSLELLYNRQVNVPGVILNYVD--
A0A2W5YWL9      DSSPVLAADDTTSLAPKIDATLFVVRLGYTSARLTRKALELLYSRQVNVAGVILNYVD--
A0A2V5NH62      DSSPVLAADDSTSLAPKIDATLFVVRLSYTSARLTRKSLELLYNRQVNVPGVILNYVD--
A0A2W6A620      DSSPVLAADDSTSLAPKIDATLFVVRLSYTSARLTRKSLELLYNRQVNVPGVILNYVD--
A0A2V5PIJ4      DSAPVLAADDATSLAPKIDATLFVVRLSHTSARLTRKSLELLYNRQVNVPGVILNQVD--
A0A2V6K2G8      DSSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYNRQVNVPGVILNFVD--
A0A2V5W206      DSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALELLYGRQVNIPGVILNFVD--
A0A2V6MW77      DSSPVLAADDTTSIAPKIDATIFVVRLSYTSARLTKKALELLYGRQVNIPGVILNFVD--
A0A838MZM0      DSSPVLAADDTTSLAPKIDATLFVVRLSSTSARLTKKSLELLYNRQVNVPGVILNYVD--
A0A838DHH0      DSSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKSLELLYNRQVNVPGVILNYVD--
A0A838FJZ1      DSSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKSLDLLYNRQVNVPGVILNYVD--
A0A0E3YV65      DTPPAGVFSDAMVLAEQAGELVFVVRYNYTSRPGVRRLIETFKRSQIDLAGIVLNRMP--
W0J900          DTPPAGIFPDALSLAPFANELIYVVRFNYVSRPQVHRVTERLRSTGLELPGIVLNMMP--
B4CZV9          DTPPVLGLSETSIMQSLVDGVLFVIWTGQTPVRCVKSAIETLRANRANFYGFVLNRLD--
A0A7X1AX64      DSPPVGAVSDTLCLLPLIDGVVFVLKFNDVKKKAAKSAVKHLNESETPVFGAVMNAIS--
A0A3B9FM17      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLP--
A0A7W7YGS1      DTPPVLGLSETAFLQHHADGIVVIVRCGHTLRKDVEDAVQSLKKLGGHFYGFVLNGVD--
A0A2D7WMI4      DSPPIGLFPDALAFSKIADDIIFVTRYGKVARRVAKNLLYSIEESGTNILGVVLNDLP--
A0A2D6VHX5      DSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGDLKATGANILGVILNDLP--
A0A2D8I214      DSPPIGLFPDSLAIARKVDDVLFVTRYGKVSRKIAKNLVENLEETGVNVLGVVLNDLP--
A0A1Z8VL41      DSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIENIEETGANILGVVLNDLP--
A0A2E6TNA4      DSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIENIEETGANILGVVLNDLP--
A0A1Z8RG47      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLP--
A0A1Z8RJJ5      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLP--
A0A2D7V631      DSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLP--
A0A354RA24      DSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLP--
A0A2E9RV62      DSPPIGLFPDSLAMARKVDEVIFVTRYGKVARKVAKNLIESLEETGANMLGVVLNDLP--
A0A2E4AY96      DSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSNLEESGSNILGVVLNDLP--
A0A3B9B9P4      DSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSNLEESGSNILGVVLNDLP--
A0A2D5Y6N6      DSPPIGLFPDSLAMARKVEEVLFVTRYGKVSRKIAKSLLENLDETGAKILGVVLNDLP--
A0A2E7HSS8      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVVKSLIASIKETGANLLGVVLNDLP--
A0A2D8VCK3      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLP--
A0A350QVY4      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLP--
A0A2E4ZYR7      DSPPVGLFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLMRMDETGANTLGVVLNDLP--
A0A2E6TCV1      DSPPLALFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLTRVDETGANILGVVLNDLP--
R7E4L8          DGCPYEAVADASLMARHADLVLYVIRCGMIEKQYVPVIQGLADKGEFRSGAVILNAEN--
A0A4P6PCA7      DTPPIGPVGDGVILASYVDSVIVVSRVGKTKMRGLKTMLSRLLEVDALVLGCIANDVP--
A0A2T6DSN5      DTPPSAVFPDALLLSRFCSEMVYVCRFKTVRKALIKKTLHKFAESGIHVLGVVLNCVP--
A0A317ZIW7      DTAPILATDDTTSFAPFVDAVLFTVRCSYTHLRQIKPAIARLKERSTNVDGIILNYVD--
A0A7C4PPT4      DTPPVLGLSETAMLQRLVDGVVLVVWCGRTPARYVKSAVEILQANHANFYGFVLNRLD--
A0A7C4QZX4      DTPPVLGLSETAMMQKHVDGVVLVVWCGRTPANYVKSAVETLQANHANLYGFVLNRLD--
A0A3C1AXQ2      DSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLMRVKQTVENVGGTVLGVVLNNVD--
A0A3D4HHL8      DLPPVLATDDTPGFVQKVDGVLFVVRSNTTRVKQAKSAFHILMFRRAKILGIVLNAFD--
A0A366HV03      DTPPVLGLSETTNLQRVADAVVLVVKAEKTHGRDVTEAVEQLMRAGAPMAGFVLNNID--
A0A6G6K911      DTPPVLGLSETTNLQRVADAVVLVVKAEKTHGRDVTEAIEQLMRAGAPMAGFVLNNID--
A0A832HT83      DTPPVLGLSEASMMQRIVDGVVLVIWSGRTPQRYVKSAIEILQANHAHFYGFVLNRLD--
A0A5R8KAF2      DTPPVLGLSETAALRIVVDGVIMVVRAEKTTRRDVSDAVALLRKTDAHFFGMVLNDLD--
A0A7C4LRZ6      DCPPLTAIDDTFALLNLSDGVLFVVRAGQTSMRFARNAIAAVHQRGARLFGVVLNGIT--
A0A351MR11      DSPPLGAVSDALHLVPKVDGVIYVVRFNLVKKRNAMSCIARLREAGVPIVGAVLNSMA--
A0A388PR45      DSPPIGAVSDALHLIPKVDGVVYVVRFNVVSARNAAACLARLRDAGAPMLCAVLNQMS--
A0A388QR61      DSPPIGAVSDALHLIPKADGVVYVVRFNVVSARNAAACIGRLREAGVPMLCAVLNQMS--
A0A4P5YHI0      DSPPIGAVSDALHLIPKADGVVYVVRFNVVSARNAAACIGRLREAGVPMLCAVLNQMS--
A0A2A2RS01      DSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGRLAETGVPILGAVLNRMS--
A0A2A2Y1A7      DSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGRLAETGVPILGAVLNRMS--
A0A388PDH9      DSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGACLARLAETGVPILGAVLNRMS--
A0A2G4H1E7      DSPPLGAVSDSLHLLPKVDGVIYIVRYNAVNLRHATSCLARLREAQAPLLGVILNAMS--
A0A2G4GZA6      DSPPIGAVSDALHLLPKVDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVVLNAMS--
A0A388P514      DSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVVLNAMS--
A0A2A2YG59      DSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVVLNAMS--
A0A2G4F7D5      DSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVVLNAMS--
A0A7V4IDX4      DSAPVMAADDVATLAPQTEGAVFVIRANYTSARIARAALDLLYQRRVNVLGLALNAVA--
A0A2V2SDN0      DSPPVLAADDAATLAPKVDGVLFVVRGSHTSARMVREGLDTLRQRRARVLGVIFNRAV--
A0A4Q3BVY2      DAPPVLGLSESSSLQKVVDGTVLVVRAEVTGRKDVLDALALLRRSQAHFFGFVLNAVD--
A0A8A7W4D3      DAPPCLGLSETTSLQQVVDGTVLVVRAETTGRKDVTDAISLLERANAHFFGFVLNAVD--
A0A3R8L982      DSPPLGAVSDSLLIAERTDEVLYVCRFNRALRKHIKLYIKALRAGKNEILGVVLNGLT--
A0A6N6QBS9      DCPPLTAIDDTFSIAAFLDGLFFVVRAGKTSMRFAKMGINTVQQRGAPILGLIVNGVP--
A0A2V5X6Z6      DTPPVLAADDAATLAPKVDGVLFVVRGSFTSARMARGALDALRQRRVHVLGLIFNRAA--
A0A2V5VGZ7      DTPPVLATDDAGSLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVRVLGLIFNRTV--
A0A2V5U130      DTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVHVLGLIFNRAA--
A0A2V6C237      DTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVRVLGLIFNRTV--
A0A2E7HPU9      DSAPLLAVPDTRLLVPEVDNFCLVVRAEHTPKGAVAKCLDMLRDDDNEPAGIVVNDYQ--
D5EML0          DTPPIGLFSDATIVADSADSCVMVARQFAVKRTKFQHSVNQMERSTAPVVGVVFNGIKDV
A0A1V6GL40      DTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVRLLGLVFNAVR--
A0A7X7VL75      DTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVRLLGLVFNAVR--
A0A7C4PPJ4      DCPPLTAIDDTFALASHADGMLFVVRAGKTSMRFARNALNAVQQRGARLFGIVLNGIT--
A0A3C1C1M3      DVPPLGIVSDALSLAHLSDCVLVMARPATSRKRAVRHTIQRFQAAGMANLAVVMNDVE--
A0A2S7U4L6      DSPPILGVSDASVISSEVDLTMIVVQHRKLPRNMLVRVKQAVENVGGTVLGVVLNNVD--
A0A2E9EYJ1      DSPPILGVSDASVISSXVDLTIIVIQHRKLPRGMLXRVKQAIQNVGGTAXGVVLNNVD--
A0A258AXR6      DSPPILGVSDASVLANLADMTMIVVQHRKLPRHMLMRVKQGVENVGGKVVGVVLNNVD--
A0A7W7YD86      DSPPILGVSDASVLANLADMTMIVVQHRKLPRHMLMRVKQSVENVGGKVVGVVLNNVD--
A0A3D3NZQ6      DSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQTVENVGGTVLGVVLNNVD--
A0A1T4WVZ9      DAPPILGVSDASVLANEADLTIIVVQHRKLPRHMLLRVKQTIENVGGTVLGVVLNNVD--
A0A4R7SSI6      DSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLLRVKQTVENVGGTVLGVVLNNVD--
A0A7W8DNH5      DSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLLRVKQTVENVGGNVLGVVLNNVD--
A0A4Q3AQI1      DTPPVLGLSDTSVMQSQVDGVLFVIWSAHTPIRTMKAAVEMLQTNGANFYGFVLNRLD--
A0A6N2CMN7      DSPPLAAVSDALNLLPLVDGIIYVIKFNTVKRKTAVVNVRRLWESNTPVFGAILNNIS--
A0A432FAS4      DCPPVSAVSDPLMIAAATDGIIFVSKFNKVRREHARKTVQRIQDAGIYIAGICINDLD--
A0A660Q3A0      DCPPVLAVSEAAILCTLVDGVIFVVWAGQTSRKLSQLAVQTLRERGANILGCVLNNLD--
A0A849Y855      DTPPVLATDDTLSMGPSLDGIIFVVKANQTSLRFVNRSMHLLKQRGAKIFGLVLNQID--
A0A2D5W0Q9      DCPPVSAVSDPLMVGARTDGMVFVSKFNKIRREHARKTVQRIQDAGIYILGTVINDID--
A0A857ZXX2      DSPPYGILADTAILASHADISLYVIRSNRIDKRHIATVQQLAESGQLPNMGFVINAVD--
A0A7V6ECG3      DSPPLASIDDTFSIAGYSDGVLFVVKAGHTGMRFAKSALNSIQRRGAHVLGLVLNGIT--
A0A1Z9KB52      DSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGDLKATGANILGVILNDLP--
A0A7C5CZ90      DSPPIIGVSDAAILASEVDMTIQVIQYRRYPQPMYLRAKQIIEKVGGNLVGIVLNNIN--
A0A257LYL4      DSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLMRVKQAVENVGGHVIGVVLNNVD--
A0A4Q2XXY1      DSPPILGVSDASVLASEVDLTMIVIQHRKLPRTMLMRVKQAIENVGGNLLGVVLNNVD--
A0A4P6PD26      DTPPLVGISDSSIIAKETDGAIIVVQYRKYPRDMLVKAKAMIETLGVNVVGAVLNNIN--
A0A1Z8SVB5      DSPPAGLFPDSIALARKTDEVLFVTRYGKVSRHVVKRLIGDLKITGANILGVILNDLP--
A0A2V5W3Y0      DSSPVLAADDSTSLAPKIDATLFVVWLSYTSARLVRKSLELLYNRQVNVPGIILNYVD--
                *  *     :   .                                        *     

A0A2V5U7A0      -------NVEDPDYAYY-------------------------RH-------------YYG
A0A3D4CZT6      -------VRSDSQYQYY-------------------------TS-------------YYT
A0A4V1S9Q4      -------VRSDSQYQYY-------------------------TS-------------YYT
A0A355VK99      -------FKSASYSYYG-------------------------YG-------------YGY
A0A2V6N5E0      -------DTSLPEY-YY-------------------------YQ-------------YSE
A0A2V6NH44      -------DTSLPEY-YY-------------------------YQ-------------YSE
A0A3D0IZR7      -------IKTDDNYYYY-------------------------AG-------------YST
A0A520LRZ3      -------VRSDNQYQYY-------------------------TS-------------YYT
A0A356FSV4      -------STALSSY-YY-------------------------SH-------------YSD
A0A3D3DET9      -------PSSED-Y-YY-------------------------YR-------------YKD
A0A355SVK9      -------SSTLSSY-YY-------------------------YS-------------YSD
A0A2E5D7I3      -------ETRRLXG-YN-------------------------YS-------------YGS
A0A2V5NYE2      -------PSSVDYY-YY-------------------------YK-------------YKD
A0A353DI77      -----ENRLQGGKYGYG-------------------------YG-------------YGH
A0A2V6FIP7      -------FEGKDSYYYN-------------------------YY-------------YYQ
A0A3C1UJT2      -----NNNNKGSYYYYY-------------------------SSDKDKT--------YSK
A0A258AXL1      ------LRRLENNYYYG-------------------------HY-------------YSR
A0A2V5UAD5      -------ASARSHYY---------------------------------------------
A0A7Y4QK88      -------ASARSYRYYK----------------------------------------YPD
A0A1V6GCZ3      ------MSQDESYYYYS-------------------------GY-------------YHD
A0A7V3WMH6      ------MASDENYYYYS-------------------------GY-------------Y--
A0A2S7U0Z3      --------RTGGSNYLG-------------------------YKGHGEYGGEE----YGY
A0A2E6T1E0      -------FEGKDSYYYS-------------------------YY-------------YYQ
A0A5E6MKA7      -------TSARSYYAYH-------------------------YA-------------YRL
A0A7W1HKQ4      -------LKHDQNYYY-----------------------------------------YTS
A0A6B3L936      -------ARHSGSGYFG-------------------------YRDYGE---------YGH
A0A2N8IR72      -------FKSASYSYYG-------------------------YG-------------YGY
A0A2N8IV96      -------ITSDHQYQYY-------------------------TT-------------YYS
R7E1V8          -------ITSDHQYQYY-------------------------TT-------------YYS
A0A2E0R252      ----RTRTKGAYGYYYS-------------------------YYGGGN---------YAN
A0A3E1EF48      ----RVAGRGAYGYYYG-------------------------YHGGGA---------IDG
A0A2A2PVG8      ----QTRTAGAHGYYYS-------------------------YSSGGS---------YSG
A0A2E0R421      ----VAKTKTGHDYYYS-------------------------YPGSGS---------YGS
A0A2E5EJ69      ------EKRRAGYNYYY-------------------------YTDKK----------YYG
A0A2G4I5Z5      -------QSAGSGYYYY-------------------------YS-------------GNK
A0A4P5QQV6      -------ESLQDYYYYR-------------------------YSEY-----------Y--
A0A2E7ALI1      RRLXGXXYSYGSYRYGK-------------------------YGYSQYG--------YGG
A0A178IDB9      ------HASIMNYGYDG-------------------------YGAYGSDY-------YKA
A0A290QD69      ------HASVMNYGYDG-------------------------YGAYKADY-------YKS
A0A6N6ZC77      -------VKGSDYYYYK-------------------------KYND-----------YYA
A0A832M896      -------TNLPDYYHYQ-------------------------YYRS-----------YYD
A0A538NJ59      -------ASARSHYY---------------------------------------------
A0A2A2R3V9      -------TNLPEYYYY--------------------------QYKE-----------YYN
A0A3C1VFY9      -------MSVGGYYNYY-------------------------RYQD-----------YYS
A0A2V2SMX4      -------PTTAD-YYYS-------------------------KYSE-----------YYR
A0A522AC27      -------TGSGDYYYYY-------------------------RYKD-----------YYK
A0A6M1RFD0      -------PRTGEYYYYS-------------------------RYKD-----------YYH
A0A7C3HXH0      -------PRTGEYYYYS-------------------------RYKD-----------YYH
A0A432FDF6      -------ISQDSYYYY-----------------------------------------YSG
A0A2E7VDS1      ------EKKTPGYYYAG-------------------------YYGYG----------YFR
A0A7C8D3W3      -------PDNPSYYYTY-------------------------Y--------------YHA
A0A178IFJ2      ------SGRGSAAYYSG-------------------------YG-------------YYG
A0A357FSP9      -------STLASYYYSS-------------------------YSDKA----------YQD
A0A1T4WWY4      ------FSKRVNHYYYY-------------------------Y--------------YSA
A0A3D3LEQ6      ------FSKRSNHYDYY-------------------------Y--------------YSS
A0A3D3NW23      ------FSKRSNHYDYY-------------------------Y--------------YSS
A0A522ACN3      ------MSQDESYYYYS-------------------------GY-------------YHD
A0A2A2R174      -------QSAGSGYYYY-------------------------YS-------------GNK
A0A1H2DTI1      -------ALLPDYYYY-----------------------------------------YRY
A0A1H1MGC9      -------LAVSGYYYAQ-------------------------YYDKS----------YKD
A0A1V5L462      -------AGGNDYYYYG-------------------------R--------------YKS
A0A3D3LGD3      -------LRADSQYQYY-------------------------TN-------------YYT
A0A350ARX4      -------ATGVDYYYN-----------------------------------------YRH
B5JIS2          SLNPRLAYGGKGKYKY-----------------------------------------HNN
A0A7Y1UGD7      -EKRFAMARNHSYGYYR-------------------------YGRYG----------LYH
A0A2E5K4P7      -------SKSAEYYYSE-------------------------YYTGQ----------YKK
A0A842HH73      -------VAVASYYYAN-------------------------YYDKS----------YQD
A0A2E6NAH3      -------SVLSSYYYSN-------------------------YSDKA----------YQD
A0A2A5VZA5      -------TSLSSYYYSQ-------------------------YTDKA----------YQD
A0A424R295      -------TSLSSYYYSQ-------------------------YTDKA----------YQD
A0A1H2GQN6      -------TNSDEGYYYY-------------------------GA-------------YAD
A0A858RDL7      ----EKRRLMGENFSYG-------------------------YYGSDGSGG------YGA
A0A512M3Y3      ------LSRMENYYYYS-------------------------SY-------------YPK
A0A4P5R5J1      -------LAESEYGYGN----------------------------------------YYQ
A0A4P5YK43      -------SDNPHYYYNN-------------------------Y--------------YHA
A0A2A2RPW6      -------GSAGAGYYYY-------------------------YS-------------GNK
B1ZT68          ------ESRFRASGYEG-------------------------YGAYGQDY-------YQA
W0J7C2          ------QSKARSYGYHG-------------------------YGTQSAAY-------YKA
B4D1I7          -------EAMQDYYYYR-------------------------YPDY-----------YAT
A0A353F286      -------VRSDSQYQYY-------------------------TS-------------YYT
A0A354FSA6      -------VRSDSQYQYY-------------------------TS-------------YYT
A0A3B9GA54      -------VRSDSQYQYY-------------------------TS-------------YYT
A0A520LEH8      -------VRSDSQYQYY-------------------------TS-------------YYT
A0A6B2M0T8      --------RSKSRNLGT-------------------------YK-------------YVD
A0A2D7B7R6      -----NNNNKGSYYYYY-------------------------SSDKDKT--------YSK
A0A353DCA1      -------VRSDSQYQYY-------------------------TS-------------YYT
A0A7C5H7K5      -------PTMGGYHYY-----------------------------------------YRK
A0A7V3QF58      -------PTMGGYHYY-----------------------------------------YRK
A0A832FWF3      -------PTMGGYHYY-----------------------------------------YRK
A0A838YJR8      -------VRSDNQYQYY-------------------------TS-------------YYT
A0A6N4WVA3      -------AMQPGYYYYK-------------------------YSEY-----------YTD
A0A0R2XPB1      -------TTQPGYYYYK-------------------------YSEY-----------YTD
A0A348NQP1      -------TTQPGYYYYK-------------------------YSEY-----------YTD
A0A357FV58      -------TTQPGYYYYK-------------------------YSEY-----------YTD
A0A2G4GZN8      -------IRMASAYTDT----------------------------------------YDS
A0A348NPT1      -------STLASYYYSS----------------------------------------YSD
A0A2E1KV60      -------SGLSSYYYSQ----------------------------------------YSS
A0A2D7F4D9      -------LGLSHYYYSQ----------------------------------------YSA
A0A3R7RBR8      -------LGLSHYYYSQ----------------------------------------YSA
A0A2E0NH28      -------TALSSYYYSH----------------------------------------YSD
A0A368BGT4      -------SSLSSYYYSN----------------------------------------YSD
A0A317ZP96      -------STLSSYYYSQ----------------------------------------YSD
A0A350AS32      -------STLSSYYYSH----------------------------------------YSD
A0A7W8DI01      ------LKNLENYYYYG-------------------------T--------------YYS
A0A6N6PLV8      -------AKHDDGYSYY-------------------------NS-------------YNE
A0A290QE54      -------TRRIEYYSN-----------------------------------------YRY
A0A1H1SWX2      -------PRRIEYYSN-----------------------------------------YRY
A0A1D8AZK8      -------PRRIEYYSN-----------------------------------------YRY
A0A4Q1C9I5      -------PRRIEYYSN-----------------------------------------YRY
A0A842HCC8      -------NREPNHYYYK-------------------------YYD------------YYS
A0A1G3ZL71      -------ARRIAYYTN-----------------------------------------YRY
A0A556QP09      -------PRRIEYYSN-----------------------------------------YRY
A0A2T6DX88      -------TRRIEYYSN-----------------------------------------YRY
A0A2T6CWI7      -------PRRIEYYSN-----------------------------------------YRY
A0A3E1E5C8      -------PRRIEYYSN-----------------------------------------YRY
B1ZZ74          -------PRRIEYYSN-----------------------------------------YRY
A0A2E0V4K6      ------ESRRLLGYNYS-------------------------YGAYRTGRYGYRQYGYGG
A0A7W1VQ11      ------------------------------------------FHALGNR--------YKY
A0A2V6F9Q9      -------TSLPEYYYYQ-------------------------YSEY-----------YNR
A0A2V6NZZ3      -------TSLPEYYYYQ-------------------------YSEY-----------YNR
A0A2V6EBU2      -------TSLPEYYYYQ-------------------------YSEY-----------YNR
A0A2V6EY06      -------TSLPEYYYYQ-------------------------YSEY-----------YNR
A0A2V6ME53      -------TSLPEYYYYQ-------------------------YSEY-----------YNR
A0A538NUU0      -------TSLPEYYYYQ-------------------------YSEY-----------YNR
A0A2V6NIJ1      -------TSLPEYYYYQ-------------------------YSEY-----------YNR
A0A2V6C292      -------TSLPEYYYYQ-------------------------YSEY-----------YNR
A0A2V6D2X0      -------TSLPEYYYYQ-------------------------YS----------------
A0A2V5ZUK1      -------TSLPEYYYYQ-------------------------YSEY-----------YST
A0A7W1MVB5      -------TSLPEYYYYQ-------------------------YAEY-----------YNT
A0A7W1U7H7      -------TSLPEYYYYQ-------------------------YAEY-----------YNT
A0A2V5XFN9      -------TSLPEYYYYQ-------------------------YSEY-----------YST
A0A2V6EZC8      -------TSLPEYYYYQ-------------------------YSEY-----------YST
A0A2V6I7Z5      -------TSLPEYYYYQ-------------------------YSEY-----------YST
A0A3B9LCP2      -------TSLPEYYYYQ-------------------------YSEY-----------YNA
A0A3C0R669      -------TSLPEYYYYQ-------------------------YSEY-----------YNA
A0A2V6EID2      -------TSLPEYYYYQ-------------------------YAEY-----------YNP
A0A2V6MHB0      -------TSLPEYYYYQ-------------------------YAEY-----------YNP
A0A7V9V4N8      -------TSLPEYYYYQ-------------------------YSEY-----------YNT
A0A838I5D7      -------TSLPEYYYYQ-------------------------YSEY-----------YNT
A0A2W5YWL9      -------TSLPEYYYYQ-------------------------YSEY-----------YNT
A0A2V5NH62      -------TSLPEYYYYQ-------------------------YSEY-----------YNT
A0A2W6A620      -------TSLPEYYYYQ-------------------------YSEY-----------YNT
A0A2V5PIJ4      -------TSLSEYYYYQ-------------------------YAEY-----------YNT
A0A2V6K2G8      -------TSLPEYYYYQ-------------------------YSEY-----------YST
A0A2V5W206      -------TSLPEYYYYQ-------------------------YSEY-----------YST
A0A2V6MW77      -------TSLPEYYYYQ-------------------------YSEY-----------YST
A0A838MZM0      -------TSLPEYYYYQ-------------------------YAEY-----------YNT
A0A838DHH0      -------TSLPEYYYYQ-------------------------YSEY-----------YNT
A0A838FJZ1      -------TSLPEYYYYQ-------------------------YSEY-----------YNT
A0A0E3YV65      ------AGTHSDAYYSS-------------------------YG-------------HYG
W0J900          ------SGRGSSGYYSG-------------------------YG-------------YYG
B4CZV9          -------LNATQNYYQY-------------------------Y--------------YYS
A0A7X1AX64      -------AKMSNYYYSH----------------------------------------YYD
A0A3B9FM17      ------QKKTPGYYYSG-------------------------YYGYG----------YFR
A0A7W7YGS1      ------------------------------------------FTKRANH--------YYY
A0A2D7WMI4      ------QKRSTGYYYSG-------------------------Y--YGYG--------YYR
A0A2D6VHX5      ------SKKATGYYYSG-------------------------Y--YGYG--------YYR
A0A2D8I214      ------QKKAPGYYYSG-------------------------Y--YGYG--------YFR
A0A1Z8VL41      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A2E6TNA4      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A1Z8RG47      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A1Z8RJJ5      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A2D7V631      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A354RA24      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A2E9RV62      ------EKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A2E4AY96      ------SKKSTGYYYSG-------------------------YYGYGYG--------YYR
A0A3B9B9P4      ------SKKSTGYYYSG-------------------------YYGYGYG--------YYR
A0A2D5Y6N6      ------QKKAPGYYYSG-------------------------Y--YGYG--------YFR
A0A2E7HSS8      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A2D8VCK3      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A350QVY4      ------QKKTPGYYYSG-------------------------Y--YGYG--------YFR
A0A2E4ZYR7      ------EKKTPGYYYAG-------------------------Y--YGYG--------YFR
A0A2E6TCV1      ------EKKTPGYYYAG-------------------------Y--YGYG--------YFR
R7E4L8          --------FKNSRFHY-----------------------------------------YDE
A0A4P6PCA7      -YSLAGKFSGAEGYGYG-------------------------HS-------------YKS
A0A2T6DSN5      ---------SSSVRNYG-------------------------YDGYGSY--------ESD
A0A317ZIW7      -------TAQPGYYYYR-------------------------YS---EY-----------
A0A7C4PPT4      -------LSVTSNYYNY-------------------------YN---YY--------YYS
A0A7C4QZX4      -------LSVTSNYYNY-------------------------YN---YY--------YYS
A0A3C1AXQ2      -------LRSDSQYQY--------------------------YT---SY--------YTY
A0A3D4HHL8      -------VRGPGYYYHR-------------------------YG---EY--------YTR
A0A366HV03      -------MSKVSNYYYY-------------------------YYSSSYY--------YQA
A0A6G6K911      -------MSKVSNYYYY-------------------------YYSSSYY--------YQA
A0A832HT83      -------LSVTSNYYNY-------------------------YN---YY--------YYS
A0A5R8KAF2      ------------------------------------------LNKAKNY--------YNY
A0A7C4LRZ6      ---------ADNPYYY--------------------------YN---HY--------YHG
A0A351MR11      -------TRLAAFYTNS-------------------------YD---AS--------YSK
A0A388PR45      -------VRLASVYTDT-------------------------YD---PS--------AGK
A0A388QR61      -------VRMASVYTDT-------------------------YD---PT--------AGK
A0A4P5YHI0      -------VRMASVYTDT-------------------------YD---PT--------AGK
A0A2A2RS01      -------IRMASVYTDS-------------------------YD---PA--------NKK
A0A2A2Y1A7      -------IRMASVYTDS-------------------------YD---PA--------NKK
A0A388PDH9      -------IRMASVYTDS-------------------------YD---PA--------NKK
A0A2G4H1E7      -------LRMASAYTDS-------------------------YD---SS--------YRK
A0A2G4GZA6      -------LRMASAYTDT-------------------------YD---SS--------YRK
A0A388P514      -------LRMASAYTDT-------------------------YD---SS--------YRK
A0A2A2YG59      -------LRMASAYTDT-------------------------YD---SS--------YRK
A0A2G4F7D5      -------LRMASAYTDT-------------------------YD---SS--------YRK
A0A7V4IDX4      --------ADSSEYYY--------------------------YK-------------YKS
A0A2V2SDN0      ----------SSSFEY-------------------------------HH--------YQR
A0A4Q3BVY2      ------------------------------------------LSKLGNY--------YNY
A0A8A7W4D3      ------------------------------------------LSKIGNY--------YNY
A0A3R8L982      -------ARRIEYYSN-----------------------------------------YRY
A0A6N6QBS9      ---------IDNPYYYY-------------------------TT---YY--------YAS
A0A2V5X6Z6      ----------SSPCER-------------------------------QY--------YQR
A0A2V5VGZ7      ----------SSPYEH-------------------------------DY--------YQR
A0A2V5U130      ----------SSPYGH-------------------------------DY--------YQR
A0A2V6C237      ----------SSPYEH-------------------------------DY--------YQR
A0A2E7HPU9      -----ERGGFARKYLYK-------------------------YGGYGGYGGYGGYGGYGG
D5EML0          NAAVGFGRNGVSHYGYG-------------------------YEKDPEK--------YKA
A0A1V6GL40      -------PSSEDYYYYR-------------------------YK---DY--------YRP
A0A7X7VL75      -------PSSEDYYYYR-------------------------YK---DY--------YRP
A0A7C4PPJ4      ---------ADNPYYY--------------------------YN---YY--------YHG
A0A3C1C1M3      --------HSKFTYHS--------------------------YG---PY--------YH-
A0A2S7U4L6      -------LRSDSQYQY--------------------------YT---SY--------YT-
A0A2E9EYJ1      -------VRSDNXYQY--------------------------YT---SY--------YT-
A0A258AXR6      -------LRSDAQYQY--------------------------YT---SY--------YT-
A0A7W7YD86      -------LRSDAQYQY--------------------------YT---SY--------YT-
A0A3D3NZQ6      -------LRADSQYQY--------------------------YT---NY--------YT-
A0A1T4WVZ9      -------LRSDSQYQY--------------------------YT---SY--------YT-
A0A4R7SSI6      -------LRSDSQYQY--------------------------YT---SY--------YT-
A0A7W8DNH5      -------LRSDSQYQY--------------------------YT---SY--------YT-
A0A4Q3AQI1      -------LNATTNYYQY---------YYYSNDYY--------YHTQLENA----------
A0A6N2CMN7      -------GSLSSYYYSS---------YSDKAYQN--------YYIQHEEELEEELAAKVE
A0A432FAS4      -------FEGKDSYYYS---------YYYYQNR---------YYASHYKSDKPG------
A0A660Q3A0      -------FSRIGYYYYS---------TYY--G----------YYDYDYRY-PSG------
A0A849Y855      -------TTSAHYYYYY---------YYS--TY---------YYGRDAKR-KSG------
A0A2D5W0Q9      -------FEGKDSYYYS---------YYYYQNRYYAS-----YYSNEKKLGSKKGEGAKD
A0A857ZXX2      -------F-KSSSYSYY---------GYGY------------HYGNTSKNNPS-------
A0A7V6ECG3      ---------EDNPYYYY---------SHYYNV----------YYRATMPKGNGDFEKVDA
A0A1Z9KB52      -------SKKATGY-YY---------SGYYGYGYYRYKYYSKYYSPTEDT----------
A0A7C5CZ90      -------IAQDESYYYY---------SGYYHDYYY-------YYSRHDEEE--------S
A0A257LYL4      -------VRSDSQYQYY---------TSYYT-----------YYAPAESQSAAQLGPVAP
A0A4Q2XXY1      -------VRSDSQYQYY---------TSYYT-----------YYSPTNIEK-ARPRPAAS
A0A4P6PD26      -------VMRDDYYYYY---------HSYYSD----------YYHSSQSEVLDESGS---
A0A1Z8SVB5      -------SKKATGYYYSGYYGYGYYRYKYYSK----------YYSPDXA-----------
A0A2V5W3Y0      -------TSLPEYYYYQ------------YSE----------YYNTPLAVEEPDDVAAAH
                                                                            

A0A2V5U7A0      SDYGTVAA------------------------------------AENGNGGEHADVEVLM
A0A3D4CZT6      Y------Y------------------------------------APSADSDPVPTVGATA
A0A4V1S9Q4      Y------Y------------------------------------APAESQIGPPVAAATS
A0A355VK99      Q------Y------------------------------------GYGAKDPQQTARKRD-
A0A2V6N5E0      Y------Y------------------------------------STPTSVPDGEAVAPVR
A0A2V6NH44      Y------Y------------------------------------NRPVAPPESAAAV---
A0A3D0IZR7      Q----YGY------------------------------------KKRAPRAAQRSKATAT
A0A520LRZ3      Y------Y------------------------------------SPSNIDPNQKISSDKP
A0A356FSV4      KSYQDY-Y------------------------------------INNEDDFEDQLVESTA
A0A3D3DET9      Y------Y------------------------------------RPYPSGGTKAAESVRT
A0A355SVK9      KSYSDY-Y------------------------------------VHHDVESEQDLGKGAL
A0A2E5D7I3      YRYGKYGY------------------------------------SQYGYGGYGSYGSYGS
A0A2V5NYE2      Y------Y------------------------------------KAYPTSPSQSAATASP
A0A353DI77      YGDDT-------------------------------------------------------
A0A2V6FIP7      NRYYSSHY------------------------------------NPRPDKPLKDKSEEVK
A0A3C1UJT2      SGYQKKQV------------------------------------TNSPMEVGASAEDEPV
A0A258AXL1      YYEPTYYN------------------------------------NPKEGGEAA-------
A0A2V5UAD5      ------------------------------------------------------------
A0A7Y4QK88      YYATAKAV----------------------------------------------------
A0A1V6GCZ3      YYYRSEEQ------------------------------------E--------PVVKEGA
A0A7V3WMH6      YYSHSEDS------------------------------------DREEARESKRKSKSNS
A0A2S7U0Z3      YGGDK-------------------------------------------------------
A0A2E6T1E0      NRYYASHY------------------------------------KSDKSDSEHGKEEEFD
A0A5E6MKA7      PEEQKREQ------------------------------------SLKAPSQPS-------
A0A7W1HKQ4      YYGYYPTR------------------------------------GGERKSTRRGTRAATP
A0A6B3L936      DSYYGQED----------------------------------------------------
A0A2N8IR72      QYGYGTKE------------------------------------PQQTSRKQNK------
A0A2N8IV96      YYSADGAS------------------------------------SGENADASSMKKVERS
R7E1V8          YYSADGGS------------------------------------SGENADASSMKKAERS
A0A2E0R252      Y--SDAK-----------------------------------------------------
A0A3E1EF48      YVSNDSK-----------------------------------------------------
A0A2A2PVG8      YSSNEK------------------------------------------------------
A0A2E0R421      GNNSDTEKIKTTRVRVPLFQNILNLGSKMKDHDFFSKKQKRPRRRNRRRPSRR-------
A0A2E5EJ69      YGEDKR------------------------------------------------------
A0A2G4I5Z5      YYGQKGVY------------------------------------GASTPRS---------
A0A4P5QQV6      --------------------------------------------GSQKKDAGKKQAARA-
A0A2E7ALI1      YGSYGSYG------------------------------------SDDDED----------
A0A178IDB9      YQEEEAAAVK--------------------------------------------------
A0A290QD69      YQGEKAESK---------------------------------------------------
A0A6N6ZC77      PPSSGAGS----------------------------------------------------
A0A832M896      TPTET-------------------------------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A2A2R3V9      RGAKAS------------------------------------------------------
A0A3C1VFY9      THPGK-------------------------------------------------------
A0A2V2SMX4      TYPGKG------------------------------------------------------
A0A522AC27      PYPAKPA-----------------------------------------------------
A0A6M1RFD0      RSSRAKA-----------------------------------------------------
A0A7C3HXH0      RPSRARA-----------------------------------------------------
A0A432FDF6      YYYDYYYK------------------------------------SREKEESADEAQDGKK
A0A2E7VDS1      YKYYNKYY------------------------------------GENEPQEHGKAKAG--
A0A7C8D3W3      YYNKDLTEMPEEEPGDGPMKAPARTMAAPKKESSIEISIQAAARKKAEETRSPNDFPALA
A0A178IFJ2      SKHYSSYY------------------------------------KEGQLAARSG------
A0A357FSP9      YYISQDVE------------------------------------LEDELAGSVEPEMEPR
A0A1T4WWY4      SYYDANW----------------------------------------------DVKPAKK
A0A3D3LEQ6      NYYDSNW-------------------------------------EEEKEEREADERPGRK
A0A3D3NW23      NYYDSNWE------------------------------------EEEKEDREADERPGRK
A0A522ACN3      YYSKNEDS------------------------------------MTEGEHKGDAKKAKVE
A0A2A2R174      YYGQKGVY------------------------------------GATSSKG---------
A0A1H2DTI1      YEYYRPKD------------------------------------EVIEGAPGTPRRGKDG
A0A1H1MGC9      YYVTMAKQ------------------------------------DPGTVER---------
A0A1V5L462      YRYQHKES------------------------------------GDSGNEEIRKKTGRLS
A0A3D3LGD3      YYSPDNRP------------------------------------AAEGGKPKKRRKAAGE
A0A350ARX4      YDSYHQQP------------------------------------DAKQKRERS-------
B5JIS2          IKKHAKGA------------------------------------GRVKSKSMVGKLMAED
A0A7Y1UGD7      YEQDASVY------------------------------------GEDEEQA---------
A0A2E5K4P7      YYTSQGAP------------------------------------EVSLGETSNSHPKPAR
A0A842HH73      YYHTDDGE------------------------------------DVQVEGKGKKTKRAPI
A0A2E6NAH3      YYINQEEE---------------------------------------------LEEELVG
A0A2A5VZA5      YYIGQEDE---------------------------------------------MEDELAA
A0A424R295      YYIGQEDE---------------------------------------------MEDELAA
A0A1H2GQN6      YYNNPKNR------------------------------------KKKKKGSSLQPRPAPP
A0A858RDL7      YGAYGH--------------------------------------DDDDGDKPKKKTRKVR
A0A512M3Y3      YYDPSYVL------------------------------------QHADA-----------
A0A4P5R5J1      YSAYRENA------------------------------------DSEPLEPLPR------
A0A4P5YK43      YYGKQAQH------------------------------------AATAPTPIPAAVHRAT
A0A2A2RPW6      YYGSKGVY------------------------------------GASSSKG---------
B1ZT68          YAKTSAAQ----------------------------------------------------
W0J7C2          YEEQTPA-----------------------------------------------------
B4D1I7          AKSDQAGV----------------------------------------------------
A0A353F286      YYSPSNME------------------------------------ENQKPQAMTARKSSKS
A0A354FSA6      YYSPSNME------------------------------------ENQKPQAMTARKSSKS
A0A3B9GA54      YYSPSNME------------------------------------ENQKPQAMTARKSSKS
A0A520LEH8      YYSPSNME------------------------------------ENQKPQAMTARKSSKS
A0A6B2M0T8      YGKYKSYY------------------------------------PQKSEKTR--------
A0A2D7B7R6      SGYQKKQV------------------------------------TNSPMEVGASAEDEPV
A0A353DCA1      YYAPSSLE------------------------------------ETGTPQQMTAAPASSK
A0A7C5H7K5      YRDYFQTA------------------------------------ATKS------------
A0A7V3QF58      YRDYYQTA------------------------------------APKS------------
A0A832FWF3      YRDYYQTA------------------------------------APKS------------
A0A838YJR8      YYAPRNLD------------------------------------PNMESDSIGSAKSESK
A0A6N4WVA3      SKSGSSSS------------------------------------SKATST----------
A0A0R2XPB1      PKNGVQST------------------------------------SQQTTASS--------
A0A348NQP1      PKNSEQSL------------------------------------SQQTTA----------
A0A357FV58      PKNSEQSL------------------------------------SQQTTA----------
A0A2G4GZN8      --SYRKYY------------VDE---------------------------------PRGA
A0A348NPT1      -KAYQDYY------------ISQ---------------------DVELEDELA-----GS
A0A2E1KV60      -EKYSQYY------------LQDSYL-DLNESNATKSLDSSTANDQSAGVDTAVAESDTN
A0A2D7F4D9      NKKYSAYY------------MQESYLGNMDESEAEES-------NQAIVADTFTETKTDS
A0A3R7RBR8      NKKYSAYY------------MQESYLGNMDESEAEES-------NQAIVADTFTETKTDS
A0A2E0NH28      -KSYQDYY------------INN---------------------EDDFEDQLVESTASGD
A0A368BGT4      -KAYKNYYTNRGEELDQGEELVQ---------------------GEELEDELV-----GD
A0A317ZP96      -KSYQDYY------------IQQ---------------------EEEFEHELE-----GE
A0A350AS32      -KAYQDYY------------IHN---------------------DEEFEEELA-----GS
A0A7W8DI01      RYYDPTYY------------------------------------SSSRRGGVQPVNDA--
A0A6N6PLV8      YYGARREA------------------------------------PARIETAAPQLARPRP
A0A290QE54      YRSYKKYY------------------------------------GTQT------------
A0A1H1SWX2      YRSYKKYY------------------------------------GSQS------------
A0A1D8AZK8      YRSYKKYY------------------------------------GSQS------------
A0A4Q1C9I5      YRSYKKYY------------------------------------GSQS------------
A0A842HCC8      YRSYAPKA------------------------------------GNHEKDKKGHPKHAEK
A0A1G3ZL71      YRSYKKYY------------------------------------GTQG------------
A0A556QP09      YRSYKKYY------------------------------------GTQD------------
A0A2T6DX88      YRSYKKYY------------------------------------GTQA------------
A0A2T6CWI7      YRSYKKYY------------------------------------GAQT------------
A0A3E1E5C8      YRSYKKYY------------------------------------GTQS------------
B1ZZ74          YRSYKKYY------------------------------------GSQS------------
A0A2E0V4K6      YGSYGAYG------------------------------------SDDEED----------
A0A7W1VQ11      FYYAPNYY------------------------------------YNYRALEAPSSLAEK-
A0A2V6F9Q9      SVAVLE------------------------------------------SEATAQRQPTR-
A0A2V6NZZ3      PVAPSE------------------------------------------SEAIAQRSSG--
A0A2V6EBU2      PVAPSE------------------------------------------SEAIAQRSSG--
A0A2V6EY06      PVAPSE------------------------------------------SEAIAQRSSG--
A0A2V6ME53      PIAPPE------------------------------------------SEATAQHSSG--
A0A538NUU0      PIAPPE------------------------------------------SEATAQHSSG--
A0A2V6NIJ1      PVASSE------------------------------------------SEATTQHHPTSQ
A0A2V6C292      PVTSSA------------------------------------------SDAIAQ-HSSDQ
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      PSVPETDA----------------------------------------QPVAPPVRRQRP
A0A7W1MVB5      PPATPTPA------------------------------------PTGVEDPLRAAGREHG
A0A7W1U7H7      PPAVPTPA------------------------------------PTGVEKPLRAESKEHR
A0A2V5XFN9      PA-APD------------------------------------------GEAVTSVGREHP
A0A2V6EZC8      PA-APD------------------------------------------GEAVTPVGREHP
A0A2V6I7Z5      PA-APD------------------------------------------GEAVTPVGREHP
A0A3B9LCP2      PASAPE------------------------------------------GETVAAPHREQA
A0A3C0R669      PASAPE------------------------------------------GETVAAPHREQA
A0A2V6EID2      PASVTD------------------------------------------DEALTAPPPREP
A0A2V6MHB0      PASVTD------------------------------------------DEALTAPPPREP
A0A7V9V4N8      PVPGDD------------------------------------------RDGVPAALQNGK
A0A838I5D7      PVPDED------------------------------------------RHGV-AALQNGN
A0A2W5YWL9      PAEPAE---------------------------------------------------RPA
A0A2V5NH62      PVPVEE------------------------------------------HDDVAAAHRHHQ
A0A2W6A620      PVPVEE------------------------------------------HDEVAATTLHPQ
A0A2V5PIJ4      PEPVDE------------------------------------------RAAPAALHHREP
A0A2V6K2G8      PT-VPD------------------------------------------AETVTPVRRERP
A0A2V5W206      PTSVPD------------------------------------------GEAVAPVRRQRP
A0A2V6MW77      PTSVPD------------------------------------------GEAVAPVRRQRS
A0A838MZM0      PLPPD-------------------------------------------DRDGIPAALQNG
A0A838DHH0      PPVPDE------------------------------------------DRHGIAALQNHG
A0A838FJZ1      PPPAQE------------------------------------------DRHGVPAPALHA
A0A0E3YV65      SKYAADYI------------------------------------REEKA-----------
W0J900          SRYYASYY------------------------------------KEEQLAGQSG------
B4CZV9          HDYYYQHA------------------------------------IEST------------
A0A7X1AX64      YSYHDYYY------------------------------------TKGPGERQTLSEKTGA
A0A3B9FM17      YKYYNKYY------------------------------------GKSDAEEKRKKKQAVS
A0A7W7YGS1      YYYSSSYY------------------------------------DSNWDEPQKKVI----
A0A2D7WMI4      YKYYNKYY------------------------------------GKNQDS----------
A0A2D6VHX5      YKYYSKYY------------------------------------SPTEDT----------
A0A2D8I214      YKYYNKYY------------------------------------GKEKKSEA--------
A0A1Z8VL41      YKYYNKYY------------------------------------GSEKDTSTKIEV----
A0A2E6TNA4      YKYYYKYY------------------------------------GSEKDTSSKIEA----
A0A1Z8RG47      YKYYNKYY------------------------------------GKEKDEKAPVEKLTS-
A0A1Z8RJJ5      YKYYNKYY------------------------------------GKEKDEKAPVEKLTS-
A0A2D7V631      YKYYNKYY------------------------------------GKDKDEKPPVEKLTT-
A0A354RA24      YKYYNKYY------------------------------------GKDKDEKPPVEKLTT-
A0A2E9RV62      YKYYNKYY------------------------------------GKQGAEKAQ----GKN
A0A2E4AY96      YKYYNKYY------------------------------------GGSKSNTG--------
A0A3B9B9P4      YKYYNKYY------------------------------------GGSKSNTG--------
A0A2D5Y6N6      YKYYNKYY------------------------------------GRERDDEPSSPTVQGK
A0A2E7HSS8      YKYYNKYY------------------------------------GKSDAEEKR----KSV
A0A2D8VCK3      YKYYNKYY------------------------------------GKSDAEEKR----KKK
A0A350QVY4      YKYYNKYY------------------------------------GKPDAEEKR----KNK
A0A2E4ZYR7      YKYYNKYY------------------------------------GGRGEDEKA----EKK
A0A2E6TCV1      YKYYNKYY------------------------------------GGKEGAESE----LPR
R7E4L8          YSETDG------------------------------------------------------
A0A4P6PCA7      Y------V------------------------------------SDTAETAN--------
A0A2T6DSN5      Y------Y------------------------------------KSYQSEKVSS------
A0A317ZIW7      -------Y------------------------------------TSTQKPEDSVKSVGGV
A0A7C4PPT4      YHYYKSYK------------------------------------TLEANPPAEPNSTPAE
A0A7C4QZX4      YHYYKSYK------------------------------------ALENQPPAPVQG----
A0A3C1AXQ2      Y---------------------------------------------SPDNMAAPADKKPE
A0A3D4HHL8      REEPSPKV------------------------------------SKKMQAVSKT------
A0A366HV03      F------E------------------------------------EDDVAGRSAPVSA---
A0A6G6K911      F------E------------------------------------EDDMPGRSAPASA---
A0A832HT83      YYYYKSYK------------------------------------SGEKQPAALPPSAPPS
A0A5R8KAF2      YYYSASYY------------------------------------EDLEGVGAGGKAVV--
A0A7C4LRZ6      Y------Y------------------------------------NKGKSSASASLSPIAL
A0A351MR11      Y------Y------------------------------------TDAADQGAEKPAPKKD
A0A388PR45      Y------Y------------------------------------VGESGAGPKA------
A0A388QR61      Y------Y------------------------------------ASDAGGPPSP------
A0A4P5YHI0      Y------Y------------------------------------ASDAGGPPSP------
A0A2A2RS01      Y------Y------------------------------------IDSEGSDSSG------
A0A2A2Y1A7      Y------Y------------------------------------IDSEGSDSSG------
A0A388PDH9      Y------Y------------------------------------IDAQDSDSSS------
A0A2G4H1E7      Y------Y------------------------------------VDERGASSSPGPPKS-
A0A2G4GZA6      Y------Y------------------------------------VDETRSQAGADSTKS-
A0A388P514      Y------Y------------------------------------VDEPRGQSDAGSAKS-
A0A2A2YG59      Y------Y------------------------------------VDEPRGQSGAGSEKS-
A0A2G4F7D5      Y------Y------------------------------------VDEPRGQSGAGSEKS-
A0A7V4IDX4      Y------Y------------------------------------SDTPKRA---------
A0A2V2SDN0      YKDDYRWQ------------------------------------PNVTTAA---------
A0A4Q3BVY2      YYYSAPYY------------------------------------DQMESEEEPAAMVQTR
A0A8A7W4D3      YYYSAPYY------------------------------------DQVDAEAQPARLAGVR
A0A3R8L982      YRSYKKYY------------------------------------GPRAA-----------
A0A6N6QBS9      Y--YHRPL------------------------------------TPDEGSYGSGDGTSGP
A0A2V5X6Z6      YRRAYRWE------------------------------------PQKSGRV-ALAGNLSP
A0A2V5VGZ7      YRRAYHWE------------------------------------PKETRCATALAGHSAP
A0A2V5U130      YRRAYRWE------------------------------------PKETRRATALAGHSAP
A0A2V6C237      YRRAYHWE------------------------------------PKETRCATALAGHSAP
A0A2E7HPU9      YGQYGGGY------------------------------------GSGSYGSYGSYGADEE
D5EML0          Y------Y------------------------------------RRSRSA----------
A0A1V6GL40      Y--------------------------------------------PSGGTKTAESARTGQ
A0A7X7VL75      Y--------------------------------------------PSGGTKTAESARTGQ
A0A7C4PPJ4      Y------Y------------------------------------RSRDRSASKTTGIPDV
A0A3C1C1M3      YQKHYGAY------------------------------------AQAVPPSLTPTGK---
A0A2S7U4L6      Y------Y------------------------------------APGQNKSAAAEATA--
A0A2E9EYJ1      Y------Y------------------------------------APRNLDPDMESGSIGS
A0A258AXR6      Y------Y------------------------------------SPTNSPNGGTGGKSRR
A0A7W7YD86      Y------Y------------------------------------SPTNSPNGAQGGKSRR
A0A3D3NZQ6      Y------Y------------------------------------SPDNRP-AAEGGKPKK
A0A1T4WVZ9      Y------Y------------------------------------SPNNTA-APAGTRPEK
A0A4R7SSI6      Y------Y------------------------------------SPNNTA-APAGHKPEK
A0A7W8DNH5      Y------Y------------------------------------SPDNMA-APAGNKPER
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      PAGSKS------------------------------------------------------
A0A432FAS4      --------------------------------------------GKDEETNSKKPEKESS
A0A660Q3A0      --------------------------------------------ETGSA-----------
A0A849Y855      --------------------------------------------HRAPAEPPASQENPAA
A0A2D5W0Q9      --------------------------------------------GELVQGGKAGKDDEPS
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      SKPVLSIQEEAELLASKKGIPTLEPKPIHKAEWFKSWRAMKKKIRNFKAGVKPDLDDDDS
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      KEPSSE--------------------------------------KSPKTEKSGGMEGLET
A0A257LYL4      QGSAVA--------------------------------------PAPRS--QPAAKGDSE
A0A4Q2XXY1      ASTPAT--------------------------------------AGSRSGGKSSPKDDKD
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      RHHQPRQIQSS-------------------------------------------------
                                                                            

A0A2V5U7A0      AHDSFEKDPWPKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARNRFPKN
A0A3D4CZT6      SATSGSALESKVVANDSEEDEGLTY-----------------------------------
A0A4V1S9Q4      SSPAKPQAQSPSRGNDSE-----LY-----------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      RQRPKPIETT--------------------------------------------------
A0A2V6NH44      QHRTGQAQSS--------------------------------------------------
A0A3D0IZR7      VAAVEIPAATPAASVDEVVEHPLDTPEASAPKVTFIRPPRGQDRF---------------
A0A520LRZ3      KAPQSEESKSSSEEVSIEDKF---------------------------------------
A0A356FSV4      SGDEDTSEIARET-----------------------------------------------
A0A3D3DET9      EQT---------------------------------------------------------
A0A355SVK9      KPELQGKS----------------------------------------------------
A0A2E5D7I3      DDXED-------------------------------------------------------
A0A2V5NYE2      KREQAHRA----------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A2V6FIP7      KAG---------------------------------------------------------
A0A3C1UJT2      KS----------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A7Y4QK88      ------------------------------------------------------------
A0A1V6GCZ3      ESGGKDKLDIKQKY----------------------------------------------
A0A7V3WMH6      STEQSDKVEIKSKY----------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A2E6T1E0      SKKTKKKAV---------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A7W1HKQ4      VRNGSVSPDEY-------------------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      GKAKELAATQSHDSEDLY------------------------------------------
R7E1V8          GKAKELAATQSHDSEDLY------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      ------------------------------------------------------------
A0A290QD69      ------------------------------------------------------------
A0A6N6ZC77      ------------------------------------------------------------
A0A832M896      ------------------------------------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A2V2SMX4      ------------------------------------------------------------
A0A522AC27      ------------------------------------------------------------
A0A6M1RFD0      ------------------------------------------------------------
A0A7C3HXH0      ------------------------------------------------------------
A0A432FDF6      DAKLLAKADIGGEDEKPKY-----------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      PEPALEADKRKAELFKSRRAAKRRAKFIEISLGSEEHFQSAPLPSPTVFEEREPEMSSKQ
A0A178IFJ2      ------------------------------------------------------------
A0A357FSP9      A-----------------------------------------------------------
A0A1T4WWY4      ET----------------------------------------------------------
A0A3D3LEQ6      KRRGSSQSA---------------------------------------------------
A0A3D3NW23      KRRGSSQAA---------------------------------------------------
A0A522ACN3      IKPKY-------------------------------------------------------
A0A2A2R174      ------------------------------------------------------------
A0A1H2DTI1      SKL---------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A1V5L462      PKEK--------------------------------------------------------
A0A3D3LGD3      TAPARTPGGDLF------------------------------------------------
A0A350ARX4      ------------------------------------------------------------
B5JIS2          VEDDDNLEAVEANGKVAETAKSKLKSTPLKLNNKNSGSKSLIGKLMSEQEKKE-------
A0A7Y1UGD7      ------------------------------------------------------------
A0A2E5K4P7      KMNLEQGSEAQA------------------------------------------------
A0A842HH73      ATPADDDGQV--------------------------------------------------
A0A2E6NAH3      DIETELESKS--------------------------------------------------
A0A2A5VZA5      STEPEEKVES--------------------------------------------------
A0A424R295      STEPEEKVES--------------------------------------------------
A0A1H2GQN6      LPPGTTPPPTPPSQPDEF------------------------------------------
A0A858RDL7      SA----------------------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      PPNRPITLAVATAVPPKSAQDFKLRRATQRKANLTLPGATAARPARDVTVTRT-------
A0A2A2RPW6      ------------------------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      EPKGSSSSDTSNDDLY--------------------------------------------
A0A354FSA6      EPKGSSSSDTSNDDLY--------------------------------------------
A0A3B9GA54      EPKSSSVSDTSNDDLY--------------------------------------------
A0A520LEH8      EPKGSSSSDTSNDDLY--------------------------------------------
A0A6B2M0T8      ------------------------------------------------------------
A0A2D7B7R6      KS----------------------------------------------------------
A0A353DCA1      TEEKKSERSSSEDLY---------------------------------------------
A0A7C5H7K5      ------------------------------------------------------------
A0A7V3QF58      ------------------------------------------------------------
A0A832FWF3      ------------------------------------------------------------
A0A838YJR8      VASNDQNNLSAEDKF---------------------------------------------
A0A6N4WVA3      ------------------------------------------------------------
A0A0R2XPB1      ------------------------------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ------------------------------------------------------------
A0A2G4GZN8      TDSDSAKS----------------------------------------------------
A0A348NPT1      VEP-EMEPRA--------------------------------------------------
A0A2E1KV60      TDTDKLDS----------------------------------------------------
A0A2D7F4D9      DSEDKLDS----------------------------------------------------
A0A3R7RBR8      DSEDKLDS----------------------------------------------------
A0A2E0NH28      EDTSEIARET--------------------------------------------------
A0A368BGT4      IET-ELESKS--------------------------------------------------
A0A317ZP96      VEPEELQTKS--------------------------------------------------
A0A350AS32      VEP-TVDSKS--------------------------------------------------
A0A7W8DI01      ------------------------------------------------------------
A0A6N6PLV8      ASREDY------------------------------------------------------
A0A290QE54      ------------------------------------------------------------
A0A1H1SWX2      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A4Q1C9I5      ------------------------------------------------------------
A0A842HCC8      IPSGEEHKTPVSGKKETVVAELVDKSAPANPEQKPDDNTDTDKTDKTV------------
A0A1G3ZL71      ------------------------------------------------------------
A0A556QP09      ------------------------------------------------------------
A0A2T6DX88      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A3E1E5C8      ------------------------------------------------------------
B1ZZ74          ------------------------------------------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A7W1VQ11      ------------------------------------------------------------
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ------------------------------------------------------------
A0A2V6EBU2      ------------------------------------------------------------
A0A2V6EY06      ------------------------------------------------------------
A0A2V6ME53      ------------------------------------------------------------
A0A538NUU0      ------------------------------------------------------------
A0A2V6NIJ1      AQS-----------S---------------------------------------------
A0A2V6C292      AQS-----------F---------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      RPI-----------ETQI------------------------------------------
A0A7W1MVB5      HRV---------------------------------------------------------
A0A7W1U7H7      HPA---------------------------------------------------------
A0A2V5XFN9      KPI-----------ETA-------------------------------------------
A0A2V6EZC8      KPI-----------ETA-------------------------------------------
A0A2V6I7Z5      KPI-----------ETA-------------------------------------------
A0A3B9LCP2      KPV-----------ETS-------------------------------------------
A0A3C0R669      KHV-----------QTS-------------------------------------------
A0A2V6EID2      AKQ-----------PS--------------------------------------------
A0A2V6MHB0      AKQ-----------PS--------------------------------------------
A0A7V9V4N8      HAH-----------S---------------------------------------------
A0A838I5D7      RAP-----------S---------------------------------------------
A0A2W5YWL9      THQ-----------VQPS------------------------------------------
A0A2V5NH62      PRQ-----------IQSS------------------------------------------
A0A2W6A620      PKQ-----------IQSS------------------------------------------
A0A2V5PIJ4      KQ------------IQSS------------------------------------------
A0A2V6K2G8      KP------------IETA------------------------------------------
A0A2V5W206      KP------------IETT------------------------------------------
A0A2V6MW77      KP------------METT------------------------------------------
A0A838MZM0      KHAGS-------------------------------------------------------
A0A838DHH0      NG------------AKAS------------------------------------------
A0A838FJZ1      NGHGNGQTPAHINRPQSS------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------------------------------------
B4CZV9          ------------------------------------------------------------
A0A7X1AX64      SAPTPSGQAPIGDPEEQGEKQSERV-----------------------------------
A0A3B9FM17      ------------------------------------------------------------
A0A7W7YGS1      ------------------------------------------------------------
A0A2D7WMI4      ------------------------------------------------------------
A0A2D6VHX5      ------------------------------------------------------------
A0A2D8I214      ------------------------------------------------------------
A0A1Z8VL41      ------------------------------------------------------------
A0A2E6TNA4      ------------------------------------------------------------
A0A1Z8RG47      ------------------------------------------------------------
A0A1Z8RJJ5      ------------------------------------------------------------
A0A2D7V631      ------------------------------------------------------------
A0A354RA24      ------------------------------------------------------------
A0A2E9RV62      AKLS--------------------------------------------------------
A0A2E4AY96      ------------------------------------------------------------
A0A3B9B9P4      ------------------------------------------------------------
A0A2D5Y6N6      ESVS--------------------------------------------------------
A0A2E7HSS8      SS----------------------------------------------------------
A0A2D8VCK3      QAVS--------------------------------------------------------
A0A350QVY4      QAVS--------------------------------------------------------
A0A2E4ZYR7      AQAS--------------------------------------------------------
A0A2E6TCV1      EKAS--------------------------------------------------------
R7E4L8          ------------------------------------------------------------
A0A4P6PCA7      ------------------------------------------------------------
A0A2T6DSN5      ------------------------------------------------------------
A0A317ZIW7      ------------------------------------------------------------
A0A7C4PPT4      KSTS--------------------------------------------------------
A0A7C4QZX4      ------------------------------------------------------------
A0A3C1AXQ2      RRKKPTPAGQPSPGAAASSNAPRGDLF---------------------------------
A0A3D4HHL8      ------------------------------------------------------------
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A832HT83      APAEPPATPVT-------------------------------------------------
A0A5R8KAF2      ------------------------------------------------------------
A0A7C4LRZ6      PGSKMAGRRQSAVAGGNSRPTGGAG-----------------------------------
A0A351MR11      PVV---------------------------------------------------------
A0A388PR45      ------------------------------------------------------------
A0A388QR61      ------------------------------------------------------------
A0A4P5YHI0      ------------------------------------------------------------
A0A2A2RS01      ------------------------------------------------------------
A0A2A2Y1A7      ------------------------------------------------------------
A0A388PDH9      ------------------------------------------------------------
A0A2G4H1E7      ------------------------------------------------------------
A0A2G4GZA6      ------------------------------------------------------------
A0A388P514      ------------------------------------------------------------
A0A2A2YG59      ------------------------------------------------------------
A0A2G4F7D5      ------------------------------------------------------------
A0A7V4IDX4      ------------------------------------------------------------
A0A2V2SDN0      ------------------------------------------------------------
A0A4Q3BVY2      S-----------------------------------------------------------
A0A8A7W4D3      A-----------------------------------------------------------
A0A3R8L982      ------------------------------------------------------------
A0A6N6QBS9      GGAVAAETVDPVAGKNGPGPRS--------------------------------------
A0A2V5X6Z6      NTTDR-------------------------------------------------------
A0A2V5VGZ7      DATDG-------------------------------------------------------
A0A2V5U130      DATGG-------------------------------------------------------
A0A2V6C237      DATDG-------------------------------------------------------
A0A2E7HPU9      EDD---------------------------------------------------------
D5EML0          ------------------------------------------------------------
A0A1V6GL40      A-----------------------------------------------------------
A0A7X7VL75      A-----------------------------------------------------------
A0A7C4PPJ4      KPGKVMPPPRKTEVSR--------------------------------------------
A0A3C1C1M3      ------------------------------------------------------------
A0A2S7U4L6      --------------KSSSDSPKTNDLY---------------------------------
A0A2E9EYJ1      PKPGSKLA------SXDQNNLSAEDKF---------------------------------
A0A258AXR6      RKIKAETTATALGSSQSVSRLDGDDVF---------------------------------
A0A7W7YD86      RKIKAETTATVLG-GQGMPRAGGDDIF---------------------------------
A0A3D3NZQ6      RRK-------AAG-ETAPARTPGGDLF---------------------------------
A0A1T4WVZ9      RKKQIPPSRPGQA-TVASSSAPRGDLF---------------------------------
A0A4R7SSI6      RKKQVAPGQVAKA-VSAPSNGSRGDLF---------------------------------
A0A7W8DNH5      RKKQTSAPQPVAG-KVASSNTPRGDLF---------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A432FAS4      AA----------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A849Y855      TA----------------------------------------------------------
A0A2D5W0Q9      KA----------------------------------------------------------
A0A857ZXX2      ------------------------------------------------------------
A0A7V6ECG3      IT----------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      KY----------------------------------------------------------
A0A257LYL4      LY----------------------------------------------------------
A0A4Q2XXY1      DY----------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A2V5U7A0      RLHELFDRICEEILDDKLKNDFQQSMQEELRVL
A0A3D4CZT6      ---------------------------------
A0A4V1S9Q4      ---------------------------------
A0A355VK99      ---------------------------------
A0A2V6N5E0      ---------------------------------
A0A2V6NH44      ---------------------------------
A0A3D0IZR7      ---------------------------------
A0A520LRZ3      ---------------------------------
A0A356FSV4      ---------------------------------
A0A3D3DET9      ---------------------------------
A0A355SVK9      ---------------------------------
A0A2E5D7I3      ---------------------------------
A0A2V5NYE2      ---------------------------------
A0A353DI77      ---------------------------------
A0A2V6FIP7      ---------------------------------
A0A3C1UJT2      ---------------------------------
A0A258AXL1      ---------------------------------
A0A2V5UAD5      ---------------------------------
A0A7Y4QK88      ---------------------------------
A0A1V6GCZ3      ---------------------------------
A0A7V3WMH6      ---------------------------------
A0A2S7U0Z3      ---------------------------------
A0A2E6T1E0      ---------------------------------
A0A5E6MKA7      ---------------------------------
A0A7W1HKQ4      ---------------------------------
A0A6B3L936      ---------------------------------
A0A2N8IR72      ---------------------------------
A0A2N8IV96      ---------------------------------
R7E1V8          ---------------------------------
A0A2E0R252      ---------------------------------
A0A3E1EF48      ---------------------------------
A0A2A2PVG8      ---------------------------------
A0A2E0R421      ---------------------------------
A0A2E5EJ69      ---------------------------------
A0A2G4I5Z5      ---------------------------------
A0A4P5QQV6      ---------------------------------
A0A2E7ALI1      ---------------------------------
A0A178IDB9      ---------------------------------
A0A290QD69      ---------------------------------
A0A6N6ZC77      ---------------------------------
A0A832M896      ---------------------------------
A0A538NJ59      ---------------------------------
A0A2A2R3V9      ---------------------------------
A0A3C1VFY9      ---------------------------------
A0A2V2SMX4      ---------------------------------
A0A522AC27      ---------------------------------
A0A6M1RFD0      ---------------------------------
A0A7C3HXH0      ---------------------------------
A0A432FDF6      ---------------------------------
A0A2E7VDS1      ---------------------------------
A0A7C8D3W3      A--------------------------------
A0A178IFJ2      ---------------------------------
A0A357FSP9      ---------------------------------
A0A1T4WWY4      ---------------------------------
A0A3D3LEQ6      ---------------------------------
A0A3D3NW23      ---------------------------------
A0A522ACN3      ---------------------------------
A0A2A2R174      ---------------------------------
A0A1H2DTI1      ---------------------------------
A0A1H1MGC9      ---------------------------------
A0A1V5L462      ---------------------------------
A0A3D3LGD3      ---------------------------------
A0A350ARX4      ---------------------------------
B5JIS2          ---------------------------------
A0A7Y1UGD7      ---------------------------------
A0A2E5K4P7      ---------------------------------
A0A842HH73      ---------------------------------
A0A2E6NAH3      ---------------------------------
A0A2A5VZA5      ---------------------------------
A0A424R295      ---------------------------------
A0A1H2GQN6      ---------------------------------
A0A858RDL7      ---------------------------------
A0A512M3Y3      ---------------------------------
A0A4P5R5J1      ---------------------------------
A0A4P5YK43      ---------------------------------
A0A2A2RPW6      ---------------------------------
B1ZT68          ---------------------------------
W0J7C2          ---------------------------------
B4D1I7          ---------------------------------
A0A353F286      ---------------------------------
A0A354FSA6      ---------------------------------
A0A3B9GA54      ---------------------------------
A0A520LEH8      ---------------------------------
A0A6B2M0T8      ---------------------------------
A0A2D7B7R6      ---------------------------------
A0A353DCA1      ---------------------------------
A0A7C5H7K5      ---------------------------------
A0A7V3QF58      ---------------------------------
A0A832FWF3      ---------------------------------
A0A838YJR8      ---------------------------------
A0A6N4WVA3      ---------------------------------
A0A0R2XPB1      ---------------------------------
A0A348NQP1      ---------------------------------
A0A357FV58      ---------------------------------
A0A2G4GZN8      ---------------------------------
A0A348NPT1      ---------------------------------
A0A2E1KV60      ---------------------------------
A0A2D7F4D9      ---------------------------------
A0A3R7RBR8      ---------------------------------
A0A2E0NH28      ---------------------------------
A0A368BGT4      ---------------------------------
A0A317ZP96      ---------------------------------
A0A350AS32      ---------------------------------
A0A7W8DI01      ---------------------------------
A0A6N6PLV8      ---------------------------------
A0A290QE54      ---------------------------------
A0A1H1SWX2      ---------------------------------
A0A1D8AZK8      ---------------------------------
A0A4Q1C9I5      ---------------------------------
A0A842HCC8      ---------------------------------
A0A1G3ZL71      ---------------------------------
A0A556QP09      ---------------------------------
A0A2T6DX88      ---------------------------------
A0A2T6CWI7      ---------------------------------
A0A3E1E5C8      ---------------------------------
B1ZZ74          ---------------------------------
A0A2E0V4K6      ---------------------------------
A0A7W1VQ11      ---------------------------------
A0A2V6F9Q9      ---------------------------------
A0A2V6NZZ3      ---------------------------------
A0A2V6EBU2      ---------------------------------
A0A2V6EY06      ---------------------------------
A0A2V6ME53      ---------------------------------
A0A538NUU0      ---------------------------------
A0A2V6NIJ1      ---------------------------------
A0A2V6C292      ---------------------------------
A0A2V6D2X0      ---------------------------------
A0A2V5ZUK1      ---------------------------------
A0A7W1MVB5      ---------------------------------
A0A7W1U7H7      ---------------------------------
A0A2V5XFN9      ---------------------------------
A0A2V6EZC8      ---------------------------------
A0A2V6I7Z5      ---------------------------------
A0A3B9LCP2      ---------------------------------
A0A3C0R669      ---------------------------------
A0A2V6EID2      ---------------------------------
A0A2V6MHB0      ---------------------------------
A0A7V9V4N8      ---------------------------------
A0A838I5D7      ---------------------------------
A0A2W5YWL9      ---------------------------------
A0A2V5NH62      ---------------------------------
A0A2W6A620      ---------------------------------
A0A2V5PIJ4      ---------------------------------
A0A2V6K2G8      ---------------------------------
A0A2V5W206      ---------------------------------
A0A2V6MW77      ---------------------------------
A0A838MZM0      ---------------------------------
A0A838DHH0      ---------------------------------
A0A838FJZ1      ---------------------------------
A0A0E3YV65      ---------------------------------
W0J900          ---------------------------------
B4CZV9          ---------------------------------
A0A7X1AX64      ---------------------------------
A0A3B9FM17      ---------------------------------
A0A7W7YGS1      ---------------------------------
A0A2D7WMI4      ---------------------------------
A0A2D6VHX5      ---------------------------------
A0A2D8I214      ---------------------------------
A0A1Z8VL41      ---------------------------------
A0A2E6TNA4      ---------------------------------
A0A1Z8RG47      ---------------------------------
A0A1Z8RJJ5      ---------------------------------
A0A2D7V631      ---------------------------------
A0A354RA24      ---------------------------------
A0A2E9RV62      ---------------------------------
A0A2E4AY96      ---------------------------------
A0A3B9B9P4      ---------------------------------
A0A2D5Y6N6      ---------------------------------
A0A2E7HSS8      ---------------------------------
A0A2D8VCK3      ---------------------------------
A0A350QVY4      ---------------------------------
A0A2E4ZYR7      ---------------------------------
A0A2E6TCV1      ---------------------------------
R7E4L8          ---------------------------------
A0A4P6PCA7      ---------------------------------
A0A2T6DSN5      ---------------------------------
A0A317ZIW7      ---------------------------------
A0A7C4PPT4      ---------------------------------
A0A7C4QZX4      ---------------------------------
A0A3C1AXQ2      ---------------------------------
A0A3D4HHL8      ---------------------------------
A0A366HV03      ---------------------------------
A0A6G6K911      ---------------------------------
A0A832HT83      ---------------------------------
A0A5R8KAF2      ---------------------------------
A0A7C4LRZ6      ---------------------------------
A0A351MR11      ---------------------------------
A0A388PR45      ---------------------------------
A0A388QR61      ---------------------------------
A0A4P5YHI0      ---------------------------------
A0A2A2RS01      ---------------------------------
A0A2A2Y1A7      ---------------------------------
A0A388PDH9      ---------------------------------
A0A2G4H1E7      ---------------------------------
A0A2G4GZA6      ---------------------------------
A0A388P514      ---------------------------------
A0A2A2YG59      ---------------------------------
A0A2G4F7D5      ---------------------------------
A0A7V4IDX4      ---------------------------------
A0A2V2SDN0      ---------------------------------
A0A4Q3BVY2      ---------------------------------
A0A8A7W4D3      ---------------------------------
A0A3R8L982      ---------------------------------
A0A6N6QBS9      ---------------------------------
A0A2V5X6Z6      ---------------------------------
A0A2V5VGZ7      ---------------------------------
A0A2V5U130      ---------------------------------
A0A2V6C237      ---------------------------------
A0A2E7HPU9      ---------------------------------
D5EML0          ---------------------------------
A0A1V6GL40      ---------------------------------
A0A7X7VL75      ---------------------------------
A0A7C4PPJ4      ---------------------------------
A0A3C1C1M3      ---------------------------------
A0A2S7U4L6      ---------------------------------
A0A2E9EYJ1      ---------------------------------
A0A258AXR6      ---------------------------------
A0A7W7YD86      ---------------------------------
A0A3D3NZQ6      ---------------------------------
A0A1T4WVZ9      ---------------------------------
A0A4R7SSI6      ---------------------------------
A0A7W8DNH5      ---------------------------------
A0A4Q3AQI1      ---------------------------------
A0A6N2CMN7      ---------------------------------
A0A432FAS4      ---------------------------------
A0A660Q3A0      ---------------------------------
A0A849Y855      ---------------------------------
A0A2D5W0Q9      ---------------------------------
A0A857ZXX2      ---------------------------------
A0A7V6ECG3      ---------------------------------
A0A1Z9KB52      ---------------------------------
A0A7C5CZ90      ---------------------------------
A0A257LYL4      ---------------------------------
A0A4Q2XXY1      ---------------------------------
A0A4P6PD26      ---------------------------------
A0A1Z8SVB5      ---------------------------------
A0A2V5W3Y0      ---------------------------------
                                                 

© 1998-2022Legal notice