BYKdb

Dataset for cluster orphancd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

206 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ---------------------------------------------------MDIDPFADD
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      --------------------------------------------------MKKEIDPFDD
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A2E0R252      --------------------------------------------------------MNEV
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      -----------------------------------------------------------M
A0A2E0R421      ---------------------------------------------------------MID
A0A2E5EJ69      ----------------------------------------------------------MD
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      --------------------------------------------MSKPVQAQTRSTAHRS
A0A290QD69      --------------------------------------------MSKSTKS---SSGKRG
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      --------------------------------------------------MSKKPNKKLD
A0A178IFJ2      ---------------------------------------MAETFSKKPVPAAGAWPPQSS
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      ------------------------------------------------------------
A0A3D3NW23      ------------------------------------------------------------
A0A2A2R174      ----------------------------------------------------------MD
A0A1H2DTI1      -----------------------------------MEPIPPSAPGTPGGFPPPQAPSSPM
A0A1H1MGC9      ------------------------------------MDTVPKAEKAQGSGEAYPYTYYGT
A0A1V5L462      -----------------------------------------------------MQDDFLE
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      --------------------------------------MILSVWRSESLPSDPNNFSSSY
B5JIS2          ----------------------------------------MAHSETKKSLRPHASAGYGA
A0A6N6ZC77      ----------------------------------------------------MVANEFDL
A0A7C5H7K5      -----------------------------------------------MVNGQSTLPSNYY
A0A538NJ59      ----------------------------------------------MTHSNLPVPASEYP
A0A2A2R3V9      ----------------------------------------------------------MS
A0A3C1VFY9      --------------------------------------------------------MKED
A0A2V2SMX4      ----------------------------------------------------MNQPGAIE
A0A522AC27      -------------------------------------------------------MNE-P
A0A6M1RFD0      -------------------------------------------------------MNEYP
A0A7C3HXH0      -------------------------------------------------------MNEYP
A0A1H2GQN6      ------------------------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ---------------------------------------------------------MSL
A0A4P5YK43      --------------------------------------------------MASSHASLEL
A0A2A2RPW6      ----------------------------------------------------------MQ
B1ZT68          -----------------------------------------------------MPTSKKP
W0J7C2          -----------------------------------------------------MTTTDTT
B4D1I7          -----------------------------------------------------MDAHPAA
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ------------------------------------------------------------
A0A3B9GA54      ------------------------------------------------------------
A0A520LEH8      ------------------------------------------------------------
A0A6B2M0T8      ----------------------------------------------------MSNQQYES
A0A2D7B7R6      ------------------------------------------------------------
A0A2E5K4P7      ---------------------------------------MDSEPPEDSSNSSYRGYRYYG
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ----------------------------------------------------------MN
A0A2V6EBU2      ----------------------------------------------------------MN
A0A2V6EY06      ----------------------------------------------------------MN
A0A2V6ME53      ----------------------------------------------------------MN
A0A538NUU0      ----------------------------------------------------------MN
A0A2V6NIJ1      ----------------------------------------------------------MN
A0A2V6C292      ----------------------------------------------------------MN
A0A2V6D2X0      ----------------------------------------------------------MN
A0A2V5ZUK1      --------------------------------------------------------MQVA
A0A2V5XFN9      ---------------------------------------------------------MPA
A0A2V6EZC8      ---------------------------------------------------------MPA
A0A2V6I7Z5      ---------------------------------------------------------MPA
A0A3B9LCP2      ---------------------------------------------------------MQA
A0A3C0R669      ---------------------------------------------------------MQA
A0A2V6EID2      -------------------------------------------------------MQAPI
A0A2V6MHB0      -------------------------------------------------------MQAPI
A0A2W5YWL9      ----------------------------------------------------------MN
A0A2V5NH62      ------------------------------------------------------MPAPAP
A0A2W6A620      --------------------------------------------------------MPAP
A0A2V5PIJ4      ---------------------------------------------------------MGN
A0A2V6K2G8      ---------------------------------------------------------MQP
A0A2V5W206      ---------------------------------------------------------MQA
A0A2V6MW77      ---------------------------------------------------------MQV
A0A6N4WVA3      -------------------------------------------------------MDDLF
A0A0R2XPB1      -------------------------------------------------------MDDLF
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      -------------------------------------------------------MDDLF
A0A2G4GZN8      MPTPDPSSDNRPPEPSREGNPGYGSYGQGYGQGYGQGYGQGYGAYGAGNYRGGNYGGGNY
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      ------MKNDYS-DNNMGNDNSY--GNYGNYAPGNQYNQYNSYRYGGGGNYGNYGNYGNY
A0A2D7F4D9      ------MKNDYTGDQSNMNSNHY--GGYSNNYGNPQYYNHGSYRYGGN------SGSGSY
A0A3R7RBR8      ------MKNDYTGDQSNMNSNHY--GGYSNNYGNPQYYNHGSYRYGGN------SGSGSY
A0A2E0NH28      ------MKNDYVRGGPDPNTS----GRYGYSSGNYGY-NGSNYGYGSYG-----SNSS--
A0A368BGT4      ------MKNDYVRGAPDPNSGGYGSGGYGYGSGGYGY-GNGGYGYGNGG-----YGYGTG
A0A317ZP96      ------MKNEYVRGAPDPNAGGYA-GGYGY--GSYGY-G-GGYGYGGAG-----YGYG--
A0A350AS32      ------MKNDYVRGAPDPNSGGYG-GGYGYG-GGYGY-G-GGYGYGG-G-----YGAG--
A0A6N6PLV8      ------------------------------------------------------------
A0A290QE54      ------------------------------------------------MSDSPLNPSNAS
A0A1H1SWX2      ----------------------------------------------MSAPDAPLPTAPAR
A0A1D8AZK8      ----------------------------------------------MSVPDSP-PSSSAA
A0A4Q1C9I5      ----------------------------------------------MSSPDFS-PHSASV
A0A2E0V4K6      --------------------------------------------------MSARRLAGAG
A0A1G3ZL71      ---------------------------------------------MPSPLAIPAAPAKPS
A0A556QP09      ----------------------------------------------MSSVQKPSSATKVS
A0A2T6DX88      ---------------------------------------------MNDLQAKHP--SLHT
A0A2T6CWI7      ---------------------------------------------MADANAKPPPPPPVD
A0A3E1E5C8      ---------------------------------------------MPDHTARPF--PPAH
B1ZZ74          ---------------------------------------------MSLAEAKPAVQPGGA
A0A2E6NAH3      -------------------MKNDYIRGAPDPNSGGYGGSGYGYGGGNYGYGGSNYGYGGG
A0A2A5VZA5      -------------------MKNDYIKGGGDPNSGGY-GYGYGYSGGS--------GYSYG
A0A424R295      -------------------MKNDYIKGGGDPNSGGY-GYGYGYSGGS--------GYSYG
B4CZV9          ------------------------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ----------------------------------------MAEIPFTKTGPDTGPLHPRP
A0A3B9FM17      ------------------------------------------------------------
A0A2D7WMI4      ---------------------------------------------------------MDE
A0A2D6VHX5      ---------------------------------------------------------MDL
A0A2D8I214      -------------------------------------------------------MEEEI
A0A1Z8VL41      -------------------------------------------------------MDDNF
A0A2E6TNA4      -------------------------------------------------------MDDNL
A0A1Z8RG47      -------------------------------------------------------MDDEI
A0A1Z8RJJ5      -------------------------------------------------------MDDEI
A0A2D7V631      -------------------------------------------------------MDDDI
A0A354RA24      -------------------------------------------------------MDDDI
A0A2E9RV62      ------------------------------------------------------MDSYSN
A0A2E4AY96      -------------------------------------------------------MDQEH
A0A3B9B9P4      -------------------------------------------------------MDQEH
A0A2D5Y6N6      -------------------------------------------------------MDDNF
A0A2E7HSS8      -------------------------------------------------------MEEDF
A0A2D8VCK3      -------------------------------------------------------MEEDF
A0A350QVY4      -------------------------------------------------------MEEDF
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ----------------------------------------------------MNESLEEL
R7E4L8          ------------------------------------------------------------
A0A4Q3BVY2      ------------------------------------------------------------
A0A4P6PCA7      ----------------------------------MFSGNEPPPVYGASHTPPPVDPANPY
A0A2T6DSN5      -----------------------------------------------------MAKASKT
A0A317ZIW7      -------------------------------------------------------MSDLF
A0A7C4PPT4      ------------------------------------------------------------
A0A7C4QZX4      ------------------------------------------------------------
A0A3D4HHL8      ---------------------------------------------------MTAPPTKSP
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A5R8KAF2      -------------------------------------MDTTKKKFDFAAAVGNALSYAQH
A0A7C4LRZ6      --------------------------------------------------MSEPANANAK
A0A351MR11      -------------MPSSYILRQRDDGNTSYSGGYGGYGGY----GAYGESRYGGYGS---
A0A388PR45      -----------MDTPSPKPGQPPEDPSRG-PRGYGSYGSY----GGY-----AGYGAPGY
A0A388QR61      -----------MDAPAPKPGQPQDDAQRG-PRGYGSYGNY----GNYGGPA-GGYGAGGY
A0A4P5YHI0      -----------MDAPAPKPGQPQDDAQRG-PRGYGSYGNY----GNYGGPA-GGYGAGGY
A0A2A2RS01      ----------MAEKTQKPEDDQDDSAARG--RGYGSYGNYGNYGGNYGGNYGGGYGA-GY
A0A2A2Y1A7      ----------MAEKTQKPEDDQDDSAARG--RGYGSYGNYGNYGGNYGGNYGGGYGA-GY
A0A388PDH9      ----------MAETPQKPEDNQDDSASRA--RGYGSYGNY----GNYGGAYGGGYGA-GY
A0A2G4H1E7      -----------MANPEPSSDNRPPEPARGGNRGYGSYGSY----GQYGQGY-GAYGA-GY
A0A2G4GZA6      -----------MPNPDPLSDNRPPEPARGGNRGYGSYGSY----GNYGAAN-GGYGY-GN
A0A388P514      -----------MATPEPSSDNRPPEPARGGNRGYGSYGSY----GNYGAGN-GGYGY---
A0A2A2YG59      -----------MATPEPSSDNRPPEPARGGNRGYGSYGSY----GNYGAGN-GGYGY---
A0A2G4F7D5      -----------MATPEPSSDNRPPEPARGGNRGYGSYGSY----GNYGAGN-GGYGY---
A0A2V2SDN0      -----------------------------------MENQN----HNEPAKANNQLTTPAL
A0A1V6GL40      --------------------------------------------------MNDQP-----
A0A2V5X6Z6      ------------------------------------------------MNNNNHPNAAAV
A0A2V5VGZ7      ----------------------------------------------MNDNNHNQPNTPAV
A0A2V5U130      ------------------------------------------------MNNNNHPNAAAV
A0A2V6C237      ------------------------------------------------MNNNNHPNAAAV
A0A3R8L982      -----------------------------MPDTTNNRPPP----SAKLHSGDDDLVERRT
A0A6N6QBS9      --------------------------------------------------MKYPYSSHNT
A0A2E7HPU9      -------------------------MRRKKYYEHDEELDL----LDEEDGLGGGTSRRAR
D5EML0          -------------------------------------MGK----DDFTIEANASTTSVFG
A0A7C4PPJ4      --------------------------------------------------MSNNSSPEAR
A0A3C1C1M3      ----------MTQPNFPPSNLPPASGQPPGAPIYYGGGDP----YSGGMPMDSGPLQSLN
A0A2S7U4L6      ---------------------------------------------MQPNNSLNTSDATLH
A0A2E9EYJ1      --------------------------------------------------MAKQSETKLH
A0A258AXR6      -------------------------------------------------MNESGTELQKH
A0A3D3NZQ6      -------------------------------------------------MSEASPDLQNH
A0A1T4WVZ9      -------------------------------------------------MRETSNELQQQ
A0A4R7SSI6      -------------------------------------------------MRDTGNELQQQ
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      DKEYRSTGAEEPVVSNRIGISNVRQALSRWWIMLIFGVLGYFAALYYM-SINPPSSEAIA
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      TLAEGDAHDEGARVSNRSAAGLLRVALERWWLILIFMVLGYVGALYYL-SVKEPETMAMA
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ---------------------------------------------MVATSNVTANY----
R7E1V8          ---------------------------------------------MVASSNVTANY----
A0A2E0R252      DPPQNGYGNEAPASNGKGIKDYVRWFLRRFWIFLITCLGGYFLGLYVA-SLTPVTYQSQA
A0A3E1EF48      -------------MATKTFADYLNWLKRYAWIAVLTTITGTFYGFYLF-TITPKTYQSWT
A0A2A2PVG8      SRSYAPDSDANETGQSRGLQDYLRWFLRRFWIFLIAVVGGYFLGLYLY-SVTPPTYQSSA
A0A2E0R421      HHQQPLEENLHSNPQARGLQDYVRWFIHRFWILPITIVSGILIGHYVY-THTPHTYQSSA
A0A2E5EJ69      FPESHDLGQQTQVEKEFSLRDSVDVVLDHAWLIILIFAACFGGAYYYL-KTATVIYESRA
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      -----------------------MLLRKYWWVVAFGVALGTGIAAWLV-ASQKQIYMSQA
A0A2E7ALI1      ---------------------------------------------------PPASYLPDW
A0A178IDB9      AARVPDQAQAGGNLAHFSPRNLLNMFLERWWIGLIAGAAIATVFILAQ-PKLAPVYRSEV
A0A290QD69      SSEQPQTKPAGGG---FSPKSLLNMFLERWWIGLIVAAAVAAAFVLSQ-PKPEPIYKTEV
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      PYYGHSAGMMDRINISIHLRRYIKMLKSRWPFVILTAILGTAYMGFKA-FGDKTFFQGKS
A0A178IFJ2      SPFGEPPPFAGGSLPRLDIRQILLCIRERWIVAVSLAILVCVLLGVWL-LNQPKVFQASA
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      MNSKTQPSGKDSKLDGSSIIRTVLAYEDYWRLMIILVLIGLLGGTCYF-IYARATYESQA
A0A3D3LEQ6      MNPRQSSNSQKGKLDSSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYARATFESTA
A0A3D3NW23      MNPRQSSKSQKGKLDSSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYARATFESTA
A0A2A2R174      QYSQTQVGDTSSDHGMSLNRELWQVLVEKAWLIACIMAAAAAIGVWVG-VRSPVVYQSKA
A0A1H2DTI1      TAAMSQAGGRVPGTFMSRLHRYKLLVKKFWWILLFCTAVGIAIQAYKI-AHEVPNYASTA
A0A1H1MGC9      SYSGYGSPGHGDNQMQRSMQDYVLILRERAWYIVLVFALVFSAATIFT-FTRVPQYQSVA
A0A1V5L462      SSGREGGHTDLGETLRSLSHRARLLLQSYWWILLLCLSIGLLVQAVRV-KSMRDAWESSA
A0A3D3LGD3      -------------MKIERLQDKVQVF-----------------------ERSSDNFMANS
A0A350ARX4      DLDESSGSLDWGERLQRIYFESKRLLAIWWWIVLLAVAIGIGWQAYRE-LNREPVYVSYA
B5JIS2          SGSRNSNTEDTLAGVVTQIRSFFAIIRSRWLSGVVSALVVGSAFAYLF-LNDKPEHTAVS
A0A6N6ZC77      FDDKPKAAGDWQDQARHYWQLAKLLLRRYWWLPLLTLVLGASWRGWQA-QNDRPTYRWGA
A0A7C5H7K5      PYPHQYPDYPRKDHFAELLGYTKRVLMLRWWILLLMMMAGCLGGVAFV-YLSPPKYVSEG
A0A538NJ59      LAGPMDQDANLLPSF--RIQRFFTFLLKYWWVPVLTLALSLGGAIWYF-FWEPPTYVSKS
A0A2A2R3V9      SITPPPTLSSWSAAFFTKLHRYRALVKRRWYVPLLTLSVGLCIQAYRF-AQIQPTYISSG
A0A3C1VFY9      SALTAPDRHAWGRKFFSRVQRYRNLLLRRWWVLVVCLVLALGIEAVHI-QFTPPEFISVG
A0A2V2SMX4      TVSTTQHQHAWRARFFTRLQRLRGLLLAKWWIPALGVALGVGIQASRS-ITEKPSYVSTG
A0A522AC27      TPTPTHDRSSWAARFHSRVYRYKRLLKQRWWIPFSCVFIALVIQGALS-WFAPQRFISIG
A0A6M1RFD0      QPAP-ENRSVRSARFFTVLQRWRSLLRRHWWVLPGCALLAMAVHLIVV-WNSPPAYASRG
A0A7C3HXH0      QPVP-ENRSVRSARFFTVLQRWRSLLRRYWWILPGCALLAMAVHLLIL-WNSPPAYASQG
A0A1H2GQN6      -------MSVSESIDLPHFNDYWRVIRARFGIILTLFILTFGTGYFVSAFVLQKQYGGTV
A0A512M3Y3      -----MQKGKKLIITFQDVFLFLTRFVKHWKIASLLFSLGLAASLLYY-TYGRPTYYSRS
A0A4P5R5J1      PTSQLPAGTSAINRVRVQGIRYVYLLKKRWWVLVLLLSLGLCIGAWTA-MQQPPAFRSSG
A0A4P5YK43      PPPNQGTSLVDRINISIHFRRYFKIISRRWWIPFLLVLVGTGIALYVA-LTTPNKYRAYS
A0A2A2RPW6      TTEDVTQQSPIGGLSSVALRDFWQALLDKAWLVVCIMLAAAALGVWHG-ARSPVVYQSKA
B1ZT68          AADRRNP--QANTGFRITPRDLLQMFQERWLLGLFLGAIAAGVFVYFQ-PEKVPLYYSEV
W0J7C2          AGNRPSPGRPRAASIRRTPRDFLDMFAERWWIGALAGAAAAALIVVFR-PHFEPIYRTEV
B4D1I7          TPARDQDAASWWYLIHTKIYRYRALLRKYWWMVLFTTCAGMAIGAWML-AHQQVVYVSTG
A0A353F286      --------------------------------------------------MIPEKYESTS
A0A354FSA6      -----MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIPEKYESTS
A0A3B9GA54      -----MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIPEKYESTS
A0A520LEH8      -----MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIPEKYESTS
A0A6B2M0T8      NPNSSQRNSGNSISSEKSWLDYLFVIREHWMLALLVALSVSGFYAYKK-LQTVPLYKSVA
A0A2D7B7R6      ----------METGNTNSPQDILRSAKSHYAIVLIIIVACTFTAYMQT-RKMTAHYRSTA
A0A2E5K4P7      GYGYNYGGYDAEPQEHRSLKDYIIIFRERFWLFLFCFAIIITGVLLYT-LKKPKEYKSVA
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      APLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTPPSFQSTS
A0A2V6EBU2      APLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTPPSFQSTS
A0A2V6EY06      APLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTPPSFQSTS
A0A2V6ME53      APLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTPPSFQSTS
A0A538NUU0      APLERPGAAPWSTAFFTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTPPSFQSTS
A0A2V6NIJ1      PPPVRPAAAPWSTAFFTRLYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTPPSFQSTS
A0A2V6C292      PPPERPAAAPWSTAFFTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTPPSFQSTS
A0A2V6D2X0      PPPERPAAAPWSTAFFTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTPPSFQSTS
A0A2V5ZUK1      ATRLQNLSTSWSAAFITRLHRYKSLLLRRWWIPVLTICLGLFVEAFLI-YQTPPQYQSTS
A0A2V5XFN9      STAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTPPSYQSTS
A0A2V6EZC8      STAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTPPSYQSTS
A0A2V6I7Z5      STAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTPPSYQSTS
A0A3B9LCP2      SAAERSTPASWSTAFITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTPPSFLSTS
A0A3C0R669      SAAERSTPASWSTAFITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTPPSFLSTS
A0A2V6EID2      PAVERSTPAAWSNTLITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMPPSFLSTS
A0A2V6MHB0      PAVERSTPAAWSNTLITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMPPSFLSTS
A0A2W5YWL9      ALAERTNPGSWSTAFITRIHRYKSLLKRRWWIPLLTICLGLFVQSWLI-FQTPPSFLSTS
A0A2V5NH62      ATTDRPVSAPWSTAFITRLHRYKALLQRRWWIPVLTICLGLFVQAWFI-YQTPPSFESRS
A0A2W6A620      AATDRPASAPWSTAFITRLHRYKSLLQRRWWIPVLTICLGLFVQSWLS-YQTPPLFQSMS
A0A2V5PIJ4      AAPDHPVSPIWTTKFVTRFHRYRALLLRRWWILLLTVCMGLFVQAWMV-YQRAPSFLSRS
A0A2V6K2G8      STAVKNLSTSWSAAFVTRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTPPSYQSTS
A0A2V5W206      TTAGKNLSTSWSTVFITRLHRYKSLFLRRWWIPVLTTCLGLFVEAFLI-YQMPPSYLSAS
A0A2V6MW77      ATVGKNLSTSWSAAFITRLHRYKALFLRRWWIPVLTTCLGLFVEAFLI-YQMPPSYLSAS
A0A6N4WVA3      QDEKHTKTVDYTELFQQIVYRTKIVLRRYWWVIPLAVALGVCAKAVQS-HFKEPFYLSKA
A0A0R2XPB1      QDENNTKTVDYTELFQQIVYRAKIVLRRYWWVIPLAITLGVSYKAVES-FVADPFYKSTS
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      QDEQNTKTVDYTELFQQIVYRAKIVLRRYWWIIPLAIALGVTYKAVES-FVADPFYKSTA
A0A2G4GZN8      GYGNNPGYGKGGAGESNPIQNYLLMLKERYWWILLASLVFLTLSLLNT-YNVVPEYRATG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      GYGSYGQN-ADEQGPQRTFKDYLFLIRERIWYLIIVFFIIFLGSILYT-FNKTKLYTAYS
A0A2D7F4D9      GYGSYGNV-SEEQGPQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKTKLYTAYA
A0A3R7RBR8      GYGSYGNV-SEEQGPQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKTKLYTAYA
A0A2E0NH28      ---------GYGTIAQRSISDYFLMLRERVWYLVVAFFIIFSGSILYT-FNKTKVYTAYV
A0A368BGT4      GYGGYGGGYGGGAGPQRSFKDYFLIFRERIWYLLVSFFIIFSGTIMYT-FNKTKVYTAVS
A0A317ZP96      --GGYG---GGGGGPQRSFKDYFLMFRERIWYLIVAFFIIFSGSILYT-FNKTKVYTSAA
A0A350AS32      --GGYE---GGSSAPQRSFKDYLLMFRERVWYLIVAFFIIFSGSILYT-FNKTKVYTAVA
A0A6N6PLV8      --------MNETNEVKLHFLDYWRTIKVRMGLILLTFFLVMVTAGVTT-YFLPRQYLSKV
A0A290QE54      QSG-------DQLVERRTIRDYLIILRERLWIALPLALLVAVGFGYWK-ARAVPMYQARA
A0A1H1SWX2      APGPSLHGNDQQVVEKRSLRDYYVILRERLWIALPVALLVALSIGYYQ-AQEIPMYSSTA
A0A1D8AZK8      QRAASLHGNDHQVVERRSLRDYYIILRERLWIALPVALLVSLSVGYYK-AQETPMYSSVA
A0A4Q1C9I5      KHGASLHGNEPHVSERRTLRDYYIMLRERLWIALPVAVIVALGFGYVK-STETKMYASTA
A0A2E0V4K6      RELPDEDEVLEFPGRARGLPKVFWEMLGKWYFPVMGAILGLFASAYYL-KKTPERFASTA
A0A1G3ZL71      ASTRAPQGGEEHLVERRTLRDYYVIIRERLWIALPLALLVSLGLGYWK-MRETPMYESRA
A0A556QP09      GR-------DEEIIERRTLRDYYIILRERLWIALPLALVISIGMAYYQ-SRATPLYRSAA
A0A2T6DX88      AQ-------GEVLNERRTARDYLIILRERVWIALPIGILVGVILGYLQ-ARVTPLYQSQA
A0A2T6CWI7      HD-------DETVSERRTLRDYYIMLRERLWIALPLALLVAVGYAYKN-LQETPRYAATA
A0A3E1E5C8      DK-------EEPAVERRSLRDYYIILREKLWIALPLALLVSLSLGYYE-ASRPKMYAATA
B1ZZ74          RD-------EETLVERRGLRDYYIILRERLWIALPLALLVAVPLGYFR-ARETPLYAAMA
A0A2E6NAH3      NYGFGGGYGDGGAGPQRSFKDYLLMFRERIWYLIVSLFIIFSGSILYT-FNKTKVYTAAS
A0A2A5VZA5      NYGYGGYGGGGEQAPQRSIKDYILIFRERIWWLIVSFFIIFSGSLLYT-FNKTKVYTSVA
A0A424R295      NYGYGGYGGGGEQAPQRSIKDYILIFRERIWWLIVSFFIIFSGXLLYT-FNKTKVYTSVA
B4CZV9          ----MIPGTKKPAFTLHDIFLYVAIASKHARLMVLLICFALTAGLTYY-VFAKPVYYAHA
A0A0E3YV65      ----------------MSPREILLSIRERALTSFVLALLICSLLGGWL-LSRPKVYQSRS
W0J900          SAPRSEPPFEGGSLPRLDIRQILLCIRERWIVSTSLATLVCVLLGVWL-LKQPKVFQASA
A0A3B9FM17      ------------------------------------------------------------
A0A2D7WMI4      NEIGSLSQNPPNQKV-KGISDFLLILRDRWMLSLTLALPIALGFTYKS-LQVPEFYASSS
A0A2D6VHX5      EENSNYGDYSPKSKKNKTVSEFLLILRDRWLLAVTLALPFSLAYVYKE-LQVPEMYQSSS
A0A2D8I214      ENLNSQGSVRSKSKT-KSIAEILLVIRDRWLLALSLALPISLGYVYLK-FQDTEFFQSSS
A0A1Z8VL41      EDIDRPLSTKPKGRI-RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVPEFFRSES
A0A2E6TNA4      EDIDRSLSTKPKGRV-RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVPEFFRSES
A0A1Z8RG47      DTTEIHSGGRSKSNI-KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSPEFYKSSS
A0A1Z8RJJ5      DTTEIHSGGRSKSNI-KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSPEFYKSSS
A0A2D7V631      DSISVNAGGKPKSRI-KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGPEYYASSS
A0A354RA24      DSISVNAGGKPKSRI-KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGPEYYASSS
A0A2E9RV62      PDPSQEIIQPASRSRLRGVFDYFLIIRDRWLLATALSLPIALGFVYKE-YQQPSIYQSSS
A0A2E4AY96      PESFKN---QGDTIKVRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVPEFFSSSS
A0A3B9B9P4      PESFKN---QGDTIKVRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVPEFFSSSS
A0A2D5Y6N6      NKMTGDGGASPTGSKIKGIGDFILILRDRWLIALTLSLPXALAYIYVK-SQGIELFRSSA
A0A2E7HSS8      DNFSTP-PQPKGKPKIKGVSDFLLIIRDRWLLSLALSLPFALGFVFVK-QQVHEYYRSSS
A0A2D8VCK3      DNFSSS-PVQKGKSKIKGLSDFLLIVRDRWLLAIALSLPCALLWVFYK-QQEPDKFQSSC
A0A350QVY4      DNFSSP-PVQKGKSKIKGLSDFLLIIRDRWLLAIALSLPCALFWVFYK-QQEPDKFASSC
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      DGTSSHVPSGAPGPKLKGVIEYLLIIRDRWLLAIALSLPISLWYVYDR-YQEPELFRSSA
R7E4L8          ---MPVSVIQPEDNDIFSFRFIFSTARRYWPWILACALLGGGLAYFIC-ARQGYLYQKTA
A0A4Q3BVY2      ----MSNSSDKPKFDPLRLISQVLSYAKHVRLMLLMLAVGVMAGIIVY-LFTTPSYSSTA
A0A4P6PCA7      GAAHQPAPFNLKGGGGFKPMRLLFVVLRRWYIPVIFGLIGIAVGILRA-LYAVPVYQAKA
A0A2T6DSN5      TPSKRNEAQSPTKGFNFSPRSLLNMFLERWWIGLIAGALGAVAFVLAQ-PKQDPVYWTEV
A0A317ZIW7      NDDNQAGKVDYAEILHKSIYRTKIVLKRFWWVLPVAVSLGVAYKAIES-FLEAPNYRSNA
A0A7C4PPT4      ----MLPGLKRRSINFADIVLYVAIALKHWRLMVLLVFFALSLGLTFF-VYVKPVYMAKS
A0A7C4QZX4      ----MLSKLQKRAFSFAEVVYYLALFLKHLRLMVLLLCLSLVGGLFYY-VYARPIYSSKS
A0A3D4HHL8      RYDDVEPKIEWSELIHVWLFRAKLLLKRFWWVFLITISLGVAFQTYDV-LITPPSYVSYS
A0A366HV03      -----MSAPIKKGAPGVDMLHYAVGYLKYGRMMILLLLLGVLAGVCYY-TYSPAVYHSRS
A0A6G6K911      ------------------MLHYAVGYLKYGRMMILLLLLGVLAGVCYY-VYSPAVYQSRS
A0A5R8KAF2      GR-----------------------------LMVIMACLGVLAGLCYF-VYTTPLYSSNA
A0A7C4LRZ6      TVVSFDTPLMDRINIYFRFRRYFKMLARRWFIVLLTTGAAGGYAFHLA-MKQPPVYQAIS
A0A351MR11      --VPAPGYGQAAG--VNPLANYMLMLRERMWYLVLTVLVFVTAALIYT-VNATPEYRASG
A0A388PR45      GNYGNYAAGGASGGKGGPFTVYLAMLRERWWWVLLSVLVFVTIAVVYT-STIIPEYRAAG
A0A388QR61      GAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIVPEYRAAG
A0A4P5YHI0      GAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIVPEYRAAG
A0A2A2RS01      GQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTMPEYRAVG
A0A2A2Y1A7      GQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTMPEYRAVG
A0A388PDH9      GQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLLGVTIALVLT-YQTMPEYRAIG
A0A2G4H1E7      GSYGGGPRGGAGG--ASPISNYLLMLRERYWWVLLTSLVFLTLSLLNT-YNTVPEFQATG
A0A2G4GZA6      GNYGAYNRGGAGE--GNPIQNYLLMLRERYWWILLSTLVFLTLSLLNT-YNTVPEYRATG
A0A388P514      GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTVPEYRATG
A0A2A2YG59      GNYGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTVPEYRATG
A0A2G4F7D5      GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTVPEYRATG
A0A2V2SDN0      DLMAPPDHFVATSRLFVRLHRHQVLLREYWWVLALILLVTVVPALVIT-LATPPAYQSDA
A0A1V6GL40      -VQSFHDRPNTAARLHARLSRFRNLLREKWWVLVLGAMAGAIIKIVLL-WNAPPSYVSVG
A0A2V5X6Z6      DLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSLPAYESKA
A0A2V5VGZ7      DLFAPANRFVSASRLYGRLHRWWLLLRRYWWLIVLILVLGLGPAGFLS-FNSPPAYESKA
A0A2V5U130      DLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGVLS-FNSLPAYESKA
A0A2V6C237      DLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSLPAYESKA
A0A3R8L982      LRDYY------------------IIVRERLWIALPLALLAALGYAYYK-SRELPMYQSTA
A0A6N6QBS9      PLPGYGTSMVDRINLYLHFRRYFKILAERWLLVVVCTVTGLGIGTWQA-MSKPDIFQARS
A0A2E7HPU9      TRQLI------------------GDILVRWHWMALGLVLGLLGSFYYL-SKAPKLYEATS
D5EML0          LTDLL------------------AVVRKHWMSGAFIGLVVAGLFVASV-LTKEKLYQASA
A0A7C4PPJ4      GVDSFDTPLMDRINLYFRLRRYIKMLARRWFILLLTVAVGVGIAAHRA-YSLPKIYRAIS
A0A3C1C1M3      PMRLL------------------QIARNHWVILLLA--ILFAGGAAAF-YLSRATEIYQA
A0A2S7U4L6      AVDYL------------------QILKNRYGIILLTFILVVLTAAVIT-YVMPKKYEAIA
A0A2E9EYJ1      ALDYW------------------QVAXNRYAVILLTXALVXMTALVIA-YLRPSEXLGRV
A0A258AXR6      AMDTW------------------QVVKNRFGLIALSFLLIFAAAAVLT-YIMPRKYRGHV
A0A3D3NZQ6      ALDSW------------------RVIRGRAGLIILSFLLVFGSAAMLT-YIMPRKYRGRV
A0A1T4WVZ9      ALDSW------------------QVIRNRFGLIILSFLLVFATAAIIT-YIMPRKYRGRV
A0A4R7SSI6      AIDSW------------------QVIRNRFGLIILSFLLVFATAAIIT-YIMPRKYRGLV
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      -------------------------------------------------DLEDLESVGYV
A0A2S7U0Z3      VLEVNIQTGQLLGQDLVQERMTPDII--------------------LATEASKLMGPAIL
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      SLKVTTKQQLLVGNEVEQDSMVFRDQM-------------------LGTIAAELVGLEQL
A0A2N8IR72      ------------------------------------------MTDAWNGKAVIVRHSPVL
A0A2N8IV96      ----------------------------------------------IPMQYSVLTSAEVL
R7E1V8          ----------------------------------------------IPMQYSVLTSTEVL
A0A2E0R252      TIEIERVKKEDADVDEEERIRMGGASE-------------------MFSVTEKLRLPNLY
A0A3E1EF48      SIQIARVKQEAADVAEEERIRLGVPAE-------------------LQATLEKLRMPRIY
A0A2A2PVG8      TIEILRVKRDAADIAEEEKIRMTGAAE-------------------MLSASERIRLPQIY
A0A2E0R421      TIEVLRIKKDDADVDEDEVLRMNGVAE-------------------MMSASEKLRMPALY
A0A2E5EJ69      TIIVEFAGPTVSYDQNSRNDFRLMRFDI------------------LNTMAQTVGRREVI
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      RMMVSGKINLPEGGSFSEEMTHF-----------------------MNTQGELMKDEAIR
A0A2E7ALI1      ITGF------------------------------------------LNRGKRALPETGSN
A0A178IDB9      KLLFEPQKDQVIGIKEVVDTTTTSNLQ-------------------LNLHIEQMLSTTFY
A0A290QD69      KLLFENQKDNVIGMAGVVETTTNSGMQ-------------------LQLHIEQMLSRTFY
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      IIGITSKIRIPGEKRVEYLKPAPTY---------------------WTDLSRSMDSDTVW
A0A178IFJ2      TLLVDRAEKVLGNEMTKVVDDSVGGSK---------------NDPSFDTHLAQITSREMV
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      LIRANSFLMSSEAAVGNANADRTYRQMRALMDQLNSGYVILEAARAIGVAGPSTTFDGLR
A0A3D3LEQ6      LIRINQFVDAAKAASG-AQRDNNIALMRSLSKQLTSDFYQLEAAKKLGVATASTTAVDLR
A0A3D3NW23      LIRINQFVDAAKAASG-AQRDNNIALMRSLSKQLTSDFYQLEAAKKLGVATASTTAVDLR
A0A2A2R174      VIELDFGEKKVLAIDDFEKRDKGGGVDF------------------LNTIANNVRSSAII
A0A1H2DTI1      RLMINTKINVTESSVSTTEVGNY-----------------------METQIALMTSQKVY
A0A1H1MGC9      SVQVFRRDPVVMQVQGVVDNEIRSAED-------------------LNTQVKVLESFAIV
A0A1V5L462      QLIIQGNIEIQEADRLREVATNF-----------------------HDNQLHLMTGQWVS
A0A3D3LGD3      DVV-------------------------------------------VKNEFESIIKPETL
A0A350ARX4      EMMVSGRFALPDNVYREELSNF------------------------FGTQITLMLSDRVQ
B5JIS2          TMLAQSPLDELLHSDQQARERKKDAQENF-----------------LQNHLSVMKSRRFS
A0A6N6ZC77      KIMLSGFVAQQLNTGVQEQFSYW-----------------------FGNQRAFLESSDVR
A0A7C5H7K5      RMIVNVKLTIPEGSAYSEELGNF-----------------------LGTQAALMESPRVI
A0A538NJ59      RMWETVTLRLPEGAMFSEDMQNF-----------------------LGTQSELLESGQLR
A0A2A2R3V9      KLIVSPRMFLPENAVVSDESVNF-----------------------IGTQLELMQSAEVR
A0A3C1VFY9      QMIVSIKVNIQQGSLYTEELGNF-----------------------LGTQAALMQGNEVL
A0A2V2SMX4      RMIVSMKLSIPEGQLYTEEMGNF-----------------------LGTQAALMQSDVVI
A0A522AC27      RMIVSIKLSIQETSVYTEELSNF-----------------------LGTQQALMQSPVVV
A0A6M1RFD0      KMIVNVRIQVQTGANYIEELSNF-----------------------LGTQVALMQSDTVL
A0A7C3HXH0      RMIVNVKIQVQTGANYIEEFSNF-----------------------LGTQVALMQSATVL
A0A1H2GQN6      DIRVFKQDKDVQVFSQSDRNAFDPIF--------------------FESERSTIESKEIL
A0A512M3Y3      LVAYDSVNLPIKSETSDGSDGRG-----------------------KWAHISNVLTSALN
A0A4P5R5J1      RMMVAGQLRLGDNAAAYSEELMNF----------------------FGTQIELMQSAAVL
A0A4P5YK43      TLGF--TSRVETGVGGKAQVVELADGF-------------------VEHQLVLMKSPRVR
A0A2A2RPW6      VLYFDSGEVNVINIQEVEKREKAGIDL-------------------LNSIANNLKSSVIL
B1ZT68          SLLFETRKDRVLNIQDVVDTGVRSTTE-------------------LNVHAEQLRSQTFF
W0J7C2          SLLFEARKDRVLNIQEVVDTTLQTAAE-------------------LNTHIEQLRSKTFA
B4D1I7          RIMASGKINLPEGVTYTEEMNLF-----------------------ISTQRELMQDEAVR
A0A353F286      VVQVHPSTIAITPFRGQSAVNPGSQMTAQY----------------LQNEFESIIAPETL
A0A354FSA6      VVQVHPSTIAITPFRGQSAVNPGSQMTAQY----------------LQNEFESIIAPETL
A0A3B9GA54      VVQVHPSTIAITPFRGQSAVNPGSQMTAQY----------------LQNEFESIIAPETL
A0A520LEH8      VVQVHPSTIAITPFRGQSAVNPGSQMTAQY----------------LQNEFESIIAPETL
A0A6B2M0T8      ILLFELQQDKVINIQQVVDNSLGRSADFI-----------------LRNHLTDLRSNSFR
A0A2D7B7R6      LLVVDTQQFVESDADASNDVRDLDI---------------------LTTLVGRISTTPVL
A0A2E5K4P7      ELRMERFGNTPIDTGNEKNQDNIGSHE------------------DFNTWANILKSPTIT
A0A2V6F9Q9      -----------------------------------------------------MQSAEVR
A0A2V6NZZ3      KMMLAGKLNINQGPVYSEDNVNF-----------------------YGTQIQLMQSAEVR
A0A2V6EBU2      KMMLAGKLNINQGPVYSEDNVNF-----------------------YGTQIQLMQSAEVR
A0A2V6EY06      KMMLAGKLNINQGPVYSEDNVNF-----------------------YGTQIQLMQSAEVR
A0A2V6ME53      KMMMAGKLNINQGPVYSEDNVNF-----------------------YGTQIQLMQSAEVR
A0A538NUU0      KMMMAGKLNINQGPVYSEDNVNF-----------------------YGTQIQLMQSAEVR
A0A2V6NIJ1      KMMMAGKLNINQGPVYSEDNVNF-----------------------YGTQIQLMQSAEVR
A0A2V6C292      KMMMAGKLNINQGPVYSEDNVNF-----------------------YGTQIQLMQSAEVR
A0A2V6D2X0      KMMMAGKLNINQGPVYSEDNVNF-----------------------YGTQIQLMQSAEVR
A0A2V5ZUK1      KMMLAGKLNIAQGAVYSEDAVNF-----------------------YGTQIQLMQSAEVK
A0A2V5XFN9      KMMMAGKLNIAQGAVYSEDAVNF-----------------------YGTQIQLMQSAEVR
A0A2V6EZC8      KMMMAGKLNIAQGAVYSEDAVNF-----------------------YGTQIQLMQSAEVR
A0A2V6I7Z5      KMMMAGKLNIAQGAVYSEDAVNF-----------------------YGTQIQLMQSAEVR
A0A3B9LCP2      KMMLAGKLNIAQGAVYSEDSVNF-----------------------YGTQIQLMQSAEVK
A0A3C0R669      KMMLAGKLNIAQGAVYSEDSVNF-----------------------YGTQIQLMQSAEVK
A0A2V6EID2      KMMLAGKLNIAQGAVYSEDSVNF-----------------------YGTQIQLMQSAEVK
A0A2V6MHB0      KMMLAGKLNIAQGAVYSEDSVNF-----------------------YGTQIQLMQSAEVK
A0A2W5YWL9      KMMLAGKLNVNSSAVYSEDNVNF-----------------------YGTQIQLMQSTEVR
A0A2V5NH62      KMMLAGKLNISQSAVYSEDSVNF-----------------------YGTQIQLMQSQEVR
A0A2W6A620      KMMLAGKMNISQSAVYSEDSVNF-----------------------YGTQIQLMQSAEVR
A0A2V5PIJ4      KMMLAGKLNISQNAVYSEDSSNF-----------------------YGTQIQLMQSDQVK
A0A2V6K2G8      KMMLAGKLNIAQGAVYSEDSVNF-----------------------YGTQIQLMQSAEVR
A0A2V5W206      KMMLAGKLNIAQGAVYSEDSVNF-----------------------YGTQIQLMQSAEVR
A0A2V6MW77      KMMLAGKLNIAQGAVYSEDSVNF-----------------------YGTQIQLMQSAEVK
A0A6N4WVA3      QMIVSGRIDLPENDVYAEERDNF-----------------------FGTQIELMLSEQVQ
A0A0R2XPB1      QMIVSGRIALPENDMYAEERDNF-----------------------IGTQIELMLSDQVQ
A0A348NQP1      --------------MYAEERDNF-----------------------IGTQIELMLSDQVQ
A0A357FV58      QMIVSGRIALPENDMYAEERDNF-----------------------IGTQIELMLSDQVQ
A0A2G4GZN8      RLRV---------------FRLSPNINGGS--SAADDNFKIVSNDDFFTAIEAMRSANII
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      TIEL---------------LRDDPTVMLSS--SGNLEQNEIRTAEDLNTHISKLESITVI
A0A2D7F4D9      TIEL---------------LRDDPTVM-NS--ASNLEQNEIRSSEDLNTHISRLESVSII
A0A3R7RBR8      TIEL---------------LRDDPTVM-NS--ASNLEQNEIRSSEDLNTHISRLESVSII
A0A2E0NH28      SVQL---------------LRDDPSAMRDE---TEMEPNQILSAEDLNTQISVLESLSII
A0A368BGT4      QVQL---------------FRDDASALGAYGQGAEMELNQILGAEDFNTQIIVFESLNIM
A0A317ZP96      TVQL---------------LRDDPSALGDT---VEMEQNQIRSAEDLNTQISLLESGTII
A0A350AS32      QVQL---------------LRDDPSAMGNI-PGMEMEPNQIRSAEDLNTQISVLESASII
A0A6N6PLV8      RMEVKQDNSGPVSAFGGNTGKTFDPQF-------------------VATQFQILQTTEIL
A0A290QE54      TMQIEKPEKIVTSQEIVDISINSDIEL--------------------NTYLQVLGSAKLR
A0A1H1SWX2      TMQFERPERVVQNEQVVDTAVRSEVDL--------------------GTYLQILQSGRLR
A0A1D8AZK8      TMQFERPERVVQNEQVVDTSVRSDVDL--------------------NTYIQILTSGRLR
A0A4Q1C9I5      TMQFERPERVVLNEQVVDTSIRHDVDL--------------------NTYLQILTSGKLR
A0A2E0V4K6      TLLVKQNLSGVISSEEVEDLDLRSDNV-------------------MNTIAAQVTRVGIL
A0A1G3ZL71      TLQFEREERVMNQQKVVELAPQSEVDI--------------------NTYVHQLNSGTLR
A0A556QP09      TLQIEKPEKVVTTVDVVDTGINSDIEL--------------------NTYLQVIASAKMR
A0A2T6DX88      TMQIEKPEKIVTSQEVVDLSVTNDIDL--------------------NTYLQVLNSTKLR
A0A2T6CWI7      RMQFEKPDRIVMAEGVVDTAVRSEVDM--------------------NTHTEVLKSSSLR
A0A3E1E5C8      TMQFEKADTVVTTQGVVDPSVRSELEL--------------------RSNLEKLNSQRLR
B1ZZ74          TMQFEKPETVVTSQVVVDPSVRSDIEL--------------------NTNIQVLNSARMR
A0A2E6NAH3      QVQL---------------FRDDASALGAIGQGMEMEQNQILSAEDLNTQISVMESLSII
A0A2A5VZA5      VVRL---------------LRDDPSAMGV---SVELAQNQIVGAEDLNTQISLLQSGKII
A0A424R295      VVRL---------------LRDDPSAMGV---SVELAQNQIVGAEDLNTQISLLQSGKII
B4CZV9          LIHL------EYLARPLDTDKLYEDGR-------------------LSAFVAQFTEPQIM
A0A0E3YV65      RLLV---------DRSERVV--DIAQV------VDQSVGGGKNDAMFDTYLAQITSPAMI
W0J900          TLLV---------GRIEKVLGNEITNV------VDDSVGGSKNDPAFDTHLAQITSREMI
A0A3B9FM17      --------------------ESHLEGL-------------------ISRHTEGLNSEKLR
A0A2D7WMI4      SFRLIPPPAIIN-LQKVD-REQQLQPL-------------------VSKHLDGLNSQELR
A0A2D6VHX5      SFVLIPPPKILN-LQKVD-RDQQVNGL-------------------ISKHLDGLNSQELR
A0A2D8I214      SFRLIPPPAVLN-LQKVD-RDTQVQGL-------------------VAKHREGLNSQELK
A0A1Z8VL41      SFRLXPPPXIIN-LQKVD-RXSXINTL-------------------XSRHLDGINSQXLR
A0A2E6TNA4      SFRLIPPVEVIN-LQKVD-RSSQINTL-------------------ISRHLDGINSQELR
A0A1Z8RG47      SFRLIPPPAILN-LQKVE-RDQHVQGL-------------------VAKHLDGLNSQELR
A0A1Z8RJJ5      SFRLIPPPAILN-LQKVE-RDQHVQGL-------------------VAKHLDGLNSQELR
A0A2D7V631      SFRLIPPPAILN-LQKVE-RDQHVQGL-------------------VAKHLDGLNSQELR
A0A354RA24      SFRLIPPPAILN-LQKVE-RDQHVQGL-------------------VAKHLDGLNSQELR
A0A2E9RV62      SFRLIPPPAILN-LQPVE-QANQLVDL-------------------VRKHTEGLNSQELR
A0A2E4AY96      SFRLIPPPAIIN-LQKVDQQEQQFQLL-------------------VGKHRDGLNSQELR
A0A3B9B9P4      SFRLIPPPAIIN-LQKVDQQEQQFQLL-------------------VGKHRDGLNSQELR
A0A2D5Y6N6      SFRLIPPPAILN-LQKVD-RDQHVQGL-------------------VAXHLDGLNSQDLR
A0A2E7HSS8      SFSLIPPPAILN-LRSVD-RDQHVEGL-------------------IAKHTEGLNSQQLR
A0A2D8VCK3      SFSLTPPPAILN-LQSVE-RESHLEGL-------------------ISRHTEGLNSEKLR
A0A350QVY4      SFSLTPPPAILN-LQSVE-RESHLEGL-------------------ISRHTEGLNSEKLR
A0A2E4ZYR7      -------------MQPVD-RDKYSARI-------------------IGQHLEGLRSGELR
A0A2E6TCV1      TFVIQPPLSIIDNMQPIE-RDKYSARI-------------------VGDHLHRLKEKELR
R7E4L8          RIML----------------RDDKQKNAQVSEIILSDLGFKPGEANLANESYVVKSSEVM
A0A4Q3BVY2      LVTMHSFGAPMV-DREVAETQQVSSFHRNFLNRLRSAPIQLAAAKRMGLVGDGATSEDIL
A0A4P6PCA7      EIEM---------SVQRPQFIQTEVNLEEGGGTLSEDVI-------FNTRFAKFRSPAME
A0A2T6DSN5      QLLF---------EPKEKKVLNITEVV----------DTTTSSSLDLHTHLARLRSETFL
A0A317ZIW7      QMML------------SGRISLPENEL------YAEERANF-----FGTQIELMESSQVK
A0A7C4PPT4      LIRY---------QALERPVDAEKVFR----------------DSSERELITRLTADHII
A0A7C4QZX4      LVRY---------LSLARPLDAENVLM----------------EQTDRVLLTRLTSPKIM
A0A3D4HHL8      QMIV------------SGRIALPEGAI------YSEELSNF-----FGTQMSLMQSHRVK
A0A366HV03      LIDY-----------------------------------KFFALPVAADGVDGSSVARAV
A0A6G6K911      LIDY-----------------------------------KFFALPVAADGVDGSTAVRAV
A0A5R8KAF2      VIYFRVFGSPLS-DKGMGDSAGSQTSALKYLPWELASDSNV---------LAAAKELGIV
A0A7C4LRZ6      KIGI-----------DSKVVTPYDQKA-----AVVVDLSSF-----YDTHLQYMQSSKVR
A0A351MR11      RLKV---------YKYAPNIT-GRGAG--------EELYAIMSADDFNTAIEVMKSSGII
A0A388PR45      RLRV---------YRLTPTIGTGNTGV--------DETQRIGSNDDFLTAIESMKSTAVI
A0A388QR61      RLRV---------YRLTPNLGNNNSAV--------EEAQRIGSNDDFLTAIESMKSSTVI
A0A4P5YHI0      RLRV---------YRLTPNLGNNNSAV--------EEAQRIGSNDDFLTAIESMKSSTVI
A0A2A2RS01      KLRV---------FRMAPDVTANNTAA--------NNNFNITTNDDFYTAVESMRSTGII
A0A2A2Y1A7      KLRV---------FRMAPDVTANNTAA--------NNNFNITTNDDFYTAVESMRSTGII
A0A388PDH9      KLRV---------FRMAPDVTVNNTTA--------NNNFNITTNDDFFTAVESMRSTSII
A0A2G4H1E7      RLRV---------FRLAPTINGGSSAA--------DDNFKIVSNDDFFTAVEEMRSANII
A0A2G4GZA6      RLRV---------FRLTPTINGGSSAA--------DDNFRIGSNDDFFTAVEAMRSANII
A0A388P514      RLRV---------FRLAPTINGGSSAA--------DDNFKIVSNDDFFTAVEAMRSANII
A0A2A2YG59      RLRV---------FRLAPTINGGSSAA--------DDNFKIVSNDDFFTAVEAMRSANII
A0A2G4F7D5      RLRV---------FRLAPTINGGSSAA--------DDNFKIVSNDDFFTAVEAMRSANII
A0A2V2SDN0      RMWL------------TGKLDLSEGRL------YTEELVNF-----LGTQADLLRSRVIQ
A0A1V6GL40      RMIV------------SMKLAIQPASL------YSEELSNF-----LGTQAALMQCGVVV
A0A2V5X6Z6      RMWL------------TGRLDIYEGRL------YTEELINF-----LGTQTELLRSPAIQ
A0A2V5VGZ7      RMWL------------TGKLDIYEGRL------YTEELINF-----LGTQAELLRSPAIQ
A0A2V5U130      RMWL------------TGRLDIYEGRL------YTEELINF-----LGTQAELLRSPAIQ
A0A2V6C237      RMWL------------TGRLDIYEGRL------YTEELINF-----LGTQTELLRSPAIQ
A0A3R8L982      TMQI---------EKPERVVTSQEVVD----TAVSSDAD-------LNTYLQIIGSQKLR
A0A6N6QBS9      VLAV------------PPKVKMSGGMQ----GAQIDEDARV-----TETQIAMMKGGAVI
A0A2E7HPU9      TLLVKDSARAAF-EGQRQDNADINLRSQEALGTIVEQIKNFELFEKIAKDPDVLALEGLI
D5EML0          SMTV---------ELTTANVMDIREVM----DTNVAHVNLLNTL--MNTHLERIKTRAIA
A0A7C4PPJ4      KIGI---------A--SRVVTPFDNKA-----AVLVDINSF-----YDTHLQYLQSTKVR
A0A3C1C1M3      EARI---------ELSTRRPRIVNKQDAMIEDRGYGDAEEI-----LNTQIQKFNSPSIL
A0A2S7U4L6      VVKI---------NPLGTNNQVLGSGS----SALMTRQF-------FGTEFKKIESDENL
A0A2E9EYJ1      QIXV---------QREARDIEVFRXTG----SVGXXGSDQLPYMTXMQTQFEIXQSRETX
A0A258AXR6      EMTI---------ERITQDINVFDRNR----GDSLAFTQEY-----IKTQFETITKPTTL
A0A3D3NZQ6      EMKI---------ERLQDKVQVFERSS----DNFMANSDVV-----VKNEFESITKPETL
A0A1T4WVZ9      EMKI---------ERLQNKVQVFQRNT----DDFMAPTDVV-----IKNEFESITKPETL
A0A4R7SSI6      EMKI---------ERMQNKVQVFQRST----DDFMAPSDVV-----IKNEFESITKPETL
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      DAAS--------------------------------------------------------
A0A2S7U0Z3      SATAQSPEVRALRNAIPPEFSFKPRYMRTEEELAFKPA----------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      QKVMQRPEVQVLEKVIPPQFSWKPKYWRDESQREFISA----------------------
A0A2N8IR72      ETAN--------------------------------------------------------
A0A2N8IV96      KVVS--------RKLNLAAEWGMT------------------------------------
R7E1V8          KVVS--------RKLNLAAEWGMT------------------------------------
A0A2E0R252      TNIAASPKFAEREDVA--SEKFHMPWE---------DV----------------------
A0A3E1EF48      QNVASNPLFANRPEVVPLSRRYVLPWEPFLAKKPNPEE----------------------
A0A2A2PVG8      VEAAKGQLFANRENIA--PAKKRFPWT---------KQ----------------------
A0A2E0R421      TQVAKSYLFENRDDVF--PDRFHLPWE---------KR----------------------
A0A2E5EJ69      DRAA--------ELIVDREQLS--------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      TRAE--------AYVRTTA-----------------------------------------
A0A2E7ALI1      TSNH--------------------------------------------------------
A0A178IDB9      EYVQSSFSSAEIEQIQAPYRNPDN------------------------------------
A0A290QD69      ESVQSSFTPKEIEQIQNAYRNPDS------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      SRTL--------EQVKEDH-----------------------------------------
A0A178IFJ2      QRVV--------ASFTPEEKTRVLAAWLD-------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      DDVM--------------------------------------------------------
A0A3D3LEQ6      ASLI--------------------------------------------------------
A0A3D3NW23      ASLI--------------------------------------------------------
A0A2A2R174      KRVVVGQSLTNHPYFTGGS-----------------------------------------
A0A1H2DTI1      TAAI--------NALKAKN-----------------------------------------
A0A1H1MGC9      QRVA--------DRLTGEDLKAFL------------------------------------
A0A1V5L462      ERAS--------ERVRALH-----------------------------------------
A0A3D3LGD3      YPVV--------DKLDLQLKWELPTRQ---------------------------------
A0A350ARX4      KQAK--------DRVLMLY-----------------------------------------
B5JIS2          VELA--------SEFTEDEKASIV------------------------------------
A0A6N6ZC77      KAAR--------ERVAAFY-----------------------------------------
A0A7C5H7K5      QRAF--------------------------------------------------------
A0A538NJ59      QLAL--------ARLSAPR-----------------------------------------
A0A2A2R3V9      SRAR--------ARVQALK-----------------------------------------
A0A3C1VFY9      NRAR--------ERVASQN-----------------------------------------
A0A2V2SMX4      HRAH--------LLVIAQN-----------------------------------------
A0A522AC27      QRAH--------ARAVAQR-----------------------------------------
A0A6M1RFD0      NRAA--------ERVHAGR-----------------------------------------
A0A7C3HXH0      NRAA--------DRVHATR-----------------------------------------
A0A1H2GQN6      YPVI--------KKLNLVEKWSQRYLHGER------------------------------
A0A512M3Y3      SRWLVEHTAKTLGLVETPGEYEMI------------------------------------
A0A4P5R5J1      KGAE--------TRVHALH-----------------------------------------
A0A4P5YK43      NKAQ--------EYMREIDAA---------------------------------------
A0A2A2RPW6      SRVVKANKLTNHVYFTQGT-----------------------------------------
B1ZT68          EYVLTSFNKEEAERIQRPYRDPTQ------------------------------------
W0J7C2          DYVLASFSTAEAELIRKAYADPLD------------------------------------
B4D1I7          QRAA--------NLVRSNN-----------------------------------------
A0A353F286      AMAA--------EKAQLPVQ----------------------------------------
A0A354FSA6      AMAA--------EKAQLPVQ----------------------------------------
A0A3B9GA54      AMAA--------EKAQLPVQ----------------------------------------
A0A520LEH8      AMAA--------EKAQLPVQ----------------------------------------
A0A6B2M0T8      NRVV--------DSLTTEEVNLIT------------------------------------
A0A2D7B7R6      SHVI-----EISPELQEHYKVDLN------------------------------------
A0A2E5K4P7      SMVE--------TRLKASEVDYNN------------------------------------
A0A2V6F9Q9      RGAA--------ELVWSTH-----------------------------------------
A0A2V6NZZ3      RAAA--------ALVRSTN-----------------------------------------
A0A2V6EBU2      RAAA--------ALVRSTN-----------------------------------------
A0A2V6EY06      RAAA--------ALVRSTN-----------------------------------------
A0A2V6ME53      RGAA--------ALVRSTN-----------------------------------------
A0A538NUU0      RGAA--------ALVRSTN-----------------------------------------
A0A2V6NIJ1      RGAA--------GLVRSTN-----------------------------------------
A0A2V6C292      RGAV--------GLVRSTN-----------------------------------------
A0A2V6D2X0      RGAV--------GLVRSTN-----------------------------------------
A0A2V5ZUK1      HSAE--------ALVRSSH-----------------------------------------
A0A2V5XFN9      RSAE--------SLVRSAH-----------------------------------------
A0A2V6EZC8      RSAE--------SLVRSAH-----------------------------------------
A0A2V6I7Z5      RSAE--------SLVRSAH-----------------------------------------
A0A3B9LCP2      RSAE--------ALVRSTH-----------------------------------------
A0A3C0R669      RSAE--------ALVRSTH-----------------------------------------
A0A2V6EID2      RSAE--------ALVRSTH-----------------------------------------
A0A2V6MHB0      RSAE--------ALVRSTH-----------------------------------------
A0A2W5YWL9      RGAE--------ALVRSTH-----------------------------------------
A0A2V5NH62      KSAE--------QLVRSTH-----------------------------------------
A0A2W6A620      RSAE--------ALVRSTH-----------------------------------------
A0A2V5PIJ4      QGAE--------GLVHSTH-----------------------------------------
A0A2V6K2G8      HSAE--------SLVRSAH-----------------------------------------
A0A2V5W206      HSAE--------SLVRSAH-----------------------------------------
A0A2V6MW77      HSAE--------SLVRSAH-----------------------------------------
A0A6N4WVA3      VRAV-----ERIRLSNPELDAALR------------------------------------
A0A0R2XPB1      ARAV-----ERIRLMDPDLHDALI------------------------------------
A0A348NQP1      ARAV-----ERIRLLNSDLHDALM------------------------------------
A0A357FV58      ARAV-----ERIRLLNSDLHDALM------------------------------------
A0A2G4GZN8      EGVS--------KRLTVAERKQVL---------------EPYQGGNIFSGP---------
A0A348NPT1      --------------------ERFM---------------APYADALSFTGP---------
A0A2E1KV60      QGVE--------KRLQEDEFAQFM---------------APYKGVFSFSGP---------
A0A2D7F4D9      QGVE--------KRFQEDELAQFM---------------APYKGTFSFSGP---------
A0A3R7RBR8      QGVE--------KRFQEDELAQFM---------------APYKGTFSFSGP---------
A0A2E0NH28      QAVE--------RRLQDEERARFM---------------APYADAFSLTGP---------
A0A368BGT4      QGVE--------KRLQDEMRERFM---------------APYMDTLSFSGP---------
A0A317ZP96      QGVE--------QRLQDDMRKRFM---------------APYTDALSLRGP---------
A0A350AS32      VGVE--------QRIQDDVRERFM---------------APYSDALSLSGP---------
A0A6N6PLV8      YPVI--------ERLELVKEFSPA------------------------------------
A0A290QE54      GKVI--------QSLTPAEVKMLQ------------------------------------
A0A1H1SWX2      TMVA--------QSLTPDEIRLLQ------------------------------------
A0A1D8AZK8      TMVS--------QSLTPEEIKILQ------------------------------------
A0A4Q1C9I5      QMVA--------QSLTAEEVRILQ------------------------------------
A0A2E0V4K6      EKVAQRPEFAGSEDLVRKPASYMPDWASAFFAREGARESNSEPD----------------
A0A1G3ZL71      SRVY--------DSFTPEEKAILQ------------------------------------
A0A556QP09      NRVQ--------ESLTPQERQVLQ------------------------------------
A0A2T6DX88      TKVM--------ESFTPEEVKVIQ------------------------------------
A0A2T6CWI7      EEVV--------ASFSADEIKVLQ------------------------------------
A0A3E1E5C8      TKVV--------ESFTPDEVKILQ------------------------------------
B1ZZ74          SRVV--------ESFTPEEVQILQ------------------------------------
A0A2E6NAH3      QGVE--------QRLQDELRLRFM---------------APYEDTLSLSGP---------
A0A2A5VZA5      QGVN--------RRMSDEQRKRFL---------------LPYEGAFSFSGP---------
A0A424R295      QGVN--------RRMSDEQRKRFL---------------LPYEGAFSFSGP---------
B4CZV9          LRTA--------RALGIDTNSRDL------------------------------------
A0A0E3YV65      VRVV--------DSLSETEKLSAW---------------RPYAEQDAPPPA---------
W0J900          QRVV--------ASFKPEEKARIL---------------APWLDKDAPPLS---------
A0A3B9FM17      INVA--------HQLDNNPQYKSV------------------------------------
A0A2D7WMI4      AQVV--------TKIENSPELKTE------------------------------------
A0A2D6VHX5      MNVI--------ARINENSDYKTE------------------------------------
A0A2D8I214      ASVI--------QKISDNPESKSI------------------------------------
A0A1Z8VL41      VNVV--------QKISENPEXKSI------------------------------------
A0A2E6TNA4      VNVV--------QKISENPEYKSI------------------------------------
A0A1Z8RG47      VNVI--------QKVKDNPEYKSA------------------------------------
A0A1Z8RJJ5      VNVI--------QKVKDNPEYKSA------------------------------------
A0A2D7V631      VNVI--------QKIKDNPEFKST------------------------------------
A0A354RA24      ANVV--------QKIKDNPEFKST------------------------------------
A0A2E9RV62      ARVL--------EAIKDNSFKKST------------------------------------
A0A2E4AY96      MQVI--------TKIENSPELKRE------------------------------------
A0A3B9B9P4      MQVI--------TKIENSPELKRE------------------------------------
A0A2D5Y6N6      LNVT--------QKIKDTPELKSE------------------------------------
A0A2E7HSS8      TNVI--------LRLRESPEYKSV------------------------------------
A0A2D8VCK3      INVA--------HQLDNNPQYKSV------------------------------------
A0A350QVY4      INVA--------HQLDNNPQYKSV------------------------------------
A0A2E4ZYR7      NRIV--------RAINEDDHKKAT------------------------------------
A0A2E6TCV1      QRVV--------KAIESDKAKKSI------------------------------------
R7E4L8          SRVV--------KGLGLDVSYWEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTPLNG
A0A4Q3BVY2      RVIP--------------------------------------------------------
A0A4P6PCA7      EIAA-----------------------------------EVYFSKYSKKEY---------
A0A2T6DSN5      DYVQ--------QSFSPKEIEMIQ---------------NPYRDPQNANAP---------
A0A317ZIW7      SRAI--------ERVKLTEPEVYE------------------------SLE---------
A0A7C4PPT4      RRTA--------RRLGLPDNPKIL------------------------------------
A0A7C4QZX4      QRTA--------RRLGLPEDPKAL------------------------------------
A0A3D4HHL8      ERAR--------LRVRAMQ-----------------------------------------
A0A366HV03      RSVQ--------GQLSSRQM-------------------IAWTAHSLGVGR---------
A0A6G6K911      RSVQ--------SQLSSRQM-------------------IAWTAHALGIGR---------
A0A5R8KAF2      GPSA--------------------------------------------------------
A0A7C4LRZ6      ARVD--------EKLRADSRLPAG------------------------------------
A0A351MR11      EAVE--------RRLTTSERKAVL---------------EPYQSGNIFSGP---------
A0A388PR45      EGVS--------RLLTPAERKLVL---------------EPYQQGNVFTGP---------
A0A388QR61      EGVS--------RLLTPAERKLVL---------------EPYQQGNVFTGP---------
A0A4P5YHI0      EGVS--------RLLTPAERKLVL---------------EPYQQGNVFTGP---------
A0A2A2RS01      ESVS--------RQLTIDEKKRVI---------------EPYQQGNIFSGP---------
A0A2A2Y1A7      ESVS--------RQLTIDEKKRVI---------------EPYQQGNIFSGP---------
A0A388PDH9      ESVS--------RQLTIDEKKRVI---------------EPYQQGNIFSGP---------
A0A2G4H1E7      ESVS--------KRLTTDERKQIL---------------EPYQNGNYFSGP---------
A0A2G4GZA6      EGVS--------KRLTADERKLVL---------------EPYQAGNIFSGP---------
A0A388P514      EGVS--------KRLTADERKLVL---------------APYQAGNIFSGP---------
A0A2A2YG59      EGVS--------KRLTADERKLVL---------------LPYQGGNIFSGP---------
A0A2G4F7D5      EGVS--------KRLTADERKLVL---------------LPYQGGNIFSGP---------
A0A2V2SDN0      ERAL--------ATVEKQFSNAPP------------LKPVPGMADFLRHGS---------
A0A1V6GL40      NRAH--------ERVSAQ-KPEIG------------------------------------
A0A2V5X6Z6      GRAL--------ARLRSELNPDLAVLLDGGGRQSELLHLAKALCKRLFASG---------
A0A2V5VGZ7      GRAL--------AKLRSERN--LAVLHNGGGTQSELLHKAKALCKKLIASG---------
A0A2V5U130      GRAL--------ARLRSELNPDLAVLLDGGGRQSELLHKPKALCKRLFASG---------
A0A2V6C237      GRAL--------ARLRSELNPDLAVLLDGGGRQSELLHLAKALCKRLFASG---------
A0A3R8L982      DKVA--------ESLKPDDIKILQ---------------RPYQQDAIASGS---------
A0A6N6QBS9      TRVM--------QRLQEG------------------------------------------
A0A2E7HPU9      PPSVNWWPEWSGDLLGGDGEAAIE---------------A--------------------
D5EML0          DAVV--------AALSEDQIQQLV---------------DPYYDPAIDGEN---------
A0A7C4PPJ4      ERVL--------AKIRADER----------------------------------------
A0A3C1C1M3      PFVV------------ASYRELYP---------------D--------------------
A0A2S7U4L6      KRAA--------ELVQLPQKMQIS---------------T--------------------
A0A2E9EYJ1      KEVIXNGVDXAGNXXDLKKSWGVP---------------S--------------------
A0A258AXR6      YPVI--------ETLELAKKWELP---------------N--------------------
A0A3D3NZQ6      YPVV--------DKLDLQLKWELP---------------T--------------------
A0A1T4WVZ9      YPVV--------DKLDLQKRWSLP---------------N--------------------
A0A4R7SSI6      YPVV--------DKLDLQKRWSMP---------------N--------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      ------------------------------------------------------------
A0A290QD69      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      ------------------------------------------------------------
A0A178IFJ2      ------------------------------------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      ------------------------------------------------------------
A0A3D3NW23      ------------------------------------------------------------
A0A2A2R174      ------------------------------------------------------------
A0A1H2DTI1      ------------------------------------------------------------
A0A1H1MGC9      -------------------------------------------------------APYQK
A0A1V5L462      ------------------------------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      ------------------------------------------------------------
B5JIS2          ------------------------------------------------------------
A0A6N6ZC77      ------------------------------------------------------------
A0A7C5H7K5      ------------------------------------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A2V2SMX4      ------------------------------------------------------------
A0A522AC27      ------------------------------------------------------------
A0A6M1RFD0      ------------------------------------------------------------
A0A7C3HXH0      ------------------------------------------------------------
A0A1H2GQN6      ------------------------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      ------------------------------------------------------------
A0A2A2RPW6      ------------------------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ------------------------------------------------------------
A0A3B9GA54      ------------------------------------------------------------
A0A520LEH8      ------------------------------------------------------------
A0A6B2M0T8      --------------------------------------------------KDYRDNDGNN
A0A2D7B7R6      ------------------------------------------------------------
A0A2E5K4P7      -----------------------------------------------FMEPYQKMDKNGG
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ------------------------------------------------------------
A0A2V6EBU2      ------------------------------------------------------------
A0A2V6EY06      ------------------------------------------------------------
A0A2V6ME53      ------------------------------------------------------------
A0A538NUU0      ------------------------------------------------------------
A0A2V6NIJ1      ------------------------------------------------------------
A0A2V6C292      ------------------------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      ------------------------------------------------------------
A0A2V5XFN9      ------------------------------------------------------------
A0A2V6EZC8      ------------------------------------------------------------
A0A2V6I7Z5      ------------------------------------------------------------
A0A3B9LCP2      ------------------------------------------------------------
A0A3C0R669      ------------------------------------------------------------
A0A2V6EID2      ------------------------------------------------------------
A0A2V6MHB0      ------------------------------------------------------------
A0A2W5YWL9      ------------------------------------------------------------
A0A2V5NH62      ------------------------------------------------------------
A0A2W6A620      ------------------------------------------------------------
A0A2V5PIJ4      ------------------------------------------------------------
A0A2V6K2G8      ------------------------------------------------------------
A0A2V5W206      ------------------------------------------------------------
A0A2V6MW77      ------------------------------------------------------------
A0A6N4WVA3      ------------------------------------------------------ETEAYQ
A0A0R2XPB1      ------------------------------------------------------ATEAYQ
A0A348NQP1      ------------------------------------------------------VTEAYQ
A0A357FV58      ------------------------------------------------------VTKAYQ
A0A2G4GZN8      ------------------------------------------------------LTE---
A0A348NPT1      ------------------------------------------------------LTP---
A0A2E1KV60      ------------------------------------------------------LTA---
A0A2D7F4D9      ------------------------------------------------------LTA---
A0A3R7RBR8      ------------------------------------------------------LTA---
A0A2E0NH28      ------------------------------------------------------LTP---
A0A368BGT4      ------------------------------------------------------LTP---
A0A317ZP96      ------------------------------------------------------LTP---
A0A350AS32      ------------------------------------------------------LSP---
A0A6N6PLV8      ------------------------------------------------------------
A0A290QE54      ------------------------------------------------QPFLATLEPGQP
A0A1H1SWX2      ------------------------------------------------RPYLKDLAPGAN
A0A1D8AZK8      ------------------------------------------------RPYLKDLAPGAN
A0A4Q1C9I5      ------------------------------------------------RPYLGELAPGEN
A0A2E0V4K6      ------------------------------------------------------------
A0A1G3ZL71      ------------------------------------------------RSFLKDLPPGAG
A0A556QP09      ------------------------------------------------RPYIKDLAPGAT
A0A2T6DX88      ------------------------------------------------RAYLKNLKPGDP
A0A2T6CWI7      ------------------------------------------------RAALKRLPPGSP
A0A3E1E5C8      ------------------------------------------------RPYLKNLPPGAG
B1ZZ74          ------------------------------------------------RPYLANLAPGAS
A0A2E6NAH3      ------------------------------------------------------LTP---
A0A2A5VZA5      ------------------------------------------------------LTP---
A0A424R295      ------------------------------------------------------LTP---
B4CZV9          -------------------------------------------------------ER---
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------------------------------------
A0A3B9FM17      --------------------------------------------------LLGPFLK---
A0A2D7WMI4      --------------------------------------------------ILAPYIQ---
A0A2D6VHX5      --------------------------------------------------LLAPYLS---
A0A2D8I214      --------------------------------------------------MLAPFLR---
A0A1Z8VL41      --------------------------------------------------XLAPFLX---
A0A2E6TNA4      --------------------------------------------------LLAPFLQ---
A0A1Z8RG47      --------------------------------------------------LLEPYLK---
A0A1Z8RJJ5      --------------------------------------------------LLEPYLK---
A0A2D7V631      --------------------------------------------------LLAPYLK---
A0A354RA24      --------------------------------------------------LLAPYLK---
A0A2E9RV62      --------------------------------------------------MLAPYVH---
A0A2E4AY96      --------------------------------------------------MLKPYVE---
A0A3B9B9P4      --------------------------------------------------MLKPYVE---
A0A2D5Y6N6      --------------------------------------------------LLSPYLK---
A0A2E7HSS8      --------------------------------------------------LLAPYLK---
A0A2D8VCK3      --------------------------------------------------LLGPFLK---
A0A350QVY4      --------------------------------------------------LLGPFLK---
A0A2E4ZYR7      --------------------------------------------------LLAPYVK---
A0A2E6TCV1      --------------------------------------------------LLAPYVKDKK
R7E4L8          REFSLSYRAKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVK---
A0A4Q3BVY2      ------------------------------------------------------------
A0A4P6PCA7      ------------------------------------------------------EER---
A0A2T6DSN5      ------------------------------------------------------VPS---
A0A317ZIW7      ------------------------------------------------------QKE---
A0A7C4PPT4      -------------------------------------------------------YA---
A0A7C4QZX4      -------------------------------------------------------YA---
A0A3D4HHL8      -------------------------------------------------------PE---
A0A366HV03      ------------------------------------------------------ANA---
A0A6G6K911      ------------------------------------------------------ANA---
A0A5R8KAF2      -------------------------------------------------------SF---
A0A7C4LRZ6      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------LTS---
A0A388PR45      ------------------------------------------------------LTE---
A0A388QR61      ------------------------------------------------------LTE---
A0A4P5YHI0      ------------------------------------------------------LTE---
A0A2A2RS01      ------------------------------------------------------LSE---
A0A2A2Y1A7      ------------------------------------------------------LSE---
A0A388PDH9      ------------------------------------------------------LSE---
A0A2G4H1E7      ------------------------------------------------------LTE---
A0A2G4GZA6      ------------------------------------------------------LTE---
A0A388P514      ------------------------------------------------------LTD---
A0A2A2YG59      ------------------------------------------------------LTE---
A0A2G4F7D5      ------------------------------------------------------LTE---
A0A2V2SDN0      ------------------------------------------------------SVN---
A0A1V6GL40      ------------------------------------------------------------
A0A2V5X6Z6      ------------------------------------------------------STS---
A0A2V5VGZ7      ------------------------------------------------------SSS---
A0A2V5U130      ------------------------------------------------------STS---
A0A2V6C237      ------------------------------------------------------STS---
A0A3R8L982      -------------------------------------------------------PL---
A0A6N6QBS9      -------------------------------------------------------GG---
A0A2E7HPU9      -------------------------------------------------------SK---
D5EML0          ------------------------------------------------------KPD---
A0A7C4PPJ4      ------------------------------------------------------------
A0A3C1C1M3      -------------------------------------------------------DP---
A0A2S7U4L6      -------------------------------------------------------DE---
A0A2E9EYJ1      -------------------------------------------------------DE---
A0A258AXR6      -------------------------------------------------------RQ---
A0A3D3NZQ6      -------------------------------------------------------RQ---
A0A1T4WVZ9      -------------------------------------------------------RQ---
A0A4R7SSI6      -------------------------------------------------------RQ---
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ---------------------------------------------------NALMIEYIQ
A0A258AXL1      ----------------------------------------------------EKLALLAK
A0A2E6T1E0      ----------------------------------------------------------LT
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      -------------------------------------------------------KQFIN
A0A1V6GCZ3      ----------------------------MRGTSLIEIVVYSEKPEEAARIANAIADAYKT
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      -SSVE-------VYELVSSFGSWITISGRRGTSLIDVRVKHQDAEAARVIADTLLKVYLE
A0A5E6MKA7      ------------MGSLKVEPIR--------NTRLVRIRCESRQPIVAAQVANGYAESFIN
A0A6B3L936      -GDAD-------PAEFLRLLHQRVSVENVRGTTLIAIKVTHPDAETAKTLANAVMMTYVE
A0A2N8IR72      ------------ALLRGLTITR----PDSKESSLLEMTLTSSNPQKAEDTLNHLIQVYNQ
A0A2N8IV96      ------------DEMAATNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAYKQ
R7E1V8          ------------DEMAASNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKTVPEAYKQ
A0A2E0R252      -PSVSGADMSPET--LGGMMRGWVTVRWRKDTTLIDLYASHSDPEIARDTLEGLIEEYDR
A0A3E1EF48      -KPAPGTKQGPAAGDLAGMMAGWVSVSVRENTNLVDIFAAHTNPEVARDVLSCLLTEYEK
A0A2A2PVG8      -MRFAGEDLSPEM--LGAMLKGWVTVRWRTDTTLLDLYATHTDPAIARDSLAAVLSAYEQ
A0A2E0R421      -QNPTREDISDVS--LGNMMRGWVSVRWRPDTKLLDIHVTHTNPEVARDVLVALLSEYER
A0A2E5EJ69      -PDISQNDLRGQLGGVSSSLRK--------MTRFIDVSFRHRDRVFAMNANQAIVEAFVN
A0A2G4I5Z5      ------------------------------MTRLIDVTVELGDRVLSQTLAQAVVDEYIK
A0A4P5QQV6      -AEIP-------VSMVMLRVEP------LPQTSIFALTATGEEPLYTQKFLDAILHEYIA
A0A2E7ALI1      ------------QKKLVSLLKNRCEVTVRRRTRLLDVRINHEDPKVSAELADTVVDEYLK
A0A178IDB9      -PSAP-------PPSLAGIIRPHINIYQQKGTTIVRIVVTNRDPEAAALIANRFSRKYID
A0A290QD69      -PTAP-------PPSLADIIRPNVRIEPQRSTTILRIMVWNKDPEAAALIANRFARQYIQ
A0A2E7VDS1      ----------------------------------LRITAIARNGEGAAMIANLAQDEYER
A0A7C8D3W3      ------------PPPADVEVLS-KGASRIGKSSSFQLTVNSNNESYAKQLAAYWVTNFVH
A0A178IFJ2      -KDDPPLSASQMDGRLSGLITSGVGVQRQGTTFLIRITCKHREPAMAALVATRFAECYIV
A0A357FSP9      ----------------------------------------------AARVANLFADEFIN
A0A1T4WWY4      -PVCR---------------------MAILDQSHFQILVVSYDAEVVKKMPQALVDAYER
A0A3D3LEQ6      -PAIR---------------------IGFLDQNHIQLRVISYRPRIVREFPQAMIEAYEG
A0A3D3NW23      -PAIR---------------------IGFLDQSHIQLRVISYRPRIVREFPQAMIEAYEG
A0A2A2R174      -NAPS-------EQMVVSSVSGAVDARLRRMTRLIDVTVELGDRMLAQTVAQSVVDEYIK
A0A1H2DTI1      -PGFV-------ESDVRIDVHP------LGSTPILIIRAMSSDAQFAKDFLQADIDAYIA
A0A1H1MGC9      SAASS-------PPSPAEIIFRERKIVPVRLSLVLQVQYAHPDRHVAAKVANLFIDEYIA
A0A1V5L462      -PEIQ-------KDWVSLWAGR------KGTTDIFQLVASGGNARYTQAYLAQIIQAYLE
A0A3D3LGD3      -AALG-------KLRSNLDTQS------SIRSDFVIIEFFDKDPALAATIANAVADSYMT
A0A350ARX4      -PEIT-------PSWVSLSVVQ------RSQASIFQLRAQGGSAEFTQKFLDAVMEEYQT
B5JIS2          -RAFVKGDGVPSMSAFEKILAGRMDATRQRDREFFTLSFRHPEAEIALMVADRMTAAYLK
A0A6N6ZC77      -PDLQ-------PIPVSIQPMQ------LPDTSIIQVVATGSDREYTQRYLDALLEEYIN
A0A7C5H7K5      -DHAVAQTGINEKEPPKIKVTI------VPRASVFVLQAKGRDPRFVQAFLQACMEEFIN
A0A538NJ59      -TNAIPLGKDGQPLPVEIRVRQ------AAKSSVFELEASAADAAYVQAYLSALMIEYLQ
A0A2A2R3V9      -PNLV-------PIPVALSAYQ------QPRTSIFTLQASGSEPNYTQAFLDAVMEEYIS
A0A3C1VFY9      -PGVT-------PKPVALQVSV------LPKTTIFILRATGGNPEYTKAYLQACMDEYRN
A0A2V2SMX4      -PNFK-------PQPVSLKVTI------LPKTTIFLLVGTGDDPVYTQKFLQACMEEYAN
A0A522AC27      -PDIV-------VQPAELSVAI------TPKTTIFVVRAIGHDPQYVKAFLQACMEEYIK
A0A6M1RFD0      -PDLV-------PVPVKVTVGV------TPKTTVFNLRAVGSDPAYVQAYLDAVMEEFIN
A0A7C3HXH0      -PDLV-------PVPVKVSVGV------TPKTTIFNLRAVGSDPAYVQAYLDAVMEEFIN
A0A1H2GQN6      -LLRE-------DEVYGILLGRHLKVEPQRGSNIIQITGISEEMEEAPLLANTIAETYIG
A0A512M3Y3      -RNRY-------VSSIRVTLVP---------GNILQIEIYAYQPWLVEKWPQAMLDTYKT
A0A4P5R5J1      -PDLP-------VEQVKVVVGQ------LPKAAIFVMNVYAKSPAYASAYVDALMDEYMA
A0A4P5YK43      -LGVH-------PELESSVSKG--------AGSLFMMTVDSTDLRYASLYVSNWARAFVA
A0A2A2RPW6      -NAIS-------EERLTRQLAYVVDARLRRFTRLIDVSVELGNAKLAQVIGQSVMEEFLK
B1ZT68          -PDKP-------VPSLAEIIRPNLTIFARRNTTILVVGVTNRNPENAALIANRFARRYID
W0J7C2          -PDAA-------PPPLDAIIRPNVTVFARRGTPILGIQVSNRSPEAAALIANRHARKYID
B4D1I7          -PELT-------PCPITLFVAP------LPQTSIFNLSAIGTEPQYPQKFLDALMHEYIA
A0A353F286      -WGMD-------MDDVVSLLEGIVETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIV
A0A354FSA6      -WGMD-------MDDVVSLLEGIVETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIV
A0A3B9GA54      -WGMD-------MDAVVSLLEGIVETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIV
A0A520LEH8      -WGMD-------MDDVVSLLEGIVETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIV
A0A6B2M0T8      APSIH-------NIIASANKIA------LVGGNIFKFEFHHRNPQAAALLANRFSEEFND
A0A2D7B7R6      -DPRS-------ITSASKKLGANITAKLRGDSLFIDLTANSENRDLAYWSAKYVSTGYTN
A0A2E5K4P7      RDEED-------PIVAGPILHEKRRIIPKRLSLVIQIEYIHPNPEIAATVVNHFAQSFRE
A0A2V6F9Q9      -PDIS-------PVPIELSVAQ------RPRTSIFELQAIGSSPEYTQLYLSAVMQKYLD
A0A2V6NZZ3      -PELQ-------PVPVELSVAQ------RPRTSIFELQAIGSSPDYTQIYLNAVMQKYLD
A0A2V6EBU2      -PELQ-------PVPVELSVAQ------RPRTSIFELQAIGSSPDYTQIYLNAVMQKYLD
A0A2V6EY06      -PELQ-------PVPVELSVAQ------RPRTSIFELQAIGSSPDYTQIYLNAVMQKYLD
A0A2V6ME53      -PELQ-------PAPVELTVAQ------RPRTSIFELQAIGSSPDYTQAYLNAVMQKYLD
A0A538NUU0      -PELQ-------PAPVELTVAQ------RPRTSIFELQAIGSSPDYTQAYLNAVMQKYLD
A0A2V6NIJ1      -PELQ-------PVPVELSVAQ------RPRTSIFELQAIGSSPDYIQAYLNAVMQKYLD
A0A2V6C292      -PELQ-------PVPVELSVAQ------RPRTSIFELQAIGSSPDYTQAYLNAVMQKYLD
A0A2V6D2X0      -PELQ-------PVPVELSVAQ------RPRTSIFELQAIGSSPDYTQAYLNAVMQKYLD
A0A2V5ZUK1      -PELQ-------PVPVEIFVMQ------KPRTSIFDLSAVGSSPEYTQAYLNAAMQKYLD
A0A2V5XFN9      -PELQ-------PVTVEIFVIQ------KPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLD
A0A2V6EZC8      -PELQ-------PVTVEIFVIQ------KPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLD
A0A2V6I7Z5      -PELQ-------PVTVEIFVIQ------KPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLD
A0A3B9LCP2      -PEMQ-------PVPVDITVSQ------KPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLD
A0A3C0R669      -PEMQ-------PVPVDITVSQ------KPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLD
A0A2V6EID2      -PEMQ-------PMRVEITVVQ------KPRTSIFDLQAIGRTPDYTQAYLNALMQKYLD
A0A2V6MHB0      -PEMQ-------PMRVEITVVQ------KPRTSIFDLQAIGRTPDYTQAYLNALMQKYLD
A0A2W5YWL9      -PELH-------PVPVEINVLQ------RARTSIFELQAIGSSPDYTQAYLNAAMQKYLD
A0A2V5NH62      -PEMQ-------PVMVEISVVQ------KPRTSIFDLVAIGTTPDYTQAYLNAVMQKYLD
A0A2W6A620      -PELQ-------PHLVEITVTQ------KPRTSIFDLVAIGSTPEYTQAYLNAVMQKYVD
A0A2V5PIJ4      -PEMP-------TAPVEITVSQ------QSRTSIFDLRAVGAVPEYTQAYLNALMQKYLD
A0A2V6K2G8      -PELQ-------PVPVEIFVLQ------KPRTSIFDLSAIGSAPEYTQAYLNATMQKYLD
A0A2V5W206      -PELQ-------PVPVEITVLQ------KPRTSIFDLAAVGSAPEYTQAYLNAVMQKYLD
A0A2V6MW77      -PELQ-------SVPVEITVLQ------KPRTSIFDLAAVGSAPEYTQAYLNAIMQKYLD
A0A6N4WVA3      VNGLN-------SLDIEAYVKR--------DTSIFVLRAYTPHAEYTQAYLDAVMEEYIN
A0A0R2XPB1      IDGLR-------ALSIESNVKR--------DTSIFVLSAYTPHAEYTQAYLDAVMEEYIN
A0A348NQP1      NDGLR-------ALLIEADVKR--------DTSIFVLTAYTPHAEYTQAYLDAVMEEYIN
A0A357FV58      IDGLR-------ALSIEADVKR--------DTSIFVLTAYTPHAEYTQAYLDAVMEEYIN
A0A2G4GZN8      -QEVF-------ARQRGINPQR--------QTLVINVDFTHPNRDLARQVARLFCESIKK
A0A348NPT1      -TQML-------AQNRKILPQR--------GTLMIGVGYNHPDPVMAARVANLFADEFIN
A0A2E1KV60      -FEIL-------AKNRKIIPRR--------MSLMVNISYTHPNPIVAAKIANLFGDEYIN
A0A2D7F4D9      -FEIL-------SINRKIIPRR--------MSLMVNIAYTHPNPIMAAKIANLFGDEYIN
A0A3R7RBR8      -FEIL-------SINRKIIPRR--------MSLMVNIAYTHPNPIMAAKIANLFGDEYIN
A0A2E0NH28      -VEML-------AKNRKIIPRR--------MSLMVNVGFTHPDPIIAARVANLFADEFIA
A0A368BGT4      -LEVL-------AENRKVIPRR--------MSLMINLAYSHPDPLIAAEVSNLFAKEFID
A0A317ZP96      -TEVL-------GRNRKIIPRR--------MSLMINIAYSHPDPIVAAEVANLFAKEFID
A0A350AS32      -TEVL-------GRNRKIMPKR--------MSLMINIAYTHPDPIIAADVANLFAKEFID
A0A6N6PLV8      GQRLP-------VQSIHNRLRRAMKLQEVRMTGLIDIGIYDVKADRAANIANMIGVVYVE
A0A290QE54      PPSIH-------EVVGSIGVQA------IKNSFLISITATHRSGEGAALIANRYVDQFMQ
A0A1H1SWX2      PPAVG-------GLLGSMSPLS------IRNSFLITITVNNRDPEGAALLANRFVEQFMR
A0A1D8AZK8      PPPVG-------GLLGSMAPQS------VRNSFLINISVTNRDPEGAALLANRYVEQFMR
A0A4Q1C9I5      PPPVG-------QLLGSMSPQS------IRNSFLIHISVTNRDPQGAALLANRYVEQFMR
A0A2E0V4K6      -TGAN-------LTRVAAMLAQRCDATVRKRTRLLDVTVTHEDPELARTLADAVVDEYLK
A0A1G3ZL71      PPATG-------DFMGQVVADA------VRGSRLIRITARHRDPAAAALVANRTYQQFVN
A0A556QP09      PPT-G-------VDLGVMSVQS------VRSTFLINIAVSHRDPDAAAILANRYIEQFIE
A0A2T6DX88      LPGVG-------SMLGSTSVQS------VRNSFIIRIVVSHPDPEAAALIANRTVDQFMQ
A0A2T6CWI7      PTNVG-------IPMGELSVFP------IRNTYLIAVTVTHDDPDAAALVANRFVEVFMK
A0A3E1E5C8      VPSAG-------EALGAVSIDS------TRNSLLISITVRHPDPVAAALVANQYVNQFVG
B1ZZ74          PPSAG-------GALGGVSIDA------ARNSLLITVRVVHPDPEAAALVANRYVNQFMT
A0A2E6NAH3      -LEIL-------AKNRKIIPRR--------MSLMVNFTYSHPDPFLAAEVANLFAKEFID
A0A2A5VZA5      -TEIL-------GKYRKIMPQR--------MSLMVNVAYTHPDAQIAADVANLFAQEFIN
A0A424R295      -TEIL-------GKYRKIMPQR--------MSLMVNVAYTXPDAQIAADVANLFAQEFIN
B4CZV9          -KYLF-------KFRASLNTEK-----------NIDVEAWPYSADWAHRWTETMVQQFIA
A0A0E3YV65      -APVL-------RDTLLQIIGSSVSAARQGNTFFISINVLQRDPDSAALLASRFASQFII
W0J900          -DSQT-------DARLASLIADNVGVVRQGSTFLVRVSYKHREPAVAALVATRFTECYIV
A0A3B9FM17      -QGVR-------VGIASAYSYRITQ-AGSKSRPRFIITSDARSALGAKYVADVVQKEYEK
A0A2D7WMI4      -EGAV-------TSVAAAISYSVSVS--GEGRPVITISSNARSAQAAMIIAREVQTEYEI
A0A2D6VHX5      -DGTP-------MKIQNIVTYNVSVSSPSEGRPRFKINSQSRTGKGAMIIADLVQKEYDK
A0A2D8I214      -EGIP-------VGVESTISYSISVSPPSEGRPRFVISSTSRSAKGAMLVADLVQSEYEK
A0A1Z8VL41      -EGXP-------IGVAXTVSYSVSVTPPSAGNPRFTISATSRSARGAQIIADTVQLEYEK
A0A2E6TNA4      -AGIP-------TGVASTVSYSVGVTPPSAGNPRFTISAVSRSARGAQIIADTVQSEYEK
A0A1Z8RG47      -EGIS-------MDVGATVSYGVSVSPPSEGRPRFTINSNSRSGKGAMIVADIVQSEYEK
A0A1Z8RJJ5      -EGIS-------MDVGATVSYGVSVSPPSEGRPRFTINSNSRSGKGAMIVADIVQSEYEK
A0A2D7V631      -EGIS-------MDVGATVTYSVGVSPPTEGRPRFTINSNSRSGKGAMIVADVVQSEYEK
A0A354RA24      -EGIS-------MDVGATVTYSVGVSPPTEGRPRFTINSNSRSGKGAMIVADVVQSEYEK
A0A2E9RV62      -DQQL-------PEIASIINYSVS--VGGEGRPVFTITATGRSPESVQLVADLVQQYYDE
A0A2E4AY96      -SGIP-------TSVGSTVSYSIS--LSEESRPRFTITSNARSAKSAMIIAREVQSEYEI
A0A3B9B9P4      -SGIP-------TSVGSTVSYSIS--LSEESRPRFTITSNARSAKSAMIIAREVQSEYEI
A0A2D5Y6N6      -DGIS-------IDVGATISYSISVSPPSEGRPRFTINSTARSGRGAQIIADVVQSEYEK
A0A2E7HSS8      -DGVI-------VDLASTVSYRVD-QSGTKSRPRFIITSDSRSAKGAMIVADLVQKEYEK
A0A2D8VCK3      -QGVR-------VGIASAYSYRIT-QAGSKSRPRFIITSDARSALGAKYVADVVQKEYEK
A0A350QVY4      -QGIR-------VGIASAYSYRIT-QAGSKSRPRFIITSDARSALGAKFVADVVQKEYEK
A0A2E4ZYR7      -QGPP-------PPVASVVNYTVS--LAGEGTPILRINSMARNGEGAAMVANLAQDEYER
A0A2E6TCV1      EQEVL-------PTVGQVVNYKID--LIGKGTPTLQITAEARNAEGAQLVANLVQIEYER
R7E4L8          -EATD-------GMLGRLSVTR----PDSKESSLLELTLRLSHPQKAEDALNYLIEVYND
A0A4Q3BVY2      -----------------------SLVIRAMDGRTIELTVVAHDKRAVRGFAEAIVTAYQD
A0A4P6PCA7      -TSWI-------GLEDLAYWVRQVGWYKQGNANIVHVSFQSPDPEFAAQLVNVMIEAAGV
A0A2T6DSN5      -VRNI-------VRSAIQIRDD-------KATTIVRIGAYHRDPEAAALIANRFARKYID
A0A317ZIW7      -EFLN-------EGLRSLKIAA----EVKDDTSIFALSAITPDRKFSQEFLDAVMAEYIN
A0A7C4PPT4      -DHLR-------AVQVRFNSER-----------NLEVTVLAYRGDIVRRWTETMLEEFLK
A0A7C4QZX4      -EHLV-------RILPRFDSDR-----------NVEVTVIAYSKQVVNAWVPVMVEEFLK
A0A3D4HHL8      -LDPC-------VVRVSVSQSP--------DASIFILSAVGEKPEYTQAYLNALMNEYLS
A0A366HV03      -SFEE-------LRSGPLRKIE----LGLLDGATMQLDVFSTNPNVVREFPQALINQYDS
A0A6G6K911      -SFEE-------LRSGPLRKVE----LGLLDGATMQLDVFSTNPNVVREFPQALINQFDT
A0A5R8KAF2      -EAVK-------SKQLRVRAST-------MNWSHLQISVMSPDPAVVRVFAKKLIEVYRA
A0A7C4LRZ6      --------------IQPLSAQA----SRGVGFFLLTV--QSTNFLHAQQFALHWAREFMN
A0A351MR11      -QEVF-------GRQRGIAAQR--------MTMIVNVEFTHPDRDLSRQVCRLFCESIQK
A0A388PR45      -QEVF-------ARQRGVNPTR--------QTFVVNVDFTHPNRELARLVAQRFCDVIQK
A0A388QR61      -QEVF-------GRQRAINPTR--------QTFVVNVEFTHPNRELARMVAQRFCDVIQK
A0A4P5YHI0      -QEVF-------GRQRAINPTR--------QTFVVNVEFTHPNRELARMVAQRFCDVIQK
A0A2A2RS01      -QEVF-------GRQRAINPLK--------STFVVTVEFTHPNRDLARQVAGIFCKAIQK
A0A2A2Y1A7      -QEVF-------GRQRAINPLK--------STFVVTVEFTHPNRDLARQVAGIFCKAIQK
A0A388PDH9      -QEVF-------GRQRAVTPLK--------STFVVAVEFTHPNRELARQVASIFCKAIQK
A0A2G4H1E7      -QEVF-------AKQRSINPQR--------QTLVINVAFTHPTRDLSRKVAQLFCEAIKK
A0A2G4GZA6      -QEVF-------AKQRGINPQR--------QTLVINIDFTHPNRDLARQVARHFCDSIKK
A0A388P514      -QEVF-------VKQRGINPQR--------QTLVINVDFTHPNRDLARQVARHFCDAIKK
A0A2A2YG59      -QEVF-------ARQRGINPQR--------QTLVINVDFTHPNRDLARQVARHFCDAIKK
A0A2G4F7D5      -QEVF-------AKQRGINPQR--------QTLVINVDFTHPNRDLARQVARHFCDAIKK
A0A2V2SDN0      -AANA-------EPSELFKLKV----VESSKSSILELHATGAEPLSTRAFLNAVMAEYLS
A0A1V6GL40      --------------RHAVALNV----LVLPKTTIFVLQATGRDRDYTQAFLQACMDEYIA
A0A2V5X6Z6      -SSNA-------PPRFPFDVKV----LEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLS
A0A2V5VGZ7      -SSNA-------PPRFPFDVKV----LEGAKSSTLALRVIGAEPASTRAFLDCLMEEYLS
A0A2V5U130      -SSNA-------PPRFPFDVKV----LEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLS
A0A2V6C237      -SSNA-------PPRFPFDVKV----LEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLS
A0A3R8L982      -PGPS-------GLVGGINVQS----VARSYLISITA--YNRDPDGAALIANRYVDQFIT
A0A6N6QBS9      -ATNR-------MARPEYDALA----GRGATYVMTV---RGTNFDYCQKFALAWAQEFID
A0A2E7HPU9      -METS-------QLARLIRGWTEVSNRRKTRLVDVVV--SHPLPEVASALADKISQTYAN
D5EML0          -PAVL-------LMRRMLSVER----GENEESQVLNIIITHQNPRIAQQVANTYVDEYIA
A0A7C4PPJ4      ---LV-------GMSGPVNATA----TKGLGYFLITV--DATNFLFAQQYAMHWAREFMS
A0A3C1C1M3      -APEE-------ELTARLANRGRFAIIKRTRLVSVTF--TDPDPEFAMRACAAYAAGAEA
A0A2S7U4L6      -AIL--------VLKGGLSARQ----ERGTDLIEISLRMVKDNRQYVKPATEAIALAYSE
A0A2E9EYJ1      -DAYR-------ILKRKVETQD----VRGTDLIDIEV--YDTDPNLAADIANAVADAYRT
A0A258AXR6      -AALG-------RLRANLETQS----MLRSDFVTIDY--YDQDPQLAATIANEVAKSYMT
A0A3D3NZQ6      -AALG-------KLRSNLDTQS----SIRSDFVIIEF--FDKDPALAATIANAVADSYMT
A0A1T4WVZ9      -SALA-------KLRGNLDTQS----SVRSDFVVIEY--FDQDPGVAAEIANAVYQSYMT
A0A4R7SSI6      -AALA-------KLRGNLDTQS----SVRSDFVTIEF--YDQEPGAAAEIANAVAQSYMT
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      YKKDIRKVVSGDTLASISEQVLRLERDLKSEQENLVAFQRTNNLAI--------------
A0A258AXL1      YRSA--------------PLPVGTIVRREPNPDPFLIKTAGPNVVP--------------
A0A2E6T1E0      YKRE--------------NDIISLEESQNVTLKALIQAQTDFDMAR--------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ---------------IVLQALKQAQADLDKARSDAAAARKLDEEVE-------------R
A0A353DI77      IREGVNEEGKKSDLQHLLAAAKERESELETARRRAGSYTPAL------------------
A0A1V6GCZ3      HRQEQRAQLSRGGIKALEERFAEQEAKVKAAQERVDNLRKELNISD---AMASGDGPSPL
A0A3C1UJT2      ------------------------------------EKARPDNLTN--------------
A0A2S7U0Z3      KEESQLIGGSDDAFKILKKEADGARLEMELAEKSLQFYVSAI------------------
A0A5E6MKA7      FGLDRKLEANRHARKFLAGQMDALRKKMAQSEERLADFMAEAGIAH--------------
A0A6B3L936      EEEARISGGTSDAFKVVSIEADEIAAEMEAAERSFQTYRAAL------------------
A0A2N8IR72      ISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEFKTKSDIVK--------------
A0A2N8IV96      DREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLP-------------T
R7E1V8          DREMRENRLVETAIKSLKDVLREQEDTVNEKMMSLKKLIAESSYLP-------------T
A0A2E0R252      SVESKVAGSSEFALDYILESSDKVKEKMLNLERALRLYKRCLELSD--------------
A0A3E1EF48      LTAESIAGSEENTINYIVEKCRELQEGIFKIESSLARYQGCVDLSK--------------
A0A2A2PVG8      LSESRVEGSSEYVLEYILDSSAEIKERLLDLESTLQLYQRCLELSK--------------
A0A2E0R421      MTESKVADSSEYALDYILENTNRIRKGILDLERAIELYNNCQDLIT--------------
A0A2E5EJ69      WDIERKMGRGTNTIAIHTTAAEELKVKWLEAQEIAHQYVKSNSLAV--------------
A0A2G4I5Z5      QINEDRAGIGTNTSQFLMGEEIRIKAGLLKAEVAVQEYLKTNSSS---------------
A0A4P5QQV6      TRREMRSQKGEFAAGAIDDEIERVAAELRKEEDRLLAFQRDNKTGF--------------
A0A2E7ALI1      ELTEENRGTKNKRSEGLVKQAEEARVGLQEATSALAIYNRAI------------------
A0A178IDB9      FTVDKAMTSTNSAIIFLKNQSEEKRSEVESVERAMQDYRARHNMAA--------------
A0A290QD69      YTIDRAMTKTSSAMLLLRGQAEEKRTELQLIERQKQDFRAKHNMAA--------------
A0A2E7VDS1      IHDVRKGKKHDMAITFLEEQMNKSRKLGQAIDANTRDFKRQHNLAF--------------
A0A7C8D3W3      HKDLKTLEEFTNKQASLEKNKTKWIRNLADVQKEYDELILKHGATG--------------
A0A178IFJ2      YLMDRNASANDSAISFLRAQTEDLRKKAEASERALHAYREKSRMVS--------------
A0A357FSP9      YNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEYREDNNAVS--------------
A0A1T4WWY4      IRLKIRSEYRDTAVKRYADEVTEIRKKVAEQLDSRLQFEEQSALAN--------------
A0A3D3LEQ6      ARKRLRNEYRDKAIARYVDELADVRAKVTSQLDSRLKFEEESALAS--------------
A0A3D3NW23      ARKRLRNEYRDKAIARYVDELADVRAKVTSQLDSRLKFEEESALAS--------------
A0A2A2R174      ERNEVRAGVGTNTSQFLMAEETRIKEKLLLAERAAEQYLRTNSSS---------------
A0A1H2DTI1      LQHDIKVDDKDRAIKDITDELTKAEATLQTDEDDVLGFQKANNIVF--------------
A0A1H1MGC9      YNSRLRIEDSMKAVDDLKERAEQQKKKVEELAINLQAYREKNKMVS--------------
A0A1V5L462      FRRQTRLETSDDVMLSIGEELRELDVKIQQIQEAIRRFQQENNTIA--------------
A0A3D3LGD3      RRVEVESKQKESALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNSTVPGA
A0A350ARX4      FRSEMRSETTETTLIAVTEQLYRLEEEIENQENTVVDFQKENNLIF--------------
B5JIS2          LVQREIKETNQAAAEMLRLQAEQLQAEISELEGKQRDFRERNNVIS--------------
A0A6N6ZC77      WRQQMKGETSERALLAITEQLDDIERKIQQGEDAVVEFRKRNNLIF--------------
A0A7C5H7K5      LKREMVGRTSDVTLAGMTEEVLRLEKELRQYETELAEFQKSNDIVF--------------
A0A538NJ59      YKKDIRKVVSGDTLASISEQVLRLERDLKSEQENLVAFQRTNNLAI--------------
A0A2A2R3V9      RRKETRSEKSQSALLTIKEQVDKSEKEINQVDEEMLSFQKENNVIF--------------
A0A3C1VFY9      LKKGMTEHASDTTVAGLTDQMLRLDPEMRKVDDQVAVFLSTNDVAF--------------
A0A2V2SMX4      LKAEMRTQTSDKTLSGLSEEVESLRKELKQSSVQLEAFQGSNSVVV--------------
A0A522AC27      LKREMREKTSDTTLAGLTEEILHLQRDLKKSDEELAEFQKTNSVVL--------------
A0A6M1RFD0      LKKEMRTRSSDVTLAGITEEVARLEKELKQYEDELLQFQATNSIVF--------------
A0A7C3HXH0      LKKEMRTRSSDVTLAGITEEVARLEKELKGYEEELLQFQATNSIVF--------------
A0A1H2GQN6      VRTKNEKDRINRGLDNVADQIEKQRTIVTDAKKKVDDMRLQLGVDI------------IP
A0A512M3Y3      YTQQQRSRFKDNAVEEYTKDLDRLKTRIASEQNATAKFEEDNHLIEQYIANNGLESVPGE
A0A4P5R5J1      KKKEMRQTSGESAAVAIQEELVRLEKDMKLEEEEMHGFQQKNNIGF--------------
A0A4P5YK43      YKNEVNTELIEKKFGQTRQEVKRYEQNLEKARESTLIFKKKHNIGD--------------
A0A2A2RPW6      QNAEDRVGAGTNAGHALLASEAAIKQRLLKAEHAVAEYRRTKNIS---------------
B1ZT68          YNLDRANSGTNSAIIFLRNQAEELRAQVEAVESSLQEFRARNNIAA--------------
W0J7C2          YNLDNASTRTNSAIVFLRNQADETRAQVEAAEKALQNYREKNNLAA--------------
B4D1I7          TRREMRTEKSEDAESSIEDEISRVQADVRKEEEKLVTFQRENNVGF--------------
A0A353F286      RRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPY--------------
A0A354FSA6      RRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPY--------------
A0A3B9GA54      RRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPY--------------
A0A520LEH8      RRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPY--------------
A0A6B2M0T8      FLVERSRKTNDSALRFLRSQSEELKLKVERSELAVQRYRQERNLVS--------------
A0A2D7B7R6      FLKVNSRSKAMGGLIQLERGRELSQKDLEDAQKALIRFQTKNRITN--------------
A0A2E5K4P7      YQLDQSLKKGISDISKLGTEIQEKEKDVLVLEAKAVNYKTQFTSLG--------------
A0A2V6F9Q9      FKRGMREGQTQTFTTGITEHLIQVEKDLRTAEDEMLEFQKENNIGF--------------
A0A2V6NZZ3      FKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF--------------
A0A2V6EBU2      FKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDDMLDFQKQNNIGF--------------
A0A2V6EY06      FKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF--------------
A0A2V6ME53      FKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF--------------
A0A538NUU0      FKRGMREGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF--------------
A0A2V6NIJ1      FKRGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF--------------
A0A2V6C292      FKRGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF--------------
A0A2V6D2X0      FKRGMREGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGF--------------
A0A2V5ZUK1      FKRGMREDRGHEITTGITEQLIQVEKDLRNSEDEMLEFQKQNNIGF--------------
A0A2V5XFN9      FKRGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGF--------------
A0A2V6EZC8      FKRGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGF--------------
A0A2V6I7Z5      FKRGMREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGF--------------
A0A3B9LCP2      FKKGMREGQGQTVITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGF--------------
A0A3C0R669      FKKGMREGQGQTVITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGF--------------
A0A2V6EID2      FKKGMREGQGQTLITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGF--------------
A0A2V6MHB0      FKKGMREGQGQTLITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGF--------------
A0A2W5YWL9      FKRGMRQDQTHTLTTGMTEQLIQVEKDLRAAEDEMLEFQKQNNIGF--------------
A0A2V5NH62      FKKGMRENQGSTVTTAITEQLIQVEKDLRGAEDEMIEFQKQNNIGF--------------
A0A2W6A620      FKKGLRENQGSTVTTAITEQLIQVEKDLRNSEDEMLDFQKQNNIGF--------------
A0A2V5PIJ4      FKKGMREGQGHNVTTAITEQLIEVEKDLRTAEDELLEFQKQNNIGF--------------
A0A2V6K2G8      FKRGMREDRGHEITTGITEQLIQVEKDLRNSEDEITEFQKQNNIGF--------------
A0A2V5W206      FKRGMREDRGHEITTGITEQLIQVEKDLRNGEDEMLEFQKQNNIGF--------------
A0A2V6MW77      FKRGMREDRGHEITTGITEQLIQVEKDLRNGEDEMLEFQKQNNIGF--------------
A0A6N4WVA3      RRVEMRSKTSERTYDAIVAQLQILEKEVDEGEDAIVEFQQRNNIVF--------------
A0A0R2XPB1      RRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVF--------------
A0A348NQP1      RRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVF--------------
A0A357FV58      RRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVF--------------
A0A2G4GZN8      NSEDDRLMVTNPLIEKARIEIETLEDKVRRLNEQKNGLIKNQKLLS--------------
A0A348NPT1      YNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEYREDNNAVS--------------
A0A2E1KV60      SMLSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKNAIS--------------
A0A2D7F4D9      TMLSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKKAVS--------------
A0A3R7RBR8      TMLSQNIDASMKAVEDLRKRAEQKKNRVEELELKLAEYRELKKAVS--------------
A0A2E0NH28      YNLTKSVDASMDAVEDLRIRADQQRQRVEELELKLAEYREEHNAVS--------------
A0A368BGT4      YNLRLNIDGSMKAVEDLRIRADQQKDRVEELELKLAEYREQNNAVS--------------
A0A317ZP96      YNLKLNIDSSMKAVEDLRIRADQQKDRVEELEFKLADYREQKNAVS--------------
A0A350AS32      YNLKLNIDGSMKAVEDLRIRADQQKERVEELDMKLADYREQNNAVS--------------
A0A6N6PLV8      RRRADLQKNVDRGLEQLTEEVAKQREVMKKASAEAAQLRTEGNIND--------------
A0A290QE54      DLLMNVGGKNEYAVQSLRTRAEQLRKEVEVADQRLQTYMKEQRLVS--------------
A0A1H1SWX2      YLMENVGGKNEFAVDYLRSRAKELQQESEAAEGKLQDYRRKHNLVS--------------
A0A1D8AZK8      YLLENVGGKNEFAVDYLKTRAEELRKESEIAEGRLQDYRRKHNLVS--------------
A0A4Q1C9I5      YLFENAGGKNEDAVNFLRSRADELRKDSETAEGRLQDYRRKHNLVS--------------
A0A2E0V4K6      ELAEEDKGSADRRSAGLLGQADVARESLQEANSALAVYNRAL------------------
A0A1G3ZL71      QLIENAGGSSEFTVEFLQLRATELRKELGEKEALLQDYKKRHNLIS--------------
A0A556QP09      SLLENVSGGHDYAVKYLRDRATQLQEEARIAEQRLQDYMRAQNLVS--------------
A0A2T6DX88      YLLDSVSGKNEYAVERLRLSAEQLRKEAEAADQKLQSYMREHNLVS--------------
A0A2T6CWI7      RLYDTAGGRTADAVKFLREQASRLEREAQEKEQALQQYMTKHQLTS--------------
A0A3E1E5C8      YLMDYYGGKNETGVEYLRAQADRLGKDAADAEQKLMAYKKEHNLVS--------------
B1ZZ74          YLIERVGGVNESAVEFLRNRADQLRKEAEQADVKLNAYMQAHNLVS--------------
A0A2E6NAH3      YNLKLNIDGSMKAVEDLRIRADQQKNRVEELELKLAEYREQNNAVS--------------
A0A2A5VZA5      YNLSENIDASMVAVEGLRIRADQQKERVEEIELKLAEYRERHNAVS--------------
A0A424R295      YNLSENIDASMVAVEGLRIRADQQKERVEEIELKLAEYRERHNAVS--------------
B4CZV9          YRQERRNEEKNLIVNTYSEELKELVGRLDQQFSEKLDFQDQQDFTK------------TL
A0A0E3YV65      HLLDRNSAVNNSAIAFLREQTQELRVKAESSERALQQYREKSGMVS--------------
W0J900          YLMDRNTSSNDSAISFLREQTEDLRKKAEASERALQAYREKTRMVS--------------
A0A3B9FM17      LHKSTKNEKVEFVKQTLEDLLDTSLGKEKKIAADMANYKKEHNLPF--------------
A0A2D7WMI4      LHRSRSNLKVESAKQTLEGLLQKEIQKEENIKRQITALKIKRSVPN--------------
A0A2D6VHX5      LNSIKKTEQVQTAKGILELLLDKSLMEEDRILKEISDIKESNDIPF--------------
A0A2D8I214      LHKSKKNQQVESVRNLLEKLLAQSIEKESQLADEMSAYKKNLGLPF--------------
A0A1Z8VL41      LHKSRKSEKVESARNLLELLLENRQSEEKRIAQEMSQFKKGKNIPY--------------
A0A2E6TNA4      LHKSRKSEKVESARNLLELLLENRQSEERRIAQEMSQFKKGKNIPY--------------
A0A1Z8RG47      LHRSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSGYKKNNQLPF--------------
A0A1Z8RJJ5      LHRSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSGYKKNNQLPF--------------
A0A2D7V631      LHKSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSEYKKANQLPF--------------
A0A354RA24      LHKSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSEYKKANQLPF--------------
A0A2E9RV62      SHKKGAGEIVRGARSVLESLLEKSQSREDSILEEMTKYKGERELPF--------------
A0A2E4AY96      LHRSNSSLKVESAIKTLERLLDREMKKEKDIQAKISQYKAEKEAPF--------------
A0A3B9B9P4      LHRSNSSLKVESAIKTLERLLDREMKKEKDIQAKISQYKAEKEAPF--------------
A0A2D5Y6N6      LHKSKKSLQVENVKNVLQLLLDKSLQEEERISQEQSSFKKKYDLPF--------------
A0A2E7HSS8      LHKSSKSEKVEFVKKTLEDLLENSLSKERKIAYDMSEFKKVNQLPF--------------
A0A2D8VCK3      LHKSTKNEKVEFVKQTLEDLLDTSLGKEKKIAADMANYKKEHNLPF--------------
A0A350QVY4      LHKSTKSEKVEFVKQTLEDLLDTELSKEKKIAADMANYKKDNNLPF--------------
A0A2E4ZYR7      IHESRQGKKHDTAIAFLEEQMTRSRNAETEIDNKVREFKRRHNLAF--------------
A0A2E6TCV1      AHKSRKGQNQTKSVAFLDIQMAESRKKEDAIIKQINSFKTNHNLTY--------------
R7E4L8          HSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVK--------------
A0A4Q3BVY2      IQQENYEEYRDEALRRYAEQVDRLEAEISQTLSSLSSVERSQNLTE--------------
A0A4P6PCA7      LMERDNKELSDGAVKWLVDQTEVLRKELEAVELELAGKRQDFQIAT--------------
A0A2T6DSN5      FMLDEAMSGTTSAILWLRNQAEETRSQLEAATRELQEFRERHNMAS--------------
A0A317ZIW7      RRSEMRAKTSEKTYDAIAAKIKSLEDEINQNEDAIVDFQRKNNIVF--------------
A0A7C4PPT4      DREEKRVEMREKIISSYTEELKEVSRRMEEALMTTHQVESGRKTEL--------------
A0A7C4QZX4      ELEEKRAEMRNRILAAYNAEMKDMGEEIESILNAKYQVEGGRKMEI--------------
A0A3D4HHL8      FKREMRSETADRTFLAITEEMMDLQKEIESGEDEKLNFQKENNIVF--------------
A0A366HV03      YTREKRFEFFEVALKRYNEELGLLKKKIDESLQVKTSFERDNEINE--------------
A0A6G6K911      YTREKRFAFFEVALKRYNEELGLLKKKIDESLEVKTNFERDNEVNE--------------
A0A5R8KAF2      QREEAWAKYRNEALIRYAREVDTLEGLAVDSYKDLSKLERESRMTE--------------
A0A7C4LRZ6      FKEEQTASAVDQRLTETRREIERYERKLETARRALQDFQLSNNIAS------VKETADAA
A0A351MR11      NSEDERLTVTNPLVEKARVEIESLEERLNRLYLDKNELVGRERMLA--------------
A0A388PR45      SSEDERLTITHPLVEKARIEIESLEDKIRRLYEKKNGLVKSGDLLD--------------
A0A388QR61      SSEDERLTMTHPLVEKARIEIESLEDKVRRLYEKKNGLVKSGELLD--------------
A0A4P5YHI0      SSEDERLTMTHPLVEKARIEIESLEDKVRRLYEKKNGLVKSGELLD--------------
A0A2A2RS01      NSEDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKTQKLLS--------------
A0A2A2Y1A7      NSEDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKTQKLLS--------------
A0A388PDH9      NSEDERLTITNPLVEKLRSEIDLIEERLRKLSDKRSDLIKSQKLLS--------------
A0A2G4H1E7      NSEDGRLMMTNPLVEKARIEIETLEDKVRRLFEQKNDLIKNQKLLS--------------
A0A2G4GZA6      SSEDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKSQKLLS--------------
A0A388P514      YSEDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLLS--------------
A0A2A2YG59      YSEDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLLS--------------
A0A2G4F7D5      YSEDDRLMVTNPLIEKARIEIETLEDKVRRLYEQKNDLIKNQKLLS--------------
A0A2V2SDN0      FKRESREKTSDRAVASLARQVNQLANELKAQQEKMYAFQMSNNVVF--------------
A0A1V6GL40      LKKEMRSQTSDTTVAGLTEQVMRLEKDLRRAEAEMVQFQSTNSMML--------------
A0A2V5X6Z6      FKKESREKTTDRTATSLGVEVTQLKGELEAQQEKLHAFQASNNVVF--------------
A0A2V5VGZ7      FKKESREKTSDRTAASLAAEVTQLKSELEAQQEKLHAFQASNNVVF--------------
A0A2V5U130      FKKESREKTSDRTATSLGAEVTQLKGELEAQQEKLHAFQASNNVVF--------------
A0A2V6C237      FKKESREKTSDRTATSLGVEVTQLKGELEAQQEKLHAFQASNNVVF--------------
A0A3R8L982      YLIDSVSGRNEDAVSYLNTSADRLRDEANAAEQRLLDYMRRENLVSLDNSTNIVRER---
A0A6N6QBS9      YKKQMLVNLKSSAEATLHREILQSERELENVRDEIDQFTRKWNIAN--FTDAGARSRERL
A0A2E7HPU9      ELGVERATGRTNSSSVLAQKSEEAEKLLNQKENALAN-----------------------
D5EML0          YKAGLRSSSTGEAVNFLERQVAEMREELELQEVELQDYRQQHNLVS--------------
A0A7C4PPJ4      FKEELTASTVDLSLAETQREIERYERKLEKARQDLLAFQVKHNIAS------VKETADAA
A0A3C1C1M3      AARAENRSGSNAAVAWLEAQALAQRQELEKADQELFDARQTLQ-----------------
A0A2S7U4L6      MRINQETKRRDKTRVELAKKIQKYEDIVEDYRTRLLEFSAKTGIYSLDRSSGGATDVVRR
A0A2E9EYJ1      RRQEEEQSRAQKALALLDQQIKSQEGRLEKARXNMIELMEELNIVD--LSLGEPVWLRGS
A0A258AXR6      QRNNIETGKKHKALEVLQQQISDQEGLRSQAQVRSQEARRKAGIVGDWIVGGGSSLNPGG
A0A3D3NZQ6      RRVEVESKQKESALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNSTVPGA
A0A1T4WVZ9      RRVEVETSQKQEALAMLAKQIAEQEQLRDQARLKMQEAKKKGGIVGEWFSSGTNSTAPGA
A0A4R7SSI6      RRVEVESKQKQDALTMLGQQISEQEQLRDQARLKMQEARKKGGIVGEWFSNGSNSTAPGS
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      -VQQEATIAGGSLARLSTELSDGILQTQLLESRALGLEANGPVGAGVSVGLNGPLLGADS
A0A258AXL1      -GATGEQVNGANTAR--------------------------RLSPEVG--AATPEASTTT
A0A2E6T1E0      -SAEVTAVAAAEEAA--------------------------RVFHETKQYGTIPEVATDT
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      --------------------------------------------------------DLDQ
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      LLHAATSIDAIPLVAGNPLIQDMRKSLAEREALLANL-----------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      MTAETLRKIESLRIESQAEYVRQATRLDRLKNLGKEL-----------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      LSPQEKAPAEKESVQIRDSLLRARLLMLQKQIRLERA-----------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      DADTTMSADFSTSQALEKEIFDLETQIKLASTLADNL-----------------------
A0A2N8IV96      SWRNGEHRSTLTAGMEEEEFRNAKAQAMDFERREKELASYVQELQRLPDDKLLDYVISSD
R7E1V8          TWRNGENRSTLTAGMEEEDFRNAKSQAMQFEKDEKELASYVQELQRLPDDKLLDYVISSD
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      ---GMTDMKRMELESIGKELTVSKNEKLKLDTDWKMI-----------------------
A0A2G4I5Z5      -LIQGQNIVTEEFKSLSERRSAATDERRDMERDFEMT-----------------------
A0A4P5QQV6      -LEQEGNAAAAYLSKLNTRLAELRNESQLLDLFDADQ-----------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      -LGEATNIVRQKVGLLGNDLAQAQLEQTTLQTLIQLI-----------------------
A0A290QD69      -LGENKGVVQQKVTMLGNSLAEAELRQTNLRTLIESV-----------------------
A0A2E7VDS1      -IEDEKKDVADRKSQYQGAITLAQVEKLRIQSTLRQI------------IAIQGRVEQST
A0A7C8D3W3      -NENLVTPIREVIVSINRELDRTEIQLQKLELTAKED------------YAQFVSSGASS
A0A178IFJ2      -LEESQNIVVDRMKAISSALTEAQVALLAIEARLQQA-----------------------
A0A357FSP9      -LESQENIAATQLSSLNTIKIENKHLYDNLETRINLI-----------------------
A0A1T4WWY4      -----AQIEMERLSNIPVDIVRAKYRLKEHEEISRILQEQQSSLDVIGKLSLISGFTDEE
A0A3D3LEQ6      -----AQIELERLSDVPVQQVRVRYKLQEMDGVRQVLKDQGGTLDTVGTLALLTSMTSDK
A0A3D3NW23      -----AQIELERLSDVPVQQVRVRYKLQEMDGVRQVLKDQGGTLDTVGTLALLTSMTSDK
A0A2A2R174      -LIQSQNIVTEEFKALNERRAVATDERRDVERDFEMT-----------------------
A0A1H2DTI1      -LQEQGSSLGSHLAQLNNQLVDRRNEYDLLVKLTAKQ-----------------------
A0A1H1MGC9      -LDQRKDIVTEKLKALNAYVTQTTSRLNEAEIRWRQV-----------------------
A0A1V5L462      -IKELSEKAAGRLSELKTRLEDYRTQLRILESFDENV-----------------------
A0A3D3LGD3      ELRTTGDSMA---VTREQAIFQADLDVETLSAEIGQL-----------------------
A0A350ARX4      -LKEQDSSTGAYLARLTTQQAELKTQLLILENLKTGD-----------------------
B5JIS2          -LEENQDLLAERLKGIDANRIEARLDRFRLETKLGNVKAALGEDGRPFDNPFLANFANNE
A0A6N6ZC77      -IQEQGDAAGSNLAALERRRSELRTQMRLLESLDVDM-----------------------
A0A7C5H7K5      -LQEQGNAIGAYLAQLNQRITSLKSEYDLLSTLTENAGFLDILTGEQTPLITDQLVGQRA
A0A538NJ59      -VQQEATIAGGSLARLSTELSDGILQTQLLESRALGLEANGPVGAG----VSVGLNGPLL
A0A2A2R3V9      -MEEQGNKNATYLINLSKQLDDLNTEFQLLSKLTLDQNIERRSTNTSKPQTTTKNPATTN
A0A3C1VFY9      -LEEASGVA-NYLSVLYQRLAESKSEYDLLQSMTLDQNLLLEQGRS----PALAGAGMPG
A0A2V2SMX4      -LDQQGNSAGNYLTALNQRLAGLKSELELLRTMSVEQTLERRQQGG----GVLPAPEPVA
A0A522AC27      -LQEQGNNYGMYLASLTRKLADLKSEYDLLTTMTLDQNIERQRQQG----VAS--TSSEA
A0A6M1RFD0      -LQEQGNVAGNYLAQLNQQLAMLQSELNLLNMLDLEQNLERQQAAG----VITGVRPVPP
A0A7C3HXH0      -LQEQGNVAGNYLAQLNQQLAMLQSELNLLEMLNLEQNLERQQASG----VITGVRPVPP
A0A1H2GQN6      GTQNESQLLDQELEGKQKQLDDARQDAVARRVRYEQL-----------------------
A0A512M3Y3      MLTTKNRMDS--MQQVIEMIESGKLPAVEQLSLLKKFRGTPVPVGTIMRNSRPDEVVSIA
A0A4P5R5J1      -LKEDGNSAATYLSILNRRLDELKTEFNLLQRLDIDQ-----------------TLDRTP
A0A4P5YK43      -IRDAGLAAQDRLNRLTAELDEIVLVRKRLESYTKDE---------LLEGKMPEILSKNP
A0A2A2RPW6      -LQDTSDIQTADFKAMAEKLNEAKDEVRLLELEWGMS-----------------------
B1ZT68          -LGENQNVVLQKVGTVGTALVRAQMEQVEMRSVLDKI-----------------------
W0J7C2          -IGETQNVVLQKMSSLGTAVVAATLDQIDAKSLIDKI-----------------------
B4D1I7          -LEQGGNSAGAYLAKLNTQLAEFKKEAQLLDLFQLDQ-----------------------
A0A353F286      --FDGGSAGNRLGLSEQAMFQSAKGKLANFETQADQI-----------------KIQIGK
A0A354FSA6      --FDGGSAGNRLGLSEQAMFQSAKGKLANFETQADQI-----------------KIQIGK
A0A3B9GA54      --FDGGSAGNRLGLSEQAMFQSAKGKLANFETQADQI-----------------KIQIGK
A0A520LEH8      --FDGGSAGNRLGLSEQAMFQSAKGKLANFETQADQI-----------------KIQIGK
A0A6B2M0T8      -LEESQNLIVDRMKNLSGSLNDAKVELLNLSATLEKI-----------------------
A0A2D7B7R6      -LKERKEQLETKNNSDRLVLDNLKLELSRIQNDLEDL------------------ESVGY
A0A2E5K4P7      -LDSEENIFLRELTVLREHLIKKDDVRKAVESRWQQL-----------------------
A0A2V6F9Q9      -IQEEGNSAAQYLVKLNQDFARLKTEYELLQKLDLDQ-----------------NLDRGE
A0A2V6NZZ3      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGE
A0A2V6EBU2      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGE
A0A2V6EY06      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGE
A0A2V6ME53      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGE
A0A538NUU0      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGE
A0A2V6NIJ1      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGE
A0A2V6C292      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGE
A0A2V6D2X0      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGE
A0A2V5ZUK1      -IQEDSTSAAAYLVKLNQQYAQLKTEYALLNLLDLDQ-----------------NLDRAQ
A0A2V5XFN9      -IQEEGNSAAAYLVKLNQQYAQLKTEYALLNLLDLDQ-----------------NLDRAQ
A0A2V6EZC8      -IQEEGNSAAAYLVKLNQQYAQLKTEYALLNLLDLDQ-----------------NLDRAQ
A0A2V6I7Z5      -IQEEGNSAAAYLVKLNQQYAQLKTEYALLNLLDLDQ-----------------NLDRAQ
A0A3B9LCP2      -IQEEGNSAAAYLVKLNREYAGLKTEHDLLSLLDLDQ-----------------NLDRAQ
A0A3C0R669      -IQEEGNSAAAYLVKLNREYAGLKTEHDLLSLLDLDQ-----------------NLDRAQ
A0A2V6EID2      -IQEEGNSAAAYLVRLNRDYAGLKTEYDLLNLLDLDQ-----------------NLDRAQ
A0A2V6MHB0      -IQEEGNSAAAYLVRLNRDYAGLKTEYDLLNLLDLDQ-----------------NLDRAQ
A0A2W5YWL9      -IQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQ-----------------NLDRGQ
A0A2V5NH62      -IQEEGNSAAAYLVRLNQQYAQLKTEYDLLSLLDLDQ-----------------NLDRAQ
A0A2W6A620      -IQEEGNSAAQYLVRLNQQYAQLKTEYDLLSLLDLDQ-----------------NLDRTS
A0A2V5PIJ4      -IQEEGNSAAAYLVKLNQSFAALKTEYDLLSMLDLDQ-----------------NLDRKQ
A0A2V6K2G8      -IQEEGNSAAAYLVKLNQQYAQLKTEYDLLNLLDLDQ-----------------NLDRAQ
A0A2V5W206      -IQEQGNSAAQYLVKLNQQYAQLKTEYDLLNLLDLDQ-----------------NLDRAQ
A0A2V6MW77      -IQEQGNSAAQYLVKLNQQYAQLKTEYDLLNLLDLDQ-----------------NLDRAQ
A0A6N4WVA3      -IQEQGSAAGVYLAELKREVAELNTESRSLTSILNEN-------------------AQQK
A0A0R2XPB1      -IQEQGAAASTYLAELKRELAELNTENRVLTSILNVD-------------------AVKM
A0A348NQP1      -IQEQGAAASTYLAELKRELAELNTENRVLTSILNVD-------------------AAKM
A0A357FV58      -IQEQGAAASTYLAELKRELAELNTENRVLTSILNVD-------------------AAKM
A0A2G4GZN8      -IAKDTNTLTAERSVLVRDREETRKQIDENEILVLVI-----------------------
A0A348NPT1      -LESQENIAATQLSSLNTIKIENKHLYDNLETRINLI-----------------------
A0A2E1KV60      -LDKQENIAAEELASLNQIKTAAKMELDQSETRWNLI-----------------------
A0A2D7F4D9      -LDKQENIAAEQLASLNEIKTMAKMNLDQAEIRWNLT-----------------------
A0A3R7RBR8      -LDKQENIAAEQLASLNEIKTMAKMNLDQAEIRWNLT-----------------------
A0A2E0NH28      -LDQQENIANEQLMTLNAIKSGNKNQFDAQETQWNLI-----------------------
A0A368BGT4      -LQSDENIAGAQLAHLNEIVLTNKNTYDQFQTKWNQV-----------------------
A0A317ZP96      -LDSQENIAREQLGSLNTMKLNNKNILDNLETKWNLI-----------------------
A0A350AS32      -LDSQENIAREQLASLNEMKLNAKNVYDMIETKWNLV-----------------------
A0A6N6PLV8      ---PNPDEQNVIITTDGFRAASQERNLLELESRVSTL-----------------------
A0A290QE54      -LDSSVNIVSDRLKTVNAALSSARLDRLQLEELNNQI-----------------------
A0A1H1SWX2      -LDNSMNIVGERLRTVNATLTTARLARLDIETLLSQI-----------------------
A0A1D8AZK8      -LDNSINIISERLRTINATLTSARLSRIDLENLLGQI-----------------------
A0A4Q1C9I5      -LDNSINIISDRLRGYNTSLTDARNARIAIENRLAQI-----------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A1G3ZL71      -LDDSLNIVADQLRRANEARTAARHERLRVENLFRQV-----------------------
A0A556QP09      -LDNSTNIAQANLSSVNQALQGARLDRLAIAEQERLV-----------------------
A0A2T6DX88      -LDNSVNIVSDRLKSVNAALQTARLERLSIEEQVNQV-----------------------
A0A2T6CWI7      -LDTSQSMSDEALKKAHTMRDDARLRLMAVDEKITQV-----------------------
A0A3E1E5C8      -LGNSTNIVGTRLTTVNDALTKARLARIDLETQYHQV-----------------------
B1ZZ74          -LDKNKDIVSERLKTISSTLTSAQLVRLNFENQYALV-----------------------
A0A2E6NAH3      -LQSDENIAAVQLSHLNEIELTNKNIYDQFQTKWDQI-----------------------
A0A2A5VZA5      -LDSQENIAREQLVTLNQIKLESKNNYDQLDTKWNLI-----------------------
A0A424R295      -LDSQENIAREQLVTLNQIKLESKNNYDQLDTKWNLI-----------------------
B4CZV9          ILVNSINNLPADLTKLQMRIDEIGRVRVRLQDPALDSVAKLSLIASADDNDTRLSVGQTV
A0A0E3YV65      -LDESRNIVVDRMKALSSTVTGARVSRVTIEARLNQA-----------------------
W0J900          -LEESQNIVVDRMKAISSALTEAQVARFAINARLQQA-----------------------
A0A3B9FM17      -LEDEKRDTGDRKSQFSSEVTKSRLEQIRINSLLRQILAIKTRIGSNS--------NSVS
A0A2D7WMI4      -LEDIKRDNATRKSQYQSEITRCNIEQLRLDSTLSQIRSILKRINSNKE-------SSNS
A0A2D6VHX5      -IEDAKKINSSKKSQFQAKITASKLDQIQINSILRQILDIRKRISSNKESSIDSTNTGVD
A0A2D8I214      -IEDEKRDTADRKSQYSAEVTTSKLEQIKIDSLLRQVLQIQARIGSRNSSS-----RSKD
A0A1Z8VL41      -LEDAKNSIFARXSQYQSEITRSKXXQXKITTLLKQIINVRVNIGVQNESL-----KSQD
A0A2E6TNA4      -LEDAKNSIFARKSQYQSEITKSKLEQIKITTLLKQIINVRXNXGXQNESX-----KSQD
A0A1Z8RG47      -LEDEKKDTADRKSRYQAEITKCKLEQIRINSLLRQILQIQMRIGNETSSL-----QSAD
A0A1Z8RJJ5      -LEDEKKDTADRKSRYQAEITKCKLEQIRINSLLRQILQIQMRIGNETSSL-----QSAD
A0A2D7V631      -LEDEKKDTADRKSQYQAEITRCKLEQIRINSLLRQILQIQMRIGAQTSSL-----KSDD
A0A354RA24      -LEDEKKDTADRKSQYQAEITRCKLEQIRINSLLRQILQIQMRIGAQTSSL-----KSDD
A0A2E9RV62      -VEDERLDNAARKSSYHSEITKAKVEKVRINSLLRQIIQIQASISSRIQND-----GASK
A0A2E4AY96      -LEDDKKDISAKKSQYQAEITRCRIERLRIESLKSQVLAVDNKI----KSR-----KVES
A0A3B9B9P4      -LEDDKKDISAKKSQYQAEITRCRIERLRIESLKSQVLAVDNKI----KSR-----KVES
A0A2D5Y6N6      -LEDEKQDTSARKSQYQSEITSSKLEQIRINSLLRQILQIQVRIGSQSEST-----SSQD
A0A2E7HSS8      -LEDEKRDTGTRKSQYSEEVTKSRLEQIRINSLLRQILAIKTRIGSGSDSV-----SSKD
A0A2D8VCK3      -LEDEKRDTGDRKSQFSSEVTKSRLEQIRINSLLRQILAIKTRIGSNSNSV-----SSKD
A0A350QVY4      -LEDEKRDTGDRKSQFSSEVTKSRLEQIRINSLLRQILAIKTRIGSSTNSV-----SSKD
A0A2E4ZYR7      -IADEKKDVADRKSQYQSAITQAQVEKLKIQSTLRQIIAIQGRVERATNAV-----KDNE
A0A2E6TCV1      -IEDDKKDNAERKSQYQNAITTADVKLLEIDSHLVSIRGIHNKVVQSLKAL-----TATG
R7E4L8          DMDTTLDATFNRVQEIGTELFSTRTELIQVKVLARLL-----------------------
A0A4Q3BVY2      -----AMLEQQSLLEIPKQLIQTRERLARMRDVRILLTNLENKASAEGSEGGTGSDQKIG
A0A4P6PCA7      ------------LEQRRESLRAILADLGTQKAGLENQ-------------------LALR
A0A2T6DSN5      -VGENKGVIAQKVVQLGQSLVGIELEQTNLRTILETI-----------------------
A0A317ZIW7      -IQEQGSAAGTYLADLKRRLAELKTESRTLSSISDSS--------------------EVE
A0A7C4PPT4      ---QTKLALLQEVPKQLVEVSERLEVLERVKKTLDDESMDAVSRLSLLAAILKNSTIRPG
A0A7C4QZX4      ---AVKMDELKQLPRKIAIISSRLSQLDRIQSTLESTNLSLVDKLSLLQVLQRESQLQPG
A0A3D4HHL8      -IQEQGSSVGAYLAELNQQLAELETQYRFLDTLSLDA------------------IGERA
A0A366HV03      ------------LLIKQNSLAQIPLDILRVQHRMRQY--DEVRGIVQSRSQNSVIAPLEH
A0A6G6K911      ------------LLIKQNALAQIPLDILRVQHKIRQY--DEVRSIVESRVQNGAMDPLEH
A0A5R8KAF2      ------------VKIEQSRLFMVPAELIMTKEVVRRMEEVRLSLDQRGTLGTAPEKLTAE
A0A7C4LRZ6      QQRLDGLLDEYTAVQTLRQRLENKTSLDLLKGGVMDA-------------------PKRP
A0A351MR11      ------------IVKDTNTLGSERGALVKDREELRRQ-------------------IDEL
A0A388PR45      ------------IAGTTNSIAAQRSKLIQDREDYRKQ-------------------LDEI
A0A388QR61      ------------IAGTTNSIAAQRAKLIQDREEYRKQ-------------------VDEV
A0A4P5YHI0      ------------IAGTTNSIAAQRAKLIQDREEYRKQ-------------------VDEV
A0A2A2RS01      ------------IAKDTTTLNTERGVLVRNREDARKQ-------------------IDEL
A0A2A2Y1A7      ------------IAKDTTTLNTERGVLVRNREDARKQ-------------------IDEL
A0A388PDH9      ------------IAKDTTTLNTERGVLVRNREDARKQ-------------------IDEL
A0A2G4H1E7      ------------IAKDTNTLTAERSVLVRDREETRKQ-------------------IDEN
A0A2G4GZA6      ------------IAKDTNTLTTERSVLVKDREETRKQ-------------------IDEN
A0A388P514      ------------IAKDTNTLTTERSVLVKDREETRKQ-------------------IDEN
A0A2A2YG59      ------------IAKDTNTLTTERSVLVKDREETRKQ-------------------IDEN
A0A2G4F7D5      ------------IAKDTNTLTTERSVLVKDREETRKQ-------------------IDEN
A0A2V2SDN0      -LQEQGSGAGSYLALLNRQLATLRTELQLLQLVQPDQ-----------------WVEIGS
A0A1V6GL40      -TQEQGNSPAHYLTTLYQRLVTLKSEYALLQRLTLDQNLARRQAAGGTFSLGNEPLAEGN
A0A2V5X6Z6      -LQEQGNSAGSYLASLNKQLATLRTELRLLQSLQPEQ-----------------WIETGH
A0A2V5VGZ7      -LQEQGNSAGSYLASLNKQLATLRTELRLLQSLQPEQ-----------------WIEAGH
A0A2V5U130      -LQEQGNSAGSYLASLNKQLATLRTELRLLQSLQPEQ-----------------WIETGH
A0A2V6C237      -LQEQGNSAGSYLASLNKQLATLRTELRLLQSLQPEQ-----------------WIETGH
A0A3R8L982      ---------LTSVNAALQTARLERLAIENLNNQVEAF-----------------RKDNKD
A0A6N6QBS9      ERAKSEYLTLQTERKLYEAATAEEVAAGNIESKRPAR-----------------VRVSKD
A0A2E7HPU9      ------------------------------------------------------------
D5EML0          -VQQDKGITADRLARLNDAL--TDAEIRQLSVETRQR-----------------QIAAAD
A0A7C4PPJ4      QQRLDKLLDEMTAVQTLRQRLENKSSRDLLKGGMVET-----------------RRMPDR
A0A3C1C1M3      ---------MDVLAGRRKTIEESLLHFNESLSEVEAK-----------------ASMEQK
A0A2S7U4L6      DLQQENMLYDEAVKARDE-----------LERQVKDL-----------------VGLDDE
A0A2E9EYJ1      QPNTGT---ASLVMAAKQREFAAEEAIQNLRSTIKSL-----------------TQLEGA
A0A258AXR6      EMRSEK---DSMVISREQALMIADQEILTLQSEIDQV-----------------SKLTPD
A0A3D3NZQ6      ELRTTG---DSMAVTREQAIFQADLDVETLSAEIGQL-----------------QTLEGD
A0A1T4WVZ9      NLRTTE---DSMVVTREQALLNTELEVQALQAEIAEL-----------------SKLSDE
A0A4R7SSI6      TLRTKE---ESMVMSREQALLQADLEVQSLRAEIDEL-----------------SKLEGD
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      EIPS---TGTSERQ----------------------------------------------
A0A258AXL1      IVTPQVAKRANEWE----------------------------------------------
A0A2E6T1E0      EVRK--------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ----ASTLADNLKESERKQGLISVETGLPDSGIA--------------------------
A0A2V6N5E0      NLDRAQNKTEAASGQGSDNQGMPFSDVGPEGDYL--------------------------
A0A2V6NH44      ----------------------PFSDVGPEGDYL--------------------------
A0A432FDF6      ------------------------------------------------------------
A0A522ACN3      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ---------------GPEGLAQAITTDAPDTLLT--------------------------
A0A3C1UJT2      ---------------EQLEIVSLIPSVAKNEDFK--------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      -------KAALADGRAGVPENPYTL-----------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ------------KESERKHGLISVETGLPDSGIA--------------------------
A0A2N8IV96      LLNAETVGADALR-----------------------------------------------
R7E1V8          LLNAESVGAKALR-----------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2E5EJ69      -----------QQYSNNVERLLTVQSILDDKQVS--------------------------
A0A2G4I5Z5      -----------RRVGGKVSELLILASISRAPEVA--------------------------
A0A4P5QQV6      QIARDRKMPKPDGGDLREGDPRIPSATGPLLEYE--------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      -----------EDYRKRGQSLYEISAIIGFGNVA--------------------------
A0A290QD69      -----------EDYQKNNKNILEISDIASYGNVS--------------------------
A0A2E7VDS1      RTTKDNEHARTNDEMEKIKEYFEISAVETYGNVQ--------------------------
A0A7C8D3W3      SSPLNSTANQLTEPFIKDTNDERYRKIAKDSSYR--------------------------
A0A178IFJ2      -----------ESVIAKNSSPLELASITEFSSLA--------------------------
A0A357FSP9      --------ESFRRAGRNLSELPFIA---EQGQVS--------------------------
A0A1T4WWY4      KDPLEAGRVVRKGG---AVAPFTFSSPSTDKKFT-------------QVVVQPNMVDGLK
A0A3D3LEQ6      DDPLSVGRIVRRTGDPRTSAPATFQTPEMAKEYN-------------QIVVQPDMVEGIE
A0A3D3NW23      DDPLSVGRIVRRTGDPRTSAPATFQTPEMAKEYN-------------QIVVQPDMVEGIE
A0A2A2R174      -----------RRVGVKVAELLTLSTVSRVPEVV--------------------------
A0A1H2DTI1      ---------------GDLQGLPVVAGASNSQQES-------------RMRLAAATTEFFK
A0A1H1MGC9      -----------QERKATPAQLLDLPFISSSQLIG--------------------------
A0A1V5L462      -------------SLDQIQDVVNLDTIESSQNYR--------------------------
A0A3D3LGD3      -----------QTLEGDELVARAGGLKLDNANVA--------------------------
A0A350ARX4      -------------ITTSVVEQSPLIEAESVALLN--------------------------
B5JIS2          ------------------------------------------------------------
A0A6N6ZC77      ----------QLQNPEGLGLDKALLNSAATDDYQ--------------------------
A0A7C5H7K5      IRIEDS----------------------VSAGYL--------------------------
A0A538NJ59      GADS----------------EIAST---GTSERQ--------------------------
A0A2A2R3V9      TAEKRTPDSEEIKAAAGDLLSPE-------SEYR--------------------------
A0A3C1VFY9      GLGTGNGILANAALGGQSTLFAPST---MGMQYL--------------------------
A0A2V2SMX4      DVNN----------SASSSLSANDS---SQNDYF--------------------------
A0A522AC27      GSER----------GGGG---RN-------ANYE--------------------------
A0A6M1RFD0      GQQR----------SPVDVLRAD-------SEYL--------------------------
A0A7C3HXH0      GQQR----------SPVDVLRAD-------SDYL--------------------------
A0A1H2GQN6      ----------KNLSTEDLIDTLPSLGLNDANIDQ--------------------------
A0A512M3Y3      APIAGSTVAGLSSD-SPSAPIPAVPAGASAGAMM-------IAAMSQPKIVVPSMVEELE
A0A4P5R5J1      SVATGAEGQLNRMD-------SLAGAPGPLAEYL--------------------------
A0A4P5YK43      AKDAASAVTAGPDKSKTADPLAPFR----QNSYT--------------------------
A0A2A2RPW6      -----------QKVGNSVDELLKLPMISRSPEVA--------------------------
B1ZT68          -------DEYRKEG-KDLFEIPAIL---GYGQVS--------------------------
W0J7C2          -------EEYQAGN-RDLLEITQIR---TSGQVA--------------------------
B4D1I7          KIAADESRAGDKDGERNPRLTGQ-----PEMEYT--------------------------
A0A353F286      LVQLTSEELISYAAGLDLPQNQVTA-----------------------------------
A0A354FSA6      LVQLTSEELISYAAGLDLPQNQVTA-----------------------------------
A0A3B9GA54      LVQLTSEELISYAAGLDLPQNQVTA-----------------------------------
A0A520LEH8      LVQLTSEELISYAAGLDLPQNQVTA-----------------------------------
A0A6B2M0T8      -----------QEAKGDLDLLAKLPAINQMGTLP--------------------------
A0A2D7B7R6      VDAASEKARPDNLTNEQLEIVSLIPSVAKNEDFK--------------------------
A0A2E5K4P7      -------LAYEAEG-RSLLDLGFIS---NTTHVA--------------------------
A0A2V6F9Q9      KTKTEASPG----ASPTDQAGMPFSDVGPEGDYL--------------------------
A0A2V6NZZ3      KTQTEASPN----PSANDQVGMPFSDVGPEGDYL--------------------------
A0A2V6EBU2      KTQTEASPN----PSANDQVGMPFSDVGPEGDYL--------------------------
A0A2V6EY06      KTQTEASPN----PSANDQVGMPFSDVGPEGDYL--------------------------
A0A2V6ME53      KTQTEASPN----PSANDQVGMPFSDVGPEGDYL--------------------------
A0A538NUU0      KTQTEASPN----PSANDQVGMPFSDVGPEGDYL--------------------------
A0A2V6NIJ1      K--TESSPG----ASPTDQVGMPFSDVGPEGDYL--------------------------
A0A2V6C292      K--TESSPG----ASPTDQVGMPFSDVGPEGDYL--------------------------
A0A2V6D2X0      K--TESSPG----ASPTDQVGMPFSDVGPEGDYL--------------------------
A0A2V5ZUK1      T-KLDS-SS----GQASDNQGLPFADVGPEADYL--------------------------
A0A2V5XFN9      N-RTETAAS----NQPVENGGLPFSDVGPEADYL--------------------------
A0A2V6EZC8      N-RTETAAS----NQPVENGGLPFSDVGPEADYL--------------------------
A0A2V6I7Z5      N-RTETAAS----NQPVENGGLPFSDVGPEADYL--------------------------
A0A3B9LCP2      I-KPESLAN----GQTAEDQGLPFAGVGPEGDYL--------------------------
A0A3C0R669      I-KPESLAN----GQTAEDQGLPFAGVGPEGDYL--------------------------
A0A2V6EID2      N-KSEMNLG----GQSTEDQGMPFSGVGPEGEYL--------------------------
A0A2V6MHB0      N-KSEMNLG----GQSTEDQGMPFSGVGPEGEYL--------------------------
A0A2W5YWL9      S-TAKPEASPSASASEQT--GMPFSDVGPEGDYL--------------------------
A0A2V5NH62      G-KNDMPSAPNTQSNDDKPPGMAFSDVGPEGDYL--------------------------
A0A2W6A620      G-KNDGTTPPSTQSTDEKAPGMAFSDVGPEADYL--------------------------
A0A2V5PIJ4      V-QPDGAGSTNTQPSDDSA-GMAFTDRGPEGDYL--------------------------
A0A2V6K2G8      N-KMDSAGGAN--PGSDNQ-GLPFSDVGPEGDYL--------------------------
A0A2V5W206      N-KTEAASG----QGSDNQ-GMPFSDVGPEGDYL--------------------------
A0A2V6MW77      N-KTEAASG----QGSDNQ-GMPFSDVGPEGDYL--------------------------
A0A6N4WVA3      SLLIDQLQGAGRGE-APSSEAFNGGGVDENQKYI--------------------------
A0A0R2XPB1      SLLLDQWQGA-----EDTSSATTGGSAGDNQSYQ--------------------------
A0A348NQP1      SLLLDQWQGA-----EDTSIAASGGSDGDDQSYQ--------------------------
A0A357FV58      SLLLDQWQGA-----EDTSIAASGGSDGDDQSYQ--------------------------
A0A2G4GZN8      -------ASYESEG-RPVGDIPQIR---ADNDVA--------------------------
A0A348NPT1      -------ESFRRAG-RNLSELPFIA---EQGQVS--------------------------
A0A2E1KV60      -------QDYLRQN-KDLWELPFIS---QQIRVA--------------------------
A0A2D7F4D9      -------QDYQKQG-KELWELPFIS---EQIRVA--------------------------
A0A3R7RBR8      -------QDYQKQG-KELWELPFIS---EQIRVA--------------------------
A0A2E0NH28      -------ESYRRDG-RDLWELSFIA---DQSRVA--------------------------
A0A368BGT4      -------ETYRKEG-RNLWELAFVA---EQLRVS--------------------------
A0A317ZP96      -------ENYKREG-KDLWELSFIA---EQERVA--------------------------
A0A350AS32      -------ESYRREQ-RDLWELSFIS---EQSRVA--------------------------
A0A6N6PLV8      KLHLDLLQKLKPEELPQALRALQII---DPAVEK--------------------------
A0A290QE54      -------ASFKKDA-RNLLEIAAIS---NHGTIP--------------------------
A0A1H1SWX2      -------EKMQKENPANLLEIGYIS---AYGNIP--------------------------
A0A1D8AZK8      -------ERMQQAG-GNLLEIGYIT---AYGNIA--------------------------
A0A4Q1C9I5      -------ERMQQAG-GNLLDIDYIS---AYGNVA--------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A1G3ZL71      -------EAYRQNG-RDLLELSEIT---GYGNIP--------------------------
A0A556QP09      -------ERYQAEK-RNLLEITAIA---AYGSVP--------------------------
A0A2T6DX88      -------ASYKREG-RDLLQISSIA---NHGTIP--------------------------
A0A2T6CWI7      -------EAYQKEK-RNLFEVVEIA---NYGAVP--------------------------
A0A3E1E5C8      -------EAYRKEG-RNLMEIAYIA---GHATVP--------------------------
B1ZZ74          -------EAYRKEG-RNLVEIQFIA---GHGTVP--------------------------
A0A2E6NAH3      -------ETYRLEG-RNLWELPFVA---EQSRVA--------------------------
A0A2A5VZA5      -------ETYKREE-RKLWQLTFVA---EQSRVS--------------------------
A0A424R295      -------ETYKREE-RKLWQLTFVA---EQSRVS--------------------------
B4CZV9          AQPQSGQSADKKDA-AANNSVVVVP---SLLKSL-------------------------H
A0A0E3YV65      -------EFIMAGG-GDPLELAAAT---EFANLS--------------------------
W0J900          -------ESIISKN-SDPLELASVT---EFSSLA--------------------------
A0A3B9FM17      SKDIKDDIAVIKEF-FEIDAIEQFG---NIPALR--------------------------
A0A2D7WMI4      ---IEERFELFSEI-FKIDEIENFA---NIPALR--------------------------
A0A2D6VHX5      ---VESNIAQIKQY-FEIDVIEGFG---SIPSLR--------------------------
A0A2D8I214      ---IDNDIALIKDF-FEIDAIESFG---NVPSLR--------------------------
A0A1Z8VL41      ---IETDIAMIKEF-FEIDAIESYG---SVPALR--------------------------
A0A2E6TNA4      ---XEXDXAXIKEX-FXIDAIESYG---XVPAXR--------------------------
A0A1Z8RG47      ---VAGDIAVIKEF-FELDAIESYG---NIPSLR--------------------------
A0A1Z8RJJ5      ---VAGDIAVIKEF-FELDAIESYG---NIPSLR--------------------------
A0A2D7V631      ---VEGDIAVIKEF-FELDAIETYG---SIPSLR--------------------------
A0A354RA24      ---VEGDIAVIKEF-FELDAIETYG---SIPSLR--------------------------
A0A2E9RV62      D--VNANIDAIKEY-FKIDAIESFG---NVPALQ--------------------------
A0A2E4AY96      ---IEERYALFGEF-FKIKEINQFG---RIAFLR--------------------------
A0A3B9B9P4      ---IEERYALFGEF-FKIKEINQFG---RIAFLR--------------------------
A0A2D5Y6N6      ---IDDDIAVIKEF-FEIDAIESYG---SIPSLR--------------------------
A0A2E7HSS8      ---VNDDIAVIKEF-FEIDAIEEYG---NIPSLR--------------------------
A0A2D8VCK3      ---IKDDIAVIKEF-FEIDAIEQFG---NIPALR--------------------------
A0A350QVY4      ---IKDDIAVIKEF-FEIDAIEQFG---NIPALR--------------------------
A0A2E4ZYR7      HARANAETDKIKEY-FEISAIEGYG---NVQTLR--------------------------
A0A2E6TCV1      PARTTAKIKIIEDF-FKISAIAEYG---NVNSLR--------------------------
R7E4L8          -----------ADR-SRQQDMIPANIGIQDAGIA--------------------------
A0A4Q3BVY2      NMMSLLSLLGSFEN-EAEVNVGDIV---PNGQFK---GSLTSVKTPETNIVSPAEVDSIE
A0A4P6PCA7      QTEYDYLSEWEESG-RSIETLPTGLP--KEQQLY--------------------------
A0A2T6DSN5      -------ETYQKNN-RDLMEIPQIA---SFGGVG--------------------------
A0A317ZIW7      ELILKDVPTPDDGS-SDGTIVSAIGSKEDNEKYT--------------------------
A0A7C4PPT4      DLVPAGDG-------SAKASVVVLPPNVTSPSQM--------------------------
A0A7C4QZX4      EVINAGTGEEIAGE-NPKTALVVLPTMLPQGNTP--------------------------
A0A3D4HHL8      QAVAELAKAKRKNN-TEVVPAENHSGAALTSELY----------------------KLSE
A0A366HV03      LSLLESAKKSSLDE-NPVGQLVVPASGDLKDALLVPSNSPAPLAAP-SIVVQPSMVEGLN
A0A6G6K911      LSLLDSAKKSSLDE-NPVGQLVVPATGDLKDNLLTPSVAPVAAITPSSIVVQPSMVEGLN
A0A5R8KAF2      QIFAELSMLTAFEK-ERELRVGDLLRRQSQQGMVDKPEGAPAQPVPASFVVQPNMVEGLR
A0A7C4LRZ6      PARGSEDALGPNRR-EASDPLERFL---GESKYA--------------------------
A0A351MR11      AIIWEQIEQFKKEG-KDLVLIPMVK---SDDRVA--------------------------
A0A388PR45      GIVVALVAQYRAAG-RDLSEIPLVR---SDADVA--------------------------
A0A388QR61      GIVVALVKQYRVAG-RDLAEIPLVR---ADVEVT--------------------------
A0A4P5YHI0      GIVVALVKQYRVAG-RDLAEIPLVR---ADVEVT--------------------------
A0A2A2RS01      EIIWKLILEYKTAG-KDAYDIAQVR---TDERVA--------------------------
A0A2A2Y1A7      EIIWKLILEYKTAG-KDAYDIAQVR---TDERVA--------------------------
A0A388PDH9      EIIWKLILEYKKAT-KDVYDIAQVR---TDERVA--------------------------
A0A2G4H1E7      EILVLVIASYEQEG-RSLGDIPQIR---ADTDVA--------------------------
A0A2G4GZA6      EILVSVIASYEKES-RPLGDIPQIR---ADTDVA--------------------------
A0A388P514      EILVSVIASYEKEG-RPLGDIPQIR---ADSDVA--------------------------
A0A2A2YG59      EILVSVIASYEKEG-RPLGDIPQIR---ADSDVA--------------------------
A0A2G4F7D5      EILVSVIASYEKEG-RPLGDIPQIR---ADSDVA--------------------------
A0A2V2SDN0      RTRPSGPGEPPAGE-ASPQDIMAGLTG-PQSDLF--------------------------
A0A1V6GL40      DSLPDTNAVALTAG-GTPGQSSTAAGDRGDTAYL--------------------------
A0A2V5X6Z6      KGVPSG-----------EMLASLAE---PQLELF--------------------------
A0A2V5VGZ7      KVVPSSESLPDQAT-EKEMLASLAE---PQLELF--------------------------
A0A2V5U130      KGVPAGESLPDPAT-EKEMLASLAE---PQLELF--------------------------
A0A2V6C237      KGVPSGESLPDQAA-EKEMLASLAE---PQLELF--------------------------
A0A3R8L982      LIELNIIST--------YGTVPALR---AQLAEH--------------------------
A0A6N6QBS9      RTQEEQDEEGYLQS-ASYPALKFEL---RKLQAL--------------------------
A0A2E7HPU9      -----------------YQIILLTL---EDLEKR--------------------------
D5EML0          GVIDRLMEIPYIG---ERDAVNAVY---AQLSEL--------------------------
A0A7C4PPJ4      TTSDASQPAPQST----GDTLERLL---SESKYA--------------------------
A0A3C1C1M3      MLDALSEGKLPAEI-PGAADVAASL---DRWRQA--------------------------
A0A2S7U4L6      TLISHVSGLNRPE----SAVLALTF---QQYQDA--------------------------
A0A2E9EYJ1      ELIKSAVDL-GVK----NETLNSGW---SEYQTL--------------------------
A0A258AXR6      ELIDQASGL-RLE----NQNITAIT---VKLQDL--------------------------
A0A3D3NZQ6      ELVARAGGL-KLD----NANVAQMT---GELQRL--------------------------
A0A1T4WVZ9      ELVARSSGL-KLE----NANVTNML---AELTRL--------------------------
A0A4R7SSI6      ELVSRASGL-KLE----NTNVTGMM---ADLNKL--------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      --------------------RRQDAEAVEAIRRPKLADESQPTSYLLDREKST-------
A0A6N2CMN7      -----------------------MLGVVPRIKKLDTSTKAQAVASNVDR-----------
A0A2V5UAD5      ---GASRDLELLKLQRERL-SKFLRPKHPKIAQLDTQIQRAEKLIELFRNQSR-------
A0A258AXL1      ---YIEGQLHSSEREYERL-SNSLLPGHEKMRELRKQIENYQFSLDAEWKKQI-------
A0A2E6T1E0      ----IRGDLALAEAELAEL-LKRYLDKHPKVIEKRGKIESLIEGLASSQKRIF-------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      ---RQIEHYNEAYLEYQKI-AGSAGSQNPITVSLKDRMNSTRAAANKALSNYR-------
A0A2V6N5E0      ---KAKQQIQLLKAERETL-AKDLRPNHPKILKLNDEITKQDKLIQLFRADAL-------
A0A2V6NH44      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIELFRSDAF-------
A0A432FDF6      --------------TLANH-GIDLGEEHPRIKGLKKVVATLEGQIDNRIKGIL-------
A0A522ACN3      ---------NIAEQRLLAL-RKEHGEDHPEVINTQKQIDLLNTKIEARVSGIM-------
A0A353DCA1      ----------------------------------------MKQMV---------------
A0A3C1AXQ2      ------------------V-NSGRGREHPEVEGVDSQILLSKQLILDAVKSHL-------
A0A3D0IZR7      ------------------------------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------MIQLLQRLQESEIELTEAVTNST-------
A0A3D3DET9      ---------MLLRVEQQEL-GRYLRPNHPKMIAMQEDIARREELLKILRTQSE-------
A0A355SVK9      ---------------------------EVELVSAVEN--------------SV-------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ---------------------------HPKIIAATEEIAHLERLLPIYREQSN-------
A0A2V6FIP7      --------------------LKRYKDKYPDVIRVREEIASLKESIQKESQKVR-------
A0A353DI77      ---EAEKEMAVAEKAVQDL-SIRYGPKHPKIISATDHIDLKTKILLSAMMDVLSNDLETD
A0A1V6GCZ3      ---SLLDQLTMAEQRLIAL-EADYGPENTEVLKCKGLAEDLHKKIKSRVEGIM-------
A0A3C1UJT2      ---SINGLYKAAKTTVRNL-EVDLKSKHPLMIDALRNVNNTRRVLLETISDVP-------
A0A2S7U0Z3      ---KLSEQIQEKRNQVIIL-RQRYLPKHPARIQEEALYTDLLESFGGAIKRSSGKPSEKS
A0A5E6MKA7      ---EIKKLLLKEVARYQQM-EETYKPEYPGMTRLHAEIEGLKGELAQEKEGSV-------
A0A6B3L936      ---ELNQELNTFRSELSAF-RQRYKSKHPRLIEAEAIYQDLYRRFRLEIETAARTGDEVD
A0A2N8IR72      ---RQIEHYNEAYLEYQKI-AGSAGSQNPIAVSLRDRMNSTRAAANKALSNYR-------
A0A2N8IV96      ---KTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLR-------
R7E1V8          ---ETYAEFSDKLKEKENLKAQNIGARHPKMLALLETERILGEKLNKELIGLR-------
A0A2E0R252      -------EIRGSETAIAQM-EKRYLPKWPALVEAKELGAILKKNFSKELDQVI-------
A0A3E1EF48      -------RIETTRIAIIEM-EKRYLPKWPDLIEAKELLALLLNRFSTELAQVI-------
A0A2A2PVG8      -------EIDEAERQVAEM-EKRYLPKWPALVEAKELLKILQDRFVQEFNQVM-------
A0A2E0R421      -------EIKLVESRIAGM-EKRYLPKWPALVESKEHSKILKQRFSAELERVL-------
A0A2E5EJ69      ---ALRTQELEKRSEISQL-EERYREKHPKMIAARKEVVDLGARLQEAILAAP-------
A0A2G4I5Z5      ---ALKEKLQVQEATLANH-QLRYREKHPEMIKAKTELESIRQQFEVEVLKAP-------
A0A4P5QQV6      ---RARQRIETLKAERAGY-ARDLTPRHPIMVELDEQIAQQQQLIDTFRKQST-------
A0A2E7ALI1      ---EAHKLLELEAIKVSDL-ARRYRAKHPKMISTVAKLEDSRKKFMSEFLVAA-------
A0A178IDB9      ---SLKTQYENILAERTAL-AERYLEEHPRMRQNALALADTRARLDAAVDLAI-------
A0A290QD69      ---EMKTRIDTLRAERRQL-DERYLSEHPRMKQNQLAMEDAEAGFKSAVDLAI-------
A0A2E7VDS1      ---ALRQKLLDLETTRKAF-EVKYLEKHPKMSANTRAVQELHRLLRLEVKTAI-------
A0A7C8D3W3      ---KIVLELAGLTEEWEKQ-SKLLKTQHPYMVNLSSQIEEFNAQKNRLLVLAT-------
A0A178IFJ2      ---SVQSQLDELVARKAVM-AEKYGRRHPAMIDQERSIQALEKLRGDLILTAV-------
A0A357FSP9      ---QLLSQISAIKIGISSS-SKRYREKHPVMIEQQQTLQESEVELAAAVKDSV-------
A0A1T4WWY4      SWQELERTKRATEEKLRLI-QTKFLDDHPEVIKLKDELKQVESALDIELKVAL-------
A0A3D3LEQ6      PWRELDKKKRSLEEKMAQS-RAKFLDDHPEMIKLREELRETVSALELELQVAR-------
A0A3D3NW23      PWRELDKKKRSLEEKMAQS-RAKFLDDHPEMIKLREELRETVSALELELQVAR-------
A0A2A2R174      ---ALKEKLQAQEAVLVNH-QLRYKEKHPEMIKARAELESIRQQFEAEVLKAP-------
A0A1H2DTI1      AQQKAQERITELETQMKEE-EEYLRPAHPKRVALAAQIADLKRSITLSKEQNI-------
A0A1H1MGC9      ---QLVQQVSAQKIVMSQL-REHYRDKHPKMIEAVNSLAQTERELSRAIDSTA-------
A0A1V5L462      ---NTKRQHQQLLAMKEQF-GIYLKPKHPRMMDIEAELEILSNRIRIFRAQAF-------
A0A3D3LGD3      ---QMTGELQRLEVAREGLVNQGRGRRHPEVLANDSQITKYKELIAAAAKDHL-------
A0A350ARX4      ---KTQQEWTQLKAQLEEY-SLYLKPKHPKIIDLELNIERATNLIDILERQTT-------
B5JIS2          ---RLRQELDKLNGQREVM-ALRYGRNHPKMRDLDSRIEAVEGNLNRNMEMAL-------
A0A6N6ZC77      ---AAKRRLTQLKAERDQF-GRYLKPRHPKMISLGDEISRTEELMEIYREQAE-------
A0A7C5H7K5      ---KVKQQLLLLKAEQIDL-GQYLRPKHPKMVALAEEISRRERLLEIYKQQGL-------
A0A538NJ59      ---GASRDLELLKLQRERL-SKFLRPKHPKITQLDTQIQRAEKLIELFRNQSR-------
A0A2A2R3V9      ---NSNQQIQLLLLQRDEL-SQYLKPKHPKIIALNAEIQRQQTLLDMFKKQSI-------
A0A3C1VFY9      ---SIKQQILLLKAEQDRF-GEFLKPKHPKMVAMNEESEKMGRLLGIYRDQSV-------
A0A2V2SMX4      ---KAKQQIALMEAQKQDW-SEFLRPKHPKMVALDEDISRRRRLLGIFKDQSS-------
A0A522AC27      ---LTYQKRTVLLAEKERL-EEYLRPKHPRLIGINEEIAQQERLLNTYRKQTS-------
A0A6M1RFD0      ---KVKQEIQVLKAEEQQL-SEYLRPKHPKMIALREEIQRKEKLLDIVREQSA-------
A0A7C3HXH0      ---KVKQEIQMLKAEEQQL-SEFLRPKHPKMIALREEIQRKEKLLDIVREQSV-------
A0A1H2GQN6      ---IRQQELQGSANIQSLL-KGGFGEEHPRVQSLRAAVGRAQEQLKSLAEGKR-------
A0A512M3Y3      PWERTERDLRVARQKREQA-AQTYLPGHEIMRNLDREITDLEASLSSEVNTAI-------
A0A4P5R5J1      ---KVKQAINQLKADRQEF-LQTLKPKHPAVVALDEQIAKNEAMLGTYKQLGQ-------
A0A4P5YK43      ---EHKLNLKAREAEYFRY-QATLKPKHPFLVSLQNEIQRTRQELQFQLDNIE-------
A0A2A2RPW6      ---ALKEKLQSHEAALSNL-QLRYKDKHPTMIQARNELSTLKAQFEVEIRRAP-------
B1ZT68          ---ALRTRYAELQAQRKLL-GEKYLRLHPKMTQNELETTETKRLLDEAAAQAI-------
W0J7C2          ---DLNNSLISLLTQRTLL-AEHYLGEHPKMKQNEAETRETRRMLAESIAKAV-------
B4D1I7          ---HARQQIEVLKSERAEY-AKDLRSKHPIMVELDRQIAQQQQLIDAFRKQSA-------
A0A353F286      ---YALQNRSAVDRMLDLE-AQGIGKKHPDMVTMKQRAEGALAKAHEEVISLK-------
A0A354FSA6      ---YALQNRSAVDRMLDLE-AQGIGKKHPDMVTMKQRAEGALAKAHEEVISLK-------
A0A3B9GA54      ---YALQNRSAVDRMLDLE-AQGIGKKHPDMVTMKQRADGALEKAHEEVISLK-------
A0A520LEH8      ---YALQNRSAVDRMLDLE-AQGIGKKHPDMVTMKQRADGALEKAHEEVISLK-------
A0A6B2M0T8      ---SKFESRNNLLAERNSL-SLRYGRRHPRMIENASSLEGVETEIQAALEKNV-------
A0A2D7B7R6      ---SINGLYKAAKTTVRNL-EVDLKSKHPLMIDALRNVNNTRRVLLETISDVP-------
A0A2E5K4P7      ---TLVARNSLKKEELGLL-AARYRSKHPKMLQALQAQALVKKELDNAILMAR-------
A0A2V6F9Q9      ---KAKQQVQLLKAERDTL-SQDLRPRHPKIIKLNDEISKQEKLIAVFRADAV-------
A0A2V6NZZ3      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV-------
A0A2V6EBU2      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV-------
A0A2V6EY06      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV-------
A0A2V6ME53      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV-------
A0A538NUU0      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIDLFRSDAV-------
A0A2V6NIJ1      ---KAKQQVQLLKAERDTL-SLDLRPKHPKIIKLNDEISKQEKLIELFRSDAV-------
A0A2V6C292      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIELFRSDAV-------
A0A2V6D2X0      ---KAKQQVQLLKAERDTL-SQDLRPKHPKIIKLNDEISKQEKLIELFRSDAV-------
A0A2V5ZUK1      ---KAKQQAQMLKAERDTL-AKDLRPNHPKILKLNDEVAKQDKLIELFRADTL-------
A0A2V5XFN9      ---KAKQQVQLLKAERDTR-AKDLRPNHPKIIKLNDEITKQDKLIELFRADTL-------
A0A2V6EZC8      ---KAKQQVQLLKAERDTL-AKDLRPNHPKIIKLNDEITKQDKLIELFRADTL-------
A0A2V6I7Z5      ---KAKQQVQLLKAERDTL-AKDLRPNHPKIIKLNDEITKQDKLIELFRADTL-------
A0A3B9LCP2      ---KAKQQLQLLKAERDTL-AKDLRPKHPKIVKLNDEISKQEKLIDLFRADTV-------
A0A3C0R669      ---KAKQQLQLLKAERDTL-AKDLRPKHPKIVKLNDEISKQEKLIDLFRADTV-------
A0A2V6EID2      ---KAKQAVQLLKAERDTL-AKDLRPKHPKILKLNDEISKQEKLIDLFRADTV-------
A0A2V6MHB0      ---KAKQAVQLLKAERDTL-AKDLRPKHPKILKLNDEISKQEKLIDLFRADTV-------
A0A2W5YWL9      ---KAKQTVQLLKAERDTL-AKDLRPKHPKILKLNDEITKQEKLIQLFRSDAV-------
A0A2V5NH62      ---KAKQALQLLKAERETL-SKDLRPKHPKIIKLNDEVTKQEKLIELYRQDTV-------
A0A2W6A620      ---KAKQTLQLLKAERETL-SKDLRPKHPKIIKINDEITKQEKLIELYRQDTV-------
A0A2V5PIJ4      ---KAKQALQVVKAERDTL-AKDLRPRHPKILKLNDEIAKQENLIKLFREDSI-------
A0A2V6K2G8      ---KAKQQVQLLKAERDTL-AKDLRPNHPKIIKLKDEISKQEKLIELFRADTL-------
A0A2V5W206      ---KAKQQIQLLKAERETL-AKDLRPSHPKILKLNDEITKQDKLIQLFRADAL-------
A0A2V6MW77      ---KAKQQIQLLKAERETL-AKDLRPNHPKILKLNDEITKQDKLIQLFRADTL-------
A0A6N4WVA3      ---QSKEQLQLLHAQLDEF-SIYLKPKHPKIIGLKNQIERTENQLKIHRAQAL-------
A0A0R2XPB1      ---LSKKQLQVLHAQLDEF-SIYLQPKHPKIIGLKNQIERTENQLEIQRDQTL-------
A0A348NQP1      ---YSKKQLQVLHGQLDEF-SIYLQPKHPKIIGLKNQIERTENQLEIQREQTL-------
A0A357FV58      ---YSKKQLQVLHGQLDEF-SIYLQPKHPKIIGLKNQIERTENQLEIQREQTL-------
A0A2G4GZN8      ---AAQTAISGSKIRVSQM-TETYTDQHPKLVAEREALKQLERQLKEATTQAI-------
A0A348NPT1      ---QLLSQISAIKIGISSS-SKRYREKHPVMIEQQQTLQESEVELAAAVKDSV-------
A0A2E1KV60      ---SLTEQISNIRIAMSTM-SKRYREKHPEMRSLLQQLQESQSELDYAVQNAV-------
A0A2D7F4D9      ---TLIEQISAIRIAISTK-SKRYREKHPEMRSLLQQLQESQSELEYAVQNAV-------
A0A3R7RBR8      ---TLIEQISAIRIAISTK-SKRYREKHPEMRSLLQQLQESQSELEYAVQNAV-------
A0A2E0NH28      ---FMLQEVSKTKIEISSL-GKRYRSKHPVMIQLLQRLQESEIELTEAVTNST-------
A0A368BGT4      ---SLLQQISSTRISISSA-SKRYREKHPAMIELLQTLQEGELELELAVQNSV-------
A0A317ZP96      ---SLLERISGARISISSL-SKRYREKHPVMIQQIQTLQEAEMELESAVKNAV-------
A0A350AS32      ---SLLESISQAKIQISSL-SKRYREKHPVMIQLLQQLQESEAELSSAVQNAV-------
A0A6N6PLV8      ---AGQSIGEFSIEEKRLL-TSGVGENHPRVATLRGQLAVYRSQLQIALNGQL-------
A0A290QE54      ---AVSSQLSELTRQQSVL-AQRYFERHPKMIELEKSIKAAREQLTRATDLAI-------
A0A1H1SWX2      ---VLKNNLAELNKQQAIL-SERYLERHPKMIELANSIDVVTAQITRNIEQSI-------
A0A1D8AZK8      ---ALKTQLAELQNQQSLL-AERYLERHPKMISVANSIDVIAAQIQNDIAQSL-------
A0A4Q1C9I5      ---ALKTQLTDLQNQQSIL-SERYLERHPKMINVANSIDVLTAQIKTDIAQAI-------
A0A2E0V4K6      ---ETHAALEVEEVKVADL-ARRYRGKHPKMIAASAKLAAAKGSFLEEFLVAA-------
A0A1G3ZL71      ---ALRNQLSELLQTQKVL-SDRYLERHPRMIELARQIATVRADLEKSIQLAV-------
A0A556QP09      ---DLSKQLETLNRDHSLL-AERYLERHPKVINVVNAIHVAQEQLDTAIRLSI-------
A0A2T6DX88      ---AIRTQLADLQRQQSVL-SERYFERHPKMMDLARAIKVSQDQLASAIDLAI-------
A0A2T6CWI7      ---SLRAQLSTLQQEQNIL-SERYYERHPRMIDVANRIDVTEKELAKAVQLAI-------
A0A3E1E5C8      ---TLKNQLSNLHQNQSVL-GERYLERHPKMVDLANQVTVVQDQLEKAVDLAV-------
B1ZZ74          ---TLSAQLSSLLQSQSVL-AERYLERHPKMIDLANSIAIVQEQLGKALDLAI-------
A0A2E6NAH3      ---SLLQQVSSTRIEISSL-GKRYREKHPAMIQLLQTLQEGELELSRAVQNSV-------
A0A2A5VZA5      ---RLLESISATRIEISSY-SKRYREKHPIMIQLLQTLQESEIELQEAVTNSV-------
A0A424R295      ---RLLESISATRIEISSY-SKRYREKHPIMIQLLQTLQESEIELQEAVTNSV-------
B4CZV9          PWDELAQQQQQVKKEISEG-LRKYLPTAGAMKPLYQQLDVINQRLDAEVEVAT-------
A0A0E3YV65      ---AVQSQLDTLRTQRATM-GERYGVRHPSMIENDRSREALERLRTELITAAM-------
W0J900          ---SVQSQLDGLIAKKAVM-SEKYGRRHPAMVEQERSIQALEKLRGDLVRAAL-------
A0A3B9FM17      ---QTLYDLEKTRRDYEET-GSGYLERHPKMLENARSVQQVKSALRQSVTSAI-------
A0A2D7WMI4      ---SSLFELYKQRRDYQEV-GTGYLSKHPKMLSNARQIQDTYGRINKQVKDAI-------
A0A2D6VHX5      ---QELLEHELQRKTYVET-GTGYGPNHPKMIENARQVQEVQELLRKEVTLAI-------
A0A2D8I214      ---KTLFDLEKTRMRYQEG-SPGYLERHPKMLENARQVNEVKNSLIKEVTSAI-------
A0A1Z8VL41      ---KNLFDLEKTRRDYQEL-EPGYLERHPKMLSNAKQVKDVKKALALEVKSAI-------
A0A2E6TNA4      ---KNLFDLEKTRRDYQEL-EPGYLERHPKMLXNAKQVKDVKKELAXEVKSAI-------
A0A1Z8RG47      ---QTLYNLELTRKNYQET-GTGYLERHPKMMENARQVLEVKQSLNLAVKSAI-------
A0A1Z8RJJ5      ---QTLYNLELTRKNYQET-GTGYLERHPKMMENARQVLEVKQSLNLAVKSAI-------
A0A2D7V631      ---KTLYDLETTRKNYQET-GTGYLERHPKMMENARQVSEIKTTLNLEVKSAI-------
A0A354RA24      ---KTLYDLETTRKNYQET-GTGYLERHPKMMENARQVSEIKTTLNLEVKSAI-------
A0A2E9RV62      ---KRLFDLEQSHKLY----GQKYLANHPKMIETARQIKDVERILQLEVKASI-------
A0A2E4AY96      ---EDLQKLYSTRKNYQEV-GTGYLEKHPKMLANARQIRDTNMQILSEIRNAI-------
A0A3B9B9P4      ---EDLQKLYSTRKNYQEV-GTGYLEKHPKMLANGRQIRDTNMQILSEIRNAI-------
A0A2D5Y6N6      ---QNLYDLESKRRDYQET-GSGYLERHPKMIENARQVQLVKQALNKEVKSAI-------
A0A2E7HSS8      ---QTLYNLEKTRRDYEET-GSGYLEKHPKMLENARNVLQVKNALKDEVTSSI-------
A0A2D8VCK3      ---QTLYDLEKTRRDYEET-GSGYLERHPKMLENARSVQQVKSALRQSVTSAI-------
A0A350QVY4      ---QTLYDLEKTRRDYEET-GSGYLERHPRMLENARSVQQVKSALRQSVTSAI-------
A0A2E4ZYR7      ---QKLLDLETIRKEHE----VKYLELHPKMSSNTRAIMELHRLLRLEVKTAI-------
A0A2E6TCV1      ---TELQEHEKTRKTYE----AKYLENHPKMKENALAIGELHKILLNEVQVAI-------
R7E4L8          ---KQIELFNDNFLQHKKL-FASAGRQNPMVSSLAENMKEMRESIGRSIANYC-------
A0A4Q3BVY2      PWRKLEKERRLLISQIRQN-STIYQPGHRVMKDLEKKLEDTERALETEFKMLR-------
A0A4P6PCA7      ---ELLGVWQTALDEFQRV-SEKYTEKHPRYQEAKRAEERALSRLDQFVEVSW-------
A0A2T6DSN5      ---ALRGELENLKAERRML-SETYLDEFPKMKENALATENTEKRLQANIELAI-------
A0A317ZIW7      ---EAKNQLDQLKADLEEF-EIYLKPKHPKIIGLKDQIERTSNQLEILRRQAF-------
A0A7C4PPT4      RWEDLQREYEKLQLTSNEL-SKKYLPGHPKMAEVLKKMEEIKSALEAELRAAQ-------
A0A7C4QZX4      PWEQLQRDREQCKTALDEA-AKKYLPAHPKMAELLRKMDQINKSIEAELAGAQ-------
A0A3D4HHL8      QYLVAKKELNLLKAQRDEY-LTYMKGKHPKLAAVNLEIERKENEMSVLKRQAL-------
A0A366HV03      SWQMLERDKRKVETEIAEA-SRVYLEDHEILKALRTKQRQIDESLTTELEVER-------
A0A6G6K911      PWHTLERDKRKVETEIAEA-ARVYLEDHKVMKELRAKQRQISEALTTELDVER-------
A0A5R8KAF2      PWQDLEKKRRVIEEELMEA-NKRYLPAHAIVKGLEEDLANNTRALAAELEVMR-------
A0A7C4LRZ6      ---ELEFKLRGLEMDYEAR-LKTLKPQHPFMVALQAGLDQVKREMQFQVELIE-------
A0A351MR11      ---ALYNRVSELQVTIETL-EKKYTESHPTLRISREQLDVTKRELKTAIEMSV-------
A0A388PR45      ---AARAKMTDAQTRVRAM-EEIYTDLHPKMIAERQALAQLSAEFQRAVKTKA-------
A0A388QR61      ---NTRNKVAEETAKTRAM-EEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKA-------
A0A4P5YHI0      ---NTRNKVAEETAKTRAM-EEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKA-------
A0A2A2RS01      ---ALGPKVTELRVLVSTM-EKKYTDEHPTLIQTRAQLDQTQKELTQAVANSV-------
A0A2A2Y1A7      ---ALGPKVTELRVLVSTM-EKKYTDEHPTLIQTRAQLDQTQKELTQAVANSV-------
A0A388PDH9      ---ALGPKVTELRVLVSTM-EKKYTDEHPTLIQTRAQLDQTQKELTQAVANSV-------
A0A2G4H1E7      ---TTLTALSASKIRMSQM-TEKYTDQHPTLVAEREALNQVDRQLREAVVQAV-------
A0A2G4GZA6      ---AVQMVISASKIRVSQM-TETYTDQHPKLVAEREALKQLDLQLKESISQAI-------
A0A388P514      ---ATQTAISASKIRVSQM-IETYTDQHPKLLAEREALKQLDNQLKEAVSQAI-------
A0A2A2YG59      ---ATQTAISASKIRVSQM-IETYTDQHPKLLAEREALKQLDNQLKEAVSQAI-------
A0A2G4F7D5      ---ATQTAISASKIRVSQM-IETYTDQHPKLLAEREALKQLDNQLKEAVSQAI-------
A0A2V2SDN0      ---RANQQIRLLKDKRDEL-SKGLRPMHPKILKLNEDIAAQEKLVEGSRSEVM-------
A0A1V6GL40      ---QAQQQLLLLRVEQQEL-GRYLRPNHPKMIAMQEDIARREELLKILRTQSE-------
A0A2V5X6Z6      ---KANQQMQLLKAKRDEL-SRFLRPLHPKILKLNEQIATQEKLVQISRDEAL-------
A0A2V5VGZ7      ---KANQQMQLLKAKRDEL-SRFLRPLHPKILKLDEQIATQEKLVEISRDEAL-------
A0A2V5U130      ---KANQQMQLLKAKRDEL-SRFLRPLHPKILKLNEQIATQEKLVQISRDEAL-------
A0A2V6C237      ---KANQQMQLLKAKRDEL-SRFLRPLHPKILKLNEQIATQEKLVQISRDEAL-------
A0A3R8L982      ---LRTQAVLSER----------YLDRHPRMIEIDNSIRVTRQQLAAAIALAI-------
A0A6N6QBS9      ---YLEKGNN-------------LRTNHPYMVDLARNVALKQQEIDEALRMAD-------
A0A2E7HPU9      ---EATFSELDLR----------YLSKHPKLIAAKNALEEYAFRFLREFDQVR-------
D5EML0          ---KRERLVLDER----------YLRKHPKIVENEAAMKSVSTELSRAIRQAE-------
A0A7C4PPJ4      ---ELEFRLLSKQDEVKKY-SATLKPQHPFMQNLLAEVAKLQREMQYQLDLIE-------
A0A3C1C1M3      ---MTERDALLSR----------YTPEHPAVEAQDKAVALYKEQANQALNRAK-------
A0A2S7U4L6      ---KRERAGVIAQG---------LGENHPQVKHHDSQISILRETLDAKVRRVR-------
A0A2E9EYJ1      ---ELSRAALIXSG---------VGVKHPKIVNIDSQLNLRMNQLLDAVETHK-------
A0A258AXR6      ---KVAREGLVNEG---------RGRLHPQVLSVDSQMAEYQSLILGAAKAHV-------
A0A3D3NZQ6      ---EVAREGLVNQG---------RGRRHPEVLANDSQITKYKELIAAAAKDHL-------
A0A1T4WVZ9      ---QVTREGLVNAG---------RGRRHPEVMGVDSQIALSKQLILDAVKAHL-------
A0A4R7SSI6      ---QVTREGLVNAG---------RGRKHPEVIGVDSQIILSKQLILDAVKSHV-------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      --------------------------------------------EYENLQRSVSRLQALY
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      --EQIAAAQQVLKLKMNGIQTSIKE----SLGKVLAANDR--IADAERMKMNISRIQFHY
A0A258AXL1      --ASFHLEKEHLQQRLESLQDKLPE----YRKLIAGYDDF--RRDYKLQSSGHLAWEAAY
A0A2E6T1E0      --DSIINKAELAKATALNLKGVLEI----RKSEQQAMNQK--SIQYFALEREAKQSETLY
A0A2D5W0Q9      --PNIKSQSLVERDLQAHLHPQSNA-----------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      -------------------------------------------------------NRALY
A0A3D4CZT6      ------------------------------------------------------------
A0A4V1S9Q4      ------------------------------------------------------------
A0A355VK99      --SNLDLKLNQLIDKRNSLTERLTE----TAIK---------EQEIIPLIREHKVKEELY
A0A2V6N5E0      --EKLKTRRESIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLY
A0A2V6NH44      --EKLETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLY
A0A432FDF6      --AGLGLRVNSSQAQVEQLQRDVDA----AKKRESDMRKT--GREYFDAKRELSNTTRIR
A0A522ACN3      --YSLSNQVEIARSEVGALKRQVED----AKRVDRDKAEK--CRPYFEKKRELEEAIRLR
A0A353DCA1      -----------------------RE----KKDGTVDLSMR--QHQYNSAKEEYEQSRMMY
A0A3C1AXQ2      --SALQTRMDFAIKRRASLQNSNED----AKKGMLDQQSA--QNDYKTAADEVAYIESLL
A0A3D0IZR7      ------------------------------MRGQLRADRSDRLAPYNEARRDFETQSQLL
A0A520LRZ3      -------QLSMAEQQFQNSKETKEK----TEKASLKERKD--NINYIEAKKEYELSKEML
A0A356FSV4      --DKIYAAYIEAKRNFEVSSQRLAE----KENELIQLSKT--RVDYNTLYREFEVQQGFL
A0A3D3DET9      --EQLKNRKELLAVEIEILEKDLKA----WDARNQEFQHK--NAEYQALKANVQRIRALY
A0A355SVK9      --GKVDSAYAEAKTNFELASRRLAE----KESELIQLSKT--RVEYSSLERELNVQQGFL
A0A2E5D7I3      -----------------VELKEVQS----NESEGLATARRLLLARTQVLDGETKSRMSVF
A0A2V5NYE2      --EQLTNKLNSLDMQIKNRRKDIKE----QEEQVLEINRK--TAEWQRLKDNKQRIQAAH
A0A2V6FIP7      --QAIRAEAELAKAKETTMASELKK----KEQESFELSQL--RIQYDVLSRQADQSKLLY
A0A353DI77      YWRGFQDQIDDVKNEENFRELRNAM-----------------KLRASLLTNSVETKNELY
A0A1V6GCZ3      --LGLDTRVLSLSNSLVNLQQEVGR----ATTNDVTQANL--TRPYFEAKRALEELQRFR
A0A3C1UJT2      --KGLYAQIKYQQEFIEELTQSIEN----QTSKLFEWEQL--YMQQAALEQDLEIGTKLI
A0A2S7U0Z3      YWLEYKDEMDALEKIIDGDGPDKSD--AADKWVLLSQGAL--ASRAKLLNNTSEQTRDKY
A0A5E6MKA7      --ADLEADFEAAKANYEGLEQEFQH----SMEKVRGESKA--LAHYALLKREADTDREMY
A0A6B3L936      YWKPLMADVDRLDKQIASAESEADRRDATDRWLSFVQNKL--SSRASVLESRIGSLRGRY
A0A2N8IR72      --SNLDLKLNQLIDKRNSLTERLTE-----------TAIK--EQEIIPLIREHKVKEELY
A0A2N8IV96      --SSLKSKLEMVAASRKHWEATVAQ----KEEDLQKHVLQ--VPMYEQASRDYDAALDQL
R7E1V8          --SSLKSKLEMVSASRKHWEATVAQ----KEEALQKHVLQ--VPMYEQASRDYDAALDQL
A0A2E0R252      --RLSDEEKAFWEQHSESFSSMDAD-----TRIDSQIQIA--STRASVLERELEAEQQIY
A0A3E1EF48      --AGSAEEQRFWKENASVLAGLEGE-----ALIAAQLRTV--ASRASILSKALETEQGIF
A0A2A2PVG8      --NLSEEERKYWETSLASLQGAPME-----ALTNAKRQVV--STRSNVLERELEAEKAVY
A0A2E0R421      --RLSEEERQFWEDAGTSIADVEGE-----ELATDQMQIV--ATRSRSLGRELESEQDIY
A0A2E5EJ69      --SKVHTTILTLSSQIDSQQGRLEA----QEKKVAADQQK--EIEYKHLKAQAESLQAMY
A0A2G4I5Z5      --LRLNQQLQAAIDKEKGLELAVKE----QEKKLSLLNSQ--RSGFDHLQAEVMQNRKLH
A0A4P5QQV6      --EELKRRRDATTLEIRNLETTVKE----WEAKAASNSER--LTQHAGIQAGISRMRAQY
A0A2E7ALI1      --SSAADKSYWEGAGAELQQIANDE----EAGLASARRLL--LARTQVLDGETKSRMSVF
A0A178IDB9      --AETHARLNLARQHEQRLRSEYAA----AEKQAQDLDRI--TIDYKFLEEDAVSKRQAY
A0A290QD69      --AELKNRFNFAKQHELRLRTDYAE----TEKQAQELDKI--TSEYKYIEDESNIKSKNY
A0A2E7VDS1      --KDLTNRVSEMASQESEFTKAMDA----VQRESQKLDDI--ETRINEMTREKEIHEKTH
A0A7C8D3W3      --TELDNSIHSLKTTQKLLKSQIKNREEELKIALIKQQEL--YQKFNEIENA--------
A0A178IFJ2      --ANLRNQREKALENERQLQRQLAD----SEKASLALDRQ--AVEYNVLRREAETNRATY
A0A357FSP9      --DKLSSALVEAKSNFELASQRLAE----KELELIKLSKT--RVAYSSLQREMDVQQGFL
A0A1T4WWY4      --TSFDLEKARLTEKLEELDGKLPE----YHKAIKSYDTK--KLDYDLMEKSQLAWDKAY
A0A3D3LEQ6      --RAFDLEYEKLKEQLVELEAKLPD----YYKAAKSYDEK--KLAYELMEKGQLAWDKAY
A0A3D3NW23      --RAFDLEYEKLKEQLVELEAKLPD----YYKAAKSYDEK--KLAYELMEKGQLAWDKAY
A0A2A2R174      --LRLGLQLQAAIEKEKGLEAAFKE----QEKKLSDLNAR--RSGYEHLQADVTLHRSLH
A0A1H2DTI1      --EEANVRRETLALEIQHLEAMVKE----YEPKAISLGAK--LAEFERLKSKRSMDQSLY
A0A1H1MGC9      --AMFEADFQTAKRNDEEARANLVR----QESESLELDRY--AVEYSNLVRDYDINEHLL
A0A1V5L462      --GQIEEEKSALRNRIDTLLPEINK----WEEEVIQYSLG--VADLETMNSNLSRLLSTR
A0A3D3LGD3      --AGLQNRLESARKRKEALEASNQD----AKSELLGQQSA--FNEYKTAKDDVTDIEAIL
A0A350ARX4      --DSLDDRKDQLRRQIQNLDAVIAQ----WEKQALSISRK--SAEFERLQYRLDRSRNTY
B5JIS2          --KDLEGQYTNVVSLEKRLDDDFRK----KFTESIEVGRL--ADQFLVIGSEVDAKREAL
A0A6N6ZC77      --QQMGDRKQELKAQLENLNIIISE----QEKVALENSRL--SAEFERLQANLERFRNQH
A0A7C5H7K5      --EQLESRKNSLAIQLKNLEKEAAE----ANAKALEVNAK--MVEYQRIKNNLQRVQALY
A0A538NJ59      --EQIAAAQQVLKLKMNGIQTSIKE----SLGKVLAANDR--IADAERMKMNISRIQFHY
A0A2A2R3V9      --EQLNNRREGLRLQIQNLQELIKS----EEVKALDVNRR--MADYQRMKSKRQRLQAFY
A0A3C1VFY9      --EQLEAKKSALALQIKNLENQTKQ----WGRQNIELGHK--SAEYASLKAKSQRLQALY
A0A2V2SMX4      --EQLQTLQKTLELQIANMERDVRE----WDAKCLEISRK--TAEYQRLKNDSQRVQGLY
A0A522AC27      --EYLENLKKSLELQITNVEKDVVE----WDAKNLSISQR--TAEYQKLKAGQSRVQALY
A0A6M1RFD0      --EQIENRKKSLQLQIENLQKEIKQ----WEARALEASSK--MAQYQKIRANINRVQSLY
A0A7C3HXH0      --EQIENRKKSLALQIENLQKEIKQ----WEARALEASSK--MAQYQKIRANITRVQNLY
A0A1H2GQN6      --RALLIDLNVSEEKLKLLEADVASL---RDKLRQEKSDK--MAPFQEAVKERDRQQYIL
A0A512M3Y3      --TSFRLQKEQMAARMQELSKKMPD----YRRVLNDFDHY--KREYSLMSSGKLLWESAY
A0A4P5R5J1      --DAITSRRGAIKTQIESLDDNIKT----WETKALDLAKR--VADFDKIKSKIERTKVHY
A0A4P5YK43      --ERRRAEIEKLRKDEIGLRPRVEE----MRREVFEKSTV--LNEFEKLKKEEDYLEKEL
A0A2A2RPW6      --ERLKLMREGAMAKEKKLEQELRE----QEKKLGQLSLL--RIEYDRLQREAASERKLY
B1ZT68          --ANLETRNRIAAQHEIRLRAELEQ----AERSAHELDKT--SVDYKFLEQDAATKRATY
W0J7C2          --ADLRARYDVSAHYLQRLQAETTG----SEAQARELDKI--SIDYKFLEQDANAKRATY
B4D1I7          --EDLQHRREATRLEIENLEKTIKE----WEAKALDLSQR--LAEYGSLQANVTRARAQL
A0A353F286      --EVLKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--QTSYTQAKEQYEQARGML
A0A354FSA6      --EVLKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--QTSYTQAKEQYEQARGML
A0A3B9GA54      --EVLKTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--QTSYTQAKEQYEQARGML
A0A520LEH8      --EVLRTKLDLVEQQVLKMREMVDA----RQEDAITLSLK--QTSYTQAKEQYEQARGML
A0A6B2M0T8      --SDFVQQHSQLKARVSNLEEALTQ----AEQESLELDQV--AIEYNVLRRKLDTDKRLF
A0A2D7B7R6      --KGLYAQIKYQQEFIEELTQSIEN----QTSKLFEWEQL--YMQQAALEQDLEIGTKLI
A0A2E5K4P7      --NKAEAEHLLATVHYKEAQRDVAI----KEQEYLALEKN--REEYGGLTRKLEQARKSL
A0A2V6F9Q9      --EKLETRRKSIGKQMENLQSNIKE----WETKALDLSQR--LAQFNRIKGKMDRTKQLY
A0A2V6NZZ3      --EKLETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLY
A0A2V6EBU2      --EKLETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLY
A0A2V6EY06      --EKLETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLY
A0A2V6ME53      --EKLETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLY
A0A538NUU0      --EKLETRRKSIGKQMENLRGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLY
A0A2V6NIJ1      --EKLETRRKSIGKQMENLQGNIKE----WEVKALDLSQR--LAQFNRIKGKVDRTKLLY
A0A2V6C292      --EKLETRRKSIGKQMENLQGNVKE----WEVKALDLSHR--LAQFNRIKGKVDRSKLLY
A0A2V6D2X0      --EKLETRRKSIGKQMENLQGNVKE----WEVKALDLSHR--LAQFNRIKGKVDRSKLLY
A0A2V5ZUK1      --ERLKTRRESIGKQMENLQGNIKE----WEAKALDLSQR--LAQFNRIKGKSDRLKQLY
A0A2V5XFN9      --EKLKTRRESIGKQMENLQANVKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLY
A0A2V6EZC8      --EKLKTRRESIGKQMENLQANVKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLY
A0A2V6I7Z5      --EKLKTRRESIGKQMENLQANVKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLY
A0A3B9LCP2      --EKLETRRKSIGKQMENLRANIKE----WEAKALDLSQR--LALFNRVKGKVDRLKTLY
A0A3C0R669      --EKLETRRKSIGKQMENLRANIKE----WEAKALDLSQR--LALFNRVKGKVDRLKTLY
A0A2V6EID2      --EKLETRRKSIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRVKGKVDRLKVLY
A0A2V6MHB0      --EKLETRRKSIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRVKGKVDRLKVLY
A0A2W5YWL9      --EKLETRRKSIGKQMENLLGNIKE----WEAKALDLSQR--LGQFNRIKGKVDRTKQLY
A0A2V5NH62      --EKLDTRRKSIGKQMENLQTNIKE----WETKALDLSQR--LAQFNRIKGKAERLKTLY
A0A2W6A620      --EKLETRRKSIGKQMENLQTNIKE----WEAKALDLSQR--LAQFNRIKGKAERLKTLY
A0A2V5PIJ4      --EKLDTRRKSIGVQMENLEKSIAE----WEKKALDLSQR--LAQFNRIKGKADRLKTLY
A0A2V6K2G8      --EKLKTRRESIGKQMENLQTNVKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLY
A0A2V5W206      --EKLKTRRESIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLY
A0A2V6MW77      --EKLKTRRESIGKQMENLQANIKE----WEAKALDLSQR--LAQFNRIKGKVDRLKTLY
A0A6N4WVA3      --ERIAERQQVVGNQIKNLNAEIEI----WEKTALENGRL--IAEFERLQSRLKRSKEAY
A0A0R2XPB1      --RRIRERQSVLNNTAANLTLEIAI----WEKSALEHGRL--IAEFERLQSRLERSKAAS
A0A348NQP1      --TRIRERQSVLNNTAANLSLEIAI----WEESALDNGRL--IAEFERLQSRLERSKAAS
A0A357FV58      --TRIRERQSVLNNTAANLSLEIAI----WEESALDNGRL--IAEFERLQSRLERSKAAS
A0A2G4GZN8      --KSRRSSLDNAKARHEAILRNLLA----KEEEISRLQAA--NVDLERVDKEIRASEEFL
A0A348NPT1      --DKLSSALVEAKSNFELASQRLAE----KELELIKLSKT--RVAYSSLQREMDVQQGFL
A0A2E1KV60      --DNLNASFKEAKDNFAQASKRLVE----KERDMIELSKT--RVEFNSLIRDLEVEQMTY
A0A2D7F4D9      --DNISGYFAESRDNFKQASKRLLE----KEREMIELSKT--RVEFNSLIRDLEVEQMTY
A0A3R7RBR8      --DNISGYFAESRDNFKQASKRLLE----KEREMIELSKT--RVEFNSLIRDLEVEQMTY
A0A2E0NH28      --DKIYAAYIEAKRNFEVSSQRLAE----KENELIQLSKT--RVDYNTLYREFEVQQGFL
A0A368BGT4      --DKIYAGYSESKSNFEMASLRLAE----KERELIELGKT--KIEFNSLLRDLEVQQSFF
A0A317ZP96      --DKIYAGYIEAQKNYEIATKRLVE----KEKELIELSRT--RVEYNSLLRDLEVEQNFY
A0A350AS32      --NKLDSSFSESKSNYEVASQRLAE----KEQELIELSKT--RVEYNSLLRDLDVQQSFF
A0A6N6PLV8      --SAIANTYALENKKLADTKASAED----TAKRVIEEKTK--MKDYIEAKNRYIQEKKIL
A0A290QE54      --ADLHASLEKSRANEKSLEQEYAL----NEKEQIRLRDL--SIDFKSLENQAAVAKGNY
A0A1H1SWX2      --SDLRTQYVKLQDTEASYIKEYQA----AEKDNLRLGDL--SVDFKSLENQAQVAKSNY
A0A1D8AZK8      --SDLRTQYTKVKETEASYQKEYKE----AEMGQLRLGEL--SVEFKSLENQATVAKNNY
A0A4Q1C9I5      --AALRAQHETLKQTEASYVREYKE----AEKEQLRLGEL--SVEFKSLENQAAVAKNNY
A0A2E0V4K6      --RSPVDKSYWEGVSDQLGTIKDGG----EAEVAIARRLL--LARTQVLDGETKSRMSVF
A0A1G3ZL71      --ADLSASLEKARDGEQTFEKEYAQ----HEKDQIKLNEL--KPEYGSLENEALAKRTAY
A0A556QP09      --ADLKTSLERAVAREKTLEKEYAA----QEKEQLRLRDL--SIEYRSLENQAQVAKSNY
A0A2T6DX88      --ADLQASLEKARANEKSLEQEYQL----HEKEQMHLRDL--AVDFRSLENQATVAKSNY
A0A2T6CWI7      --DDLRARQAEARQAYESFSAEFAQ----REKDAMRLGEL--RVEFNSLVQQSQVARENY
A0A3E1E5C8      --ADLATQLSEARQSEANLQTEYDR----AEKESLHLGDL--SVEYNSLENQANVAKSNY
B1ZZ74          --ADLGTRLNEARENERTLQEQFAK----AEKESLDLGAL--APEFNSLQNQAQVSKANY
A0A2E6NAH3      --DKIYAGYSESKSNYEVASLRLAE----KEKELIELGKT--KIEFNSLLRDLEVQQSFF
A0A2A5VZA5      --DKLYASYIEAKSNFELSSKRLAE----KESELIALSKT--RVEYNTLLRDLDVQQSFF
A0A424R295      --DKLYASYIEAKSNFELSSKRLAE----KESELIALSKT--RVEYNTLLRDLDVQQSFF
B4CZV9          --NRFNLEYQELLNKKHDLEAKLPE----YQELSRKHAKL--LSQLSIFDASRVPYDTYL
A0A0E3YV65      --SNLRNQRAKALNEETQLQSQLAQ----AEKESFRLDEM--AVQFNVLRREAETNRATY
W0J900          --STLRNQREKAVENERQLQEKLAD----AEKASLGLDRL--AVEYNVLRREAETNRATY
A0A3B9FM17      --EDLRDKHIQLSAQEKEFADEMEK----VQKQSEQLSEI--EETLKNFERELAVVQRST
A0A2D7WMI4      --FDMDNRKLQLQALANDFTVAMTT----VQDEANFLSKI--DDNISSMERELEIVQTSS
A0A2D6VHX5      --EDLRDRHIQLDAQEREFMGAMDK----VQTESRRLGHI--EEAISKAERTLAVVRSST
A0A2D8I214      --EDLKDKRVQLTAQEKEFQQAMEK----VQQDSMKLSEI--EEWLINKERELTVVRTST
A0A1Z8VL41      --DDSRDKLLELQHQEGEFTMAMQE----VQSQSNELSEI--EERLEDYKRELSVVRAST
A0A2E6TNA4      --DDSRDKLLELEHQEGEFTKAMQK----VQLQSNELSEI--EERLEDYKRELSVVRAST
A0A1Z8RG47      --EDLRDKYIHLVAQENEFAKAMQK----VQEDSRKLSEI--EEKLINFERQLAVVRKST
A0A1Z8RJJ5      --EDLRDKYIHLVAQENEFAKAMQK----VQEDSRKLSEI--EEKLINFERQLAVVRKST
A0A2D7V631      --EDLRDKHIQLNAQEKEFATAMQK----VQEDSRKLSEI--EETLTNFDRQLAVVRKST
A0A354RA24      --EDLRDKHIQLNAQEKEFATAMQK----VQEDSRKLSEI--EETLTNFDRQLAVVRKST
A0A2E9RV62      --EDLKNSYHQLEAQEQEYANEMDK----VQVEAVELSEM--EKDLEVLDRKLQIQRGST
A0A2E4AY96      --SDLYERENQLLALEDKFSIAMND----VQIEAKDVSLI--DDTLRNFERELQIVQTSS
A0A3B9B9P4      --SDLYERENQLLALEDKFSIAMND----VQIEAKDVSLI--DDTLRNFERELQIVQTSS
A0A2D5Y6N6      --EDLRDKHIQLTAQEKEFASAMAK----VQEESRTLSEI--EEKLKNLDRQLAVVTRTT
A0A2E7HSS8      --EDLRDKHIQLSAQEKEFGDEMAK----VQLESEKLSEI--EDRLKNFTRELAVVQRST
A0A2D8VCK3      --EDLRDKHIQLSAQEKEFADEMEK----VQKQSEQLSEI--EETLKNFERELAVVQRST
A0A350QVY4      --EDLRDKHIQLSAQEKEFADEMAK----VQKQSEKLSEI--EETLKNFERELAVVQRST
A0A2E4ZYR7      --EDLTNRVSELASQEREFTKAMLA----VQKESQKLDDI--EVQILGMTREGLVHRTTY
A0A2E6TCV1      --EDLTNQKNELNVQKAKFVYLREK----IKKQAQQLGQK--EQQIARLEQDLTLERQTF
R7E4L8          --NALEVRMGELEKERNELNRLLSD-----------MASK--DEGLVPLLREQKVMEELY
A0A4Q3BVY2      --QKFDLNFAGLTEKEKQLEARVPE----YHAITEQVGKS--SHVYSTIAAKQQMWDKAR
A0A4P6PCA7      --KAIQNELTLLKTKISQMQSRMENIETELRDLDKQIADG--KRRLLKLERKRDAAETSY
A0A2T6DSN5      --AELRSRYEVAGQHEKRLRQDFAD----AEKRLQELDRA--TDRYKFLEDDYNRKNQAL
A0A317ZIW7      --ERIGERKLVIERRIDNLNDEIAI----WEQSALENGRL--IAEFERLQSRLERSKAAY
A0A7C4PPT4      --QTYNLEYVSLKQKKAELQQRLPE----YEQALLEQKMF--MQELERKGAGNLGFAAMY
A0A7C4QZX4      --KQYALEQASLREKKAELMAKLPE----FEKVLRDSERL--RHDVQYQEVGKGVFSRAY
A0A3D4HHL8      --HELKDEKEVLQSKISHLKDVIDE----QEVKALDYSRR--LAEFERINSRLDRQKSLL
A0A366HV03      --KRFEVERLRLGDQLKELEAKLPE----YSEMTEKLNKL--RQDYKLGHEGDLAWTKAY
A0A6G6K911      --KRFEVERLRLGDQLKELESKLPE----YSEMTEKLNKL--RQDYKLGYEGDLAWTKAY
A0A5R8KAF2      --RRFELDFQQQTQKIATLEKRLPE----YYQTNEEAGLA--GEQYMSASQGRAMWGRAR
A0A7C4LRZ6      --EKRKAKVESLRRDEESYKPLIEN----LRKQVFESRGV--QNAFERLKNEEADVKADL
A0A351MR11      --NRLAGLRSSSQQRLIAAERSLSG----KEAEIARLQGA--NIELERIEKEIRLGEDFL
A0A388PR45      --DSLAAAQVDLRAKLDNAVEILRQ----KDEAINRLQAA--AVELEKIDKDIRANEEFL
A0A388QR61      --DSMQTTWLDLQAKLANSVEILRQ----KDEAINKLQAA--AVELEKIDKDIRANEEFL
A0A4P5YHI0      --ESMQTTWLDLQAKLANSVEILRQ----KDEAINKLQAA--AVELEKIDKDIRANEEFL
A0A2A2RS01      --NRIQASVQNARSSYDAIVANLER----KDDEIYRLQAA--NNELERVDKEIRGQEEFL
A0A2A2Y1A7      --NRIQASVQNARSSYDAIVANLER----KDDEIYRLQAA--NNELERVDKEIRGQEEFL
A0A388PDH9      --NRIQASVQNARSSYDAIVANLER----KDDEIYRLQAA--NNELERVDKEIRGQEEFL
A0A2G4H1E7      --KSRRASLENAKARHEAILRNLVA----KEEEISKLQAA--NVELERVDKDIRASEEFL
A0A2G4GZA6      --KSRRSSLENAKARHEAILRNLVA----KEEEISKLQAA--NVELERVDKDTKASEEFL
A0A388P514      --KSRRSSLENAKARLEAILRNLLA----KEEEFSKLQAA--NVELERVDKDIKASEEFL
A0A2A2YG59      --KSRRSSLENAKARLEAILRNLLA----KEEEFTKLQAA--NVELERVDKDIKASEEFL
A0A2G4F7D5      --KSRRSSLENAKARLEAILRNLLA----KEEEFSKLQAA--NVELERVDKDIKASEEFL
A0A2V2SDN0      --KQLVNRRDGLQLEVKNLEKVFRE----WEGKALEASRK--MVDYDRLRQDVQRTQAAY
A0A1V6GL40      --EQLKNRKELLAVEIEILEKDLKA----WDARNQEFQHK--NAEYQALKANVQRIRALY
A0A2V5X6Z6      --KQLAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--MADYEQIRQNLQRLQTAY
A0A2V5VGZ7      --KQLAHRRRAIELQVQNLEVAFKE----WDAKAIESSRK--MADYEQIRQNLQRLQTAY
A0A2V5U130      --KQLAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--MADYEQIRQNLQRLQTAY
A0A2V6C237      --KQLAHRRQAIELQVQNLEAAFKE----WDAKAIESSRK--MADYEQIRQNLQRLQTAY
A0A3R8L982      --ADLQATLEKARAREASLAIEYTA----NEKEHLRLRDL--SVEYKSLENTAAVAKSNY
A0A6N6QBS9      --EGRRATIRRLRMREDAYPKLILE----LEEEVFEKNSL--ENDYERLLKKEARVKEQL
A0A2E7HPU9      --KAAADKSYWDKNKSEWDKQDLDQ----LSRLQVARRLL--TARATVLTSGIASQREVY
D5EML0          --QQSTIEYQTVQKEVSDLTARIQE----TEGRVLVAERS--LLEYKRMERDVDQKREMF
A0A7C4PPJ4      --DKRLARIESLKRDEESYKPLIED----LRRQVFESRNI--QNQFDRLKSDETDIKNEL
A0A3C1C1M3      --NTAAANLALYQEQAGSLQKKNEELLETASKLDRDILEG--EMRITALNRTRSAADASY
A0A2S7U4L6      --DLLKVLLEQAGAKIARLQISKDA----SQSDAKNTAED--YTRFQSYQDEYKDSVNNL
A0A2E9EYJ1      --KALTTQLAMAEQQYENSKESKER----TEKMSLQERKQ--NVRYIEAKKEYELSKEML
A0A258AXR6      --AGLQNRLDASRKKRESLKIYNDD----AKQELQNMSSL--YTEYKTAKDEVTYLEDLL
A0A3D3NZQ6      --AGLQNRLESARKRKEALEASNQD----AKSELLGQQSA--FNEYKTAKDDVTDIEAIL
A0A1T4WVZ9      --AALQTRLDFSIQRRETLRSSNEE----AKSEMLDQQSA--QNDYKTAADDVAYIENLL
A0A4R7SSI6      --AALQTRLEFAIKRHTALQSSNED----AEKEMFDQQSA--QTDYKTAVDDVAYIENLL
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ---------------------------DLATAQMAPIKPK---KMLTLFLGIVGGLGAGF
A0A660Q3A0      DLVFNRLKEVDVSIGI---EPERIRIVERAEVPTSPVTPR---KLQSIFIAALIGLGLGI
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      DRVVNLLQNVDISRNI-DQGTLAILD--PASE-AVRSYKQ---DVSLLAMTLVAGLLAGF
A0A258AXL1      VGMKGRLAAMDYTGPE-VQVEFQFKGFTDVRD-DIPVSPN---KQKLLTYALALSIGLGL
A0A2E6T1E0      NLALQRLKETELQEKD-IVQNMHVIDLATAQM-S-PIKPK---KLLTLFLGIVGGLGAGF
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      -------------------------------------------------------MGXXL
A0A7C5CZ90      --------------------------------------------------GIIFGLLIGV
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ------------------------------------------------------------
A0A2V5U7A0      ESVLKRLSETNVSNDIAVSN-MQIMQSAERP--RSPDAPN---IPINLTMYAALGLFLGV
A0A3D4CZT6      -----------------------------------------------LSLGAAVGLIFGI
A0A4V1S9Q4      -----------------------------------------------------------V
A0A355VK99      LMLLSKEQENALAMAVTESN-ARVLEAAHGP--NLPISPK---TIKYVAGGTAGGALLSI
A0A2V6N5E0      DRLTTNLKDIDVSQVTGSEDQVSIMEMATPP--ISV-RPG---LIKSLLIGFGIGALAGL
A0A2V6NH44      DRLTNDLKSVDVSQVIDTGDQISIMEPATPP--VSV-RPG---LLKSLLLGFGGGALVGI
A0A432FDF6      DTILFRIMQEEVDLALPKESTVEITDDADLP--IKAVRPN---IPLNIALGVVVGLVLGV
A0A522ACN3      TILNMRIAQERTDINLPHTTMVEIIDRATPG--ARPVRPN---KPLNIALGVIIGLVVGV
A0A353DCA1      REMSVKQQQQRVLLKMPRTP-ITLHERAKKA--KAPAYPN---VTLNLLLGAGVGLIFGI
A0A3C1AXQ2      LQLKSTYFQTKAELELVKSP-ATIYAIATPE--GKPAKPN---VALNLALGGVLGLMLGV
A0A3D0IZR7      EVLMSRYRQQSVESRIETRP-VQVVNRAEPA--VRPVKPS---LKLNLALSMVVGLILGL
A0A520LRZ3      NGMQSKLAKEKIDAAGQRTP-MVIHEIAEAA--DPG-NPARPNIKLHLVLGAAVGLVFGI
A0A356FSV4      TAIVSRMTMQKAQINLKNPN-ARIVDEALPP--LRHSSPN---LFLNIALGAFGGVVVGL
A0A3D3DET9      DQLLATMQTLDVNKEISPES-VETIEAASPA------YAARLDLWKGAVNGALLGLALGL
A0A355SVK9      QALVSRLTEEKAQVTLKNPN-SRVIDEALPP--MRHSSPN---IPMNLAAGFLGGLAAGA
A0A2E5D7I3      NSILVALEESKVNSIDEEVI-AELHSRAAPS--DSAVFPNRLRVQ---AVGGIGGVASGL
A0A2V5NYE2      DSLQATMDKLDVGKEAAPES-VTIHQKASPA------VPNRPQLSRKLATGALVGLALSV
A0A2V6FIP7      NIVLQRMKETDLTS---KDKAQNMRVVDKAVVPMNPIKPR---VVLTLFLGVIGGLGVAM
A0A353DI77      NTLLSRVGVLKTDA---EGVEAEVIKHEDAPRAWAPFSPN---RKKIMVKTTMLGLCGGL
A0A1V6GCZ3      QVLDAKIAFEKIDVELPKTLMVEVVDRAMPG--LRPVRPN---KPLNIALGIIIGLVVGV
A0A3C1UJT2      DNIKDQIQSIEFTAES-EGTTIELAEKATE---PSTIEPN---KTQRIILGVLLGLGLAY
A0A2S7U0Z3      QSISQRMTEIDVADNQ-SMNNLKVVEPAFI---GLAKESV---RLIYLAAGSIFGIFTGF
A0A5E6MKA7      SSVMRRMRETDITSAL---NASNVEVVESAEVPNMPSRPK---KARNLLLGFLGGGMGGI
A0A6B3L936      ETFTRRLAEIDVADDEGVNSKVRVNEAATI---PPPSKYK---HLITLAAGSVLGGGVGV
A0A2N8IR72      LMLLSKEQENALAMAV-TESNARVLETAHGS--NLPISPK---TIKYVAGGTAGGALLSI
A0A2N8IV96      KELDSRYKDEIARLRV---PREAIEMYQLPTYPAAPYKPN---VTINLAVGAGAGLLLGI
R7E1V8          KDLDSRYKDEIARLRV---PREAIEMYQLPTYPAAPYKPN---VTINLAVGAGAGLLLGI
A0A2E0R252      DNLITKLKEGNVSKGFDSKQFDVVQPPSLP---ANPTGPN---KKKITMKYLFGGAALGV
A0A3E1EF48      ENLNTKLKEADVTRGIATRQFEIIQPPTLP---GGPIAPS---MNDIVGRFSGGGFLLGI
A0A2A2PVG8      DNLILQLKEGNVTRGFASRQFEVVQPPTMP---AAPVAPI---KTRMLVQFAGGGAALGI
A0A2E0R421      NNLIAKLKEGNVTKNFAGKQFDIVQPASLP---GGPIGPN---KKSIMSKYTMGGVAVGV
A0A2E5EJ69      QRVLGAKQESSVTEGI---QNRTVEVYNPASLPGAPVSPR---KSVIMMVAMIVGCGLSF
A0A2G4I5Z5      DTVIQRLKELDIVSGNKNKNEVRIIEPASLP--LTPIRPN---KKMLLIYALALGTALSV
A0A4P5QQV6      ENLSRSKGSVEITRNV-DQEIISVRQKATP---AQTARFG---VARTLTTGFVLGLLGGI
A0A2E7ALI1      NSILVALEETKVNS---IDDEVIAELHSRSAVPSSPVFPN---RLRVKAVGGLGGIAGGL
A0A178IDB9      NSILSRLNETTIVSQL---ENVNIKVLDKALVPGAPSNSP---SSQILLQAGAFGFILFL
A0A290QD69      QDILSRLSEISIISQL---DNVNITIHDKALVPGFPDTGT---PKEVIKQAAALAFVLFF
A0A2E7VDS1      DIMLNRLNEVKVTRAL-PQEDDPLKRDSPAVTPTSPFEPD---KSSIHRTGALIFLACFI
A0A7C8D3W3      ---KNRLEEYTQLLAFFQEEPESEFYEILASGVVEKIDPQ---RVKKILQGLMFGLALGL
A0A178IFJ2      TQVLSRLNEASLTAQL-GNSNIKIAERARPP--TVPLEPN---PKKILLSIGFLGVLIVI
A0A357FSP9      QALVQRMTQERAAVNL-KNPNSRVIDEALPP--LRHSSPN---IVMNLAAGFFGGLAVGA
A0A1T4WWY4      EKLSQRIESLEFDGDK-APLSLEFRGFTNLRS-EMPVSPN---KSKLFMMGCLLGLGLAG
A0A3D3LEQ6      EQLSRQIEGLEFGSDE-SAVSLEFRGFTDIRS-EAPVSPN---KSKLLMLGCLLGLGMAG
A0A3D3NW23      EQLSRQIEGLEFGSDE-SAVSLEFRGFTDIRS-EAPVSPN---KSKLLMLGCLLGLGMAG
A0A2A2R174      DAVIKRLRELDIVSGDKSKSEVRVIEPANLP--LTPIRPN---KKMLLLYALAAGTALSV
A0A1H2DTI1      ESLLQSVQKIDLNRRL-DEQRFTLMEPPSD---ATSIKDQ---YQVRLLSAGLGGLIVGM
A0A1H1MGC9      NSILGRMRETSMSSTI-ETQSARVVDRAAPA--LKPFSPN---IPLNLALGFLGGLALGT
A0A1V5L462      ESLIRRKERLDIGRNV----DTELISVLVPATSAVLRQVD---KRREIAKGGALGLGMGA
A0A3D3LGD3      RTLKTRYFETKAGLEI-FKSPATIYAKAEPE--GRPAKPN---VALNLALGGILGLMFGF
A0A350ARX4      QRLLDSIQAIQSNQNI-EQDTIGILAHASR---AGVQPPQ---VGKKVAEGAAFGLAVGI
B5JIS2          TSLLRRVSNANVVSNL----PVDVMRVVDPAFIAKPKLAK---RKLVAAFTVLLAGGAFF
A0A6N6ZC77      ETLLRSLQTIETGQDI-STEIVSVLERPQY---FGETRMS---LQRSLVEGGILGLGFGL
A0A7C5H7K5      DRLLGTIQNLDVNLKI-TPESVTILEDASE---AKPARFG---IGYHAGFGAAAGLLLGI
A0A538NJ59      DRVVNLLQNVDISRNI-DQGTLAILDPASE---AVRSYKQ---DVSLLAMTLAAGLLAGF
A0A2A2R3V9      ERLVSSVQSVDLSQNI-DQEMISIMEHPGL---AQPVHVG---MSGMLLNGFLLGLLAGV
A0A3C1VFY9      DQLLATFQTLNVNKDA-SPETVTIYQPASD---AFPDTTL---LKKGLMFAGLLGLGLGL
A0A2V2SMX4      DRLLATMQTLDVNKQI-NPESVTIYEKATQ---AYPDRVN---LPMKLALGAVAGLGLSL
A0A522AC27      DRLLATMQTLDVNKEI-SPESVTIMEPAFD---AVPERPP---IIQSLFKAGLIGLGASL
A0A6M1RFD0      DRLLQTMQAVGVDKDI-IPESVTILERASV---AEPDRLS---LSVSLALAGLVGLMLGM
A0A7C3HXH0      DRLLQTMQAVGVDKDI-TPESVAILERASE---AEPDRLS---LSISLTLAGMVGLMLGV
A0A1H2GQN6      DQYEIRYKQENLDQQSPSQPATVISPANTN---PNPVRPI---LWLNITLSGVAGLLLGL
A0A512M3Y3      ADLSKRLTAMDYTGID-VRVEFEWQGFTYLRN-DVPISPN---KQKLLLYGVMLGVGCAA
A0A4P5R5J1      DRLNGQLRSMDVYKNL-AQDTVLILEHATK---PEQIQME---LNKLLLIGGFGGLALGL
A0A4P5YK43      DRQKRSLLALEST----PTNEETISTVEEGVGLEKPVGPN---RPKIILLGLLLGLFSGI
A0A2A2RPW6      DTVINRLREIDLTGNIEKKSEFRIIEPASLP--SIPIRPN---KKMILLYALMVGMAASV
B1ZT68          SRIVDRLNEASVASQM---ENTNIKIFDPAYVPGGPIGDA---LAILIAKASFIGVGLFV
W0J7C2          ARIMDRLTEAGITSRM---ANTNIAIFDPAWVPDAPSDTG---ALEIAVKAGAAGLGLLF
B4D1I7          ESLSRSKGNVEINRNV-DQDIISIRQRASA---ATPQKPG---AVKTVGTGIGLGLFVGL
A0A353F286      REMKFKHSEAKILLKM---PRDPITLHEKPKKASKPVFPN---FTMNLLLGAGVGLIFGI
A0A354FSA6      REMKFKHSEAKILLKM---PRDPITLHEKPKKASKPVFPN---FTMNLLLGAGVGLIFGI
A0A3B9GA54      REMKFKHSEAKILLKM---PRDPITLHEKPKKASKPVFPN---FTMNLLLGAGVGLIFGI
A0A520LEH8      REMKFKHSEAKILLKM---PRDPITLHEKPKKASKPVFPN---FTMNLLLGAGVGLIFGI
A0A6B2M0T8      TQVHQRLNEAILASQL---SDVNLRVVDQAWPAGAPFTPD---VKKIYSVTVFLFLFAFS
A0A2D7B7R6      DNIKDQIQSIEFTAES-EGTTIELAEKATE---PSTIEPN---KTQRIILGVLLGLGLAY
A0A2E5K4P7      EHLRMLKFKEDVRTDT-KNSSVNIYVDGVAP--TKHFTPS---LTLNLAFGTIGGAGFGL
A0A2V6F9Q9      DRLTNDLKAVDVSQVVDAGDQISIMEPATP---PVSVRPG---LIKSLLLGFGGGAVAGI
A0A2V6NZZ3      ERLTNDLKSVDVSQVIETGDQISIMEPATT---PVSVRPG---LLKSLLLGFGGGALVGI
A0A2V6EBU2      ERLTNDLKSVDVSQVIETGDQISIMEPATT---PVSVRPG---LLKSLLLGFGGGALVGI
A0A2V6EY06      ERLTNDLKSVDVSQVIETGDQISIMEPATT---PVSVRPG---LLKSLLLGFGGGALVGI
A0A2V6ME53      ERLTNDLKSVDVSQVVDTGDQISIMEPATS---PVSVRPG---LLKSLFLGFGGGALVGI
A0A538NUU0      ERLTNDLKSVDVSQVVDTGDQISIMEPATS---PVSVRPG---LLKSLFLGFGGGALVGI
A0A2V6NIJ1      DRLTNDLKSVDVSQVVDSGDQISIMEPATP---PVSVRPG---LLKSLLVGFGGGALVGI
A0A2V6C292      DRLTNDLKSVDVSQVVDSGDQISIMEPATS---PVSVRPG---LLKSLLLGFGGGALVGI
A0A2V6D2X0      DRLTNDLKSVDVSQVVDSGDQISIMEPATS---PVSVRPG---LLKSLLLGFGGGALVGI
A0A2V5ZUK1      DRLTNNLKEIDVSQVVGGEDQVSIMEMATT---PVSVRPG---LIKSLLIGFGAGALLGL
A0A2V5XFN9      DRLTNNLKEIDVSQVVGGEDQVSIMEMATA---PISVRPG---LIKSLLIGFGIGALAGL
A0A2V6EZC8      DRLTNNLKEIDVSQVVGGEDQVSIMEMATA---PISVRPG---LIKSLLIGFGIGALAGL
A0A2V6I7Z5      DRLTNNLKEIDVSQVVGGEDQVSIMEMATA---PISVRPG---LIKSLLIGFGIGALAGL
A0A3B9LCP2      DRLTNNLKEVDVSQVVDSGDQVGIMDMATP---PISVRPG---LIKSLLIGLGCGLLAGI
A0A3C0R669      DRLTNNLKEVDVSQVVDSGDQVGIMDMATP---PISVRPG---LIKSLLIGLGCGLLAGI
A0A2V6EID2      DRLTNNLKEVDVSQVVDSADQVSVMEMATP---PISVRPG---LIKSLLIGLGCGLLAGI
A0A2V6MHB0      DRLTNNLKEVDVSQVVDSADQVSVMEMATP---PISVRPG---LIKSLLIGLGCGLLAGI
A0A2W5YWL9      DKMTNDLKSVDVSQVVDTGDQISIMEAATA---PISVRPG---LLKSLLIGLGCGALAGF
A0A2V5NH62      DRLTNSLKDVNVSQSVDSGDQVSIMEMASG---PVSVRPG---LIKSLLIGLGIGALAGI
A0A2W6A620      DRLTNNLKDINVSQSVDSGDQISIMEMAGA---PISVRPG---LLKSLLIGLGCGALAGI
A0A2V5PIJ4      DRLTNNLKEVNVSQVVDTGDQIAIMENATA---PVSVRPG---LIKSLLMGLGAGILGGL
A0A2V6K2G8      DRLTNNLKDIDVSQVTGSEDQVSIMEMATA---PISVRPG---LIKSLLIGFGIGALAGL
A0A2V5W206      DRLTTNLKDIDVSQVTGSEDQVSIMEMATP---PISVRPG---LIKSLLIGFGIGALAGL
A0A2V6MW77      DRLTNNLKEIDVSQVVGGEDQVSIMEMATS---PVSVRPG---LIKSLLIGFGIGALAGL
A0A6N4WVA3      ASSQDSLRAIDTNQNL-QQDTVSILVNARK---PVPAGVG---LVRQFAMGGLFGFVLAG
A0A0R2XPB1      VNSQDSLQAIDTNQNL-QQETVSILVNARK---PIPAGVG---LVQQFAMGALFGVVLAA
A0A348NQP1      VNSQDSLQAIDTNQNL-QQESVSILVNARK---PIPAGVG---LVRRFAMGGLFGLILAA
A0A357FV58      VNSQDSLQAIDTNQNL-QQESVSILVNARK---PIPAGVG---LVRRFAMGGLFGLILAA
A0A2G4GZN8      GRMKLSYEDAKLRSST-SGTSTSISILDAPSVSDKPINKN---YYFSALVGIGSGLLFGV
A0A348NPT1      QALVQRMTQERAAVNL-KNPNSRVIDEALPPLRH--SSPN---IVMNLAAGFFGGLAVGA
A0A2E1KV60      QKLISLMAEEKIQVNI-KNANARIIDKAFPPPEDQPSSPN---VFLNLAGGFFGGIFFGL
A0A2D7F4D9      QKLTALMAEEKIQVNI-KNANARIIDKAFPPREDRPSSPN---VFLNLAGGFFGGMIFGL
A0A3R7RBR8      QKLTALMAEEKIQVNI-KNANARIIDKAFPPREDRPSSPN---VFLNLAGGFFGGMIFGL
A0A2E0NH28      TAIVSRMTMQKAQINL-KNPNARIVDEALPPLRH--SSPN---LFLNIALGAFGGVVXGL
A0A368BGT4      QALNLRMTTEKAQVNL-KNPNARIVDEAFPPPEDQPSSPN---IVLNLFAGFFGGIAFGV
A0A317ZP96      QALNSRMTTEKAQVNL-KNPNARIVDEAYPPADDNPSSPN---VVMNLAAGFFGGLAVGT
A0A350AS32      IALTSRMTQEKAQVNL-KNPNARIVDEAFPPMKH--SSPN---VVMNLAAGLFGGVAVGM
A0A6N6PLV8      ESSEINLKAERMKRGI---EMDPARVWEKAEPSLAPDKPN---VPVYMVAAAALGLVLGI
A0A290QE54      TQILDRLSQATTSSNL---ERISVRPLDPATPAGAPYTPD---IRSIAKTSIGLFVLVFV
A0A1H1SWX2      LEILNRLNQVTTSKNL---ENIPVKPLDRALPKGSPDTPN---IRNIVKTSIGLGLVVFA
A0A1D8AZK8      IEILNRLNQVTTSKNL---ENIPVKPLDRALPAGAPFTPN---IRSIIKTSIGLGLLVFA
A0A4Q1C9I5      LQILDRLAQATTSKNL---ENIPVKPLDQALPAGAPYTPN---LRNIIKTSLGLGLLVFV
A0A2E0V4K6      NSILVAMEESKVNQ---IDDEVIADLHSRASTPETAVYPN---RIRSYFAGGAGGAACGV
A0A1G3ZL71      LQVLDRLNQTTTSKNL--DSRVPLRVIDRATPSHAPYTPN---LARVVRTSTIVGLLIFF
A0A556QP09      SQILDRLSQATTSKYL--E-KIPVRPLDPALPAGKPYTPD---LGRIARTAVGVGVLVFF
A0A2T6DX88      SQILDRLSQTTTSSKL--E-KIPVRPLDRATPTPAPYTPN---MTRVIRLSVIVGLLVFV
A0A2T6CWI7      QNIFKRLTDTTTVKNL--D-KIPLHPLDHAVANRWPVSPN---RQKITRTAIGLGLMVFL
A0A3E1E5C8      VQILNRLNETTTTRNL--E-KIPLHPLDAAVVPGGPYEPD---LARIIRTCLGVGLLVFF
B1ZZ74          LSILDRLNQTTTTKNL--E-KIPLHPLDHAVVPGAPFTPN---LNAIIRLCVGVGVMVFF
A0A2E6NAH3      QALNQRMTTEKAQVNL-KNPNARIVDEAFPPREDQPSSPN---VVLNLAAGFFGGIATGV
A0A2A5VZA5      QALNSRMTQEKAQVSL-KEANARVVDDAFPPL--RHSSPN---ITVNLLVGVFGGLAVGG
A0A424R295      QALNSRMTQEKAQVSL-KEANARVVDDAFPPL--RHSSPN---ITVNLLVGVFGGLAVGG
B4CZV9          ANMQREINEVEFAG---EKERINLKYSGLLEVRDDPVSPN---RLRIMLLSFVGGLVLAL
A0A0E3YV65      AQLLNRLNETSITAQL---ANSNVRVADGGTPAGLPLEPD---PRKIAITLLVLGLGVFV
W0J900          TQVLGRLNETSLTAQL---GNSNIKISERAQIPTFPIEPD---PKKIFRALGFLGLLIII
A0A3B9FM17      DSIHSRLNDVNIEQALPSEQDEPLRVDSVAYEPGGPYAPD---KNRIREEGMMIFAVLFI
A0A2D7WMI4      GQMQKRLNDVTIEQAFPQDQDDPLQKEQFAFVPGGPYSPD---KNGIYKKSFGIFVGIFF
A0A2D6VHX5      DIIRKRLDDVRIEAALPSEQDDPLQKDQLAFTPXSPYSPD---YNKIKQQGVLIFVGIFL
A0A2D8I214      DQIQKRLNEVRIEQALPSEQEEPLHKEQYAFLPGGPYTPD---KAKIKRTGIYIFLGLFI
A0A1Z8VL41      DQIHKRLNDVKIEQSLPSEQDDPLHKENFASLPGGPFSPD---KNAIKQKGLXIFFAVFI
A0A2E6TNA4      DQIHKRLNDVKIEQSLPSEQDDPLHKEQFASLPGGPFSPD---KNAIKQKGLIIFFVVFI
A0A1Z8RG47      DQIHDRLNDVRIEQALPSEQEEPLHKEQFATQPSAPYTPD---KNQIRQSGFMIFFSVFF
A0A1Z8RJJ5      DQIHDRLNDVRIEQALPSEQEEPLHKEQFATQPSAPYTPD---KNQIRQSGFMIFFSVFF
A0A2D7V631      DQIQSRLNDVRIEQALPSEQEEPLHKEQFAYQPFAPYTPD---KNKIRKSGFIIFFAVFF
A0A354RA24      DQIQSRLNDVRIEQALPSEQEEPLHKEQFAYQPFAPYTPD---KNKIRKSGFIIFFAVFF
A0A2E9RV62      DTIQRRLQDVVIQIELPQEQDDPLHKGNIAY-PGIQISPN---LPEIHKTGFMIFAALFV
A0A2E4AY96      AQMQKRLNDVTIEQAFPQEQDNPLQKEQFASLPASAYSPD---KAAIQKKAATVFLAIFI
A0A3B9B9P4      AQMQKRLNDVTIEQAFPQEQDNPLQKEQFASLPASAYSPD---KAAIQKKAATVFLAIFI
A0A2D5Y6N6      DQIHNRLNDVRIEQALPSEQEEPLNKEQFAYLPGAPFTPD---KNKIKRDGTMLGLAIFV
A0A2E7HSS8      DGIQSRLNEVKIEQALPSEQDEPLRMESFANEPGGPYSPD---KQKIKEQGIMIFSVLFI
A0A2D8VCK3      DSIHSRLNDVNIEQALPSEQDEPLRVDSVAYEPGGPYAPD---KNRIREEGMMIFAVLFI
A0A350QVY4      DSIHARLNDVKIEQALPSEQDEPLRVDSVAYEPGGPYAPD---KNRIREEGMMIFAVLFI
A0A2E4ZYR7      DQMLKRLNEVKVTRELPQDEDDPLRRGDVAMTPATPISPD---KAAIRRTGILIFVACFI
A0A2E6TCV1      SSLHKRKKEVEVTGALPEAQTDPLQISDVATVPYLPVSPD---KAAIKTKGILIFFACFV
R7E4L8          LMLLKKREENALALAT-TEPSARILEPAFGS--NAPVAPR---LSLMTMGGMAGGAFASL
A0A4Q3BVY2      ERLAQKLATVTFAEDF-DWVELRFKGLVSLRD-EVPISPS---KFKVAIIALTLGVAGAF
A0A4P6PCA7      RSILQRTENTRLAAEQ-DTAFVKVLREATVP--RIPVAPD---KKKIVIVTVFLFGIIGA
A0A2T6DSN5      NSIEGRLQEATIVSRL-ENVNIRILDRANVP--SVPANGT---PKDTALQASALGLFLLF
A0A317ZIW7      ERNQEALRAIDTGQSL-SQETVSVLEDASP---AYPAGQG---TVIRLAEGAAYGIVLAI
A0A7C4PPT4      KEMATRLSMIDFGADK-ERSQLQFMGHLELRD-EIPVSPN---RLKLVVYSLGLGIFLAI
A0A7C4QZX4      GELARRLSMVDYGAER-ERIHLQFLGHLELRD-QVPVSPN---RMKLLVYSLGLGLLLAF
A0A3D4HHL8      ENLTASIQSIDINLNL-DQEFLTILENASP---AYAVRIS---IVKNLVMGVVAGVFMGV
A0A366HV03      TDLSKMIATINFGGDK-DRVDLQFREFALLRD-VDPVSPT---KSKLAILAAVLGLGLAI
A0A6G6K911      ADLSKMVATINFGGDK-DRVDLQFREFALLRD-VDPISPT---KSKLLILAVVLGLGLAI
A0A5R8KAF2      DKLSDKLSMISFTQDL-DWVEMHFKEFVNLRD-VEPTSPN---KMKLLMISLMLAIGGAI
A0A7C4LRZ6      ENLRRQARALEASNTR-ENL---LAILEEGLGSPSPIGPN---RQKIILTGLLAGLGLGL
A0A351MR11      NRLKLSYEDAKLRTST-TGTSTSVRILDTPVVSERPINKN---YYLNVFVGIGLGLASGV
A0A388PR45      GRMKLNYEEAKLRTAT-SGISTSIRVMDKPSVSDKPVNKN---FSVNALAGLALGFFAGV
A0A388QR61      GRMKLNYEEAKLRTAT-SGISTSIRVMDKPSVSDKPVNKN---FTFNALAGLLLGLFSGV
A0A4P5YHI0      GRMKLNYEEAKLRTAT-SGISTSIRVMDKPSVSDKPVNKN---FTFNALAGLLLGLFSGV
A0A2A2RS01      ARQKQNYEEQKLRSST-SGTSTSIKIQEMPSVADRPVNKN---YYMNALTGMGLGLLVGF
A0A2A2Y1A7      ARQKQNYEEQKLRSST-SGTSTSIKIQEMPSVADRPVNKN---YYMNALTGMGLGLLVGF
A0A388PDH9      ARQKQNYEEQKLRSST-SGTSTSIKIQEMPSVADRPVNKN---YYMNALTGMGLGLLVGF
A0A2G4H1E7      GRMKLSYEDAKLRSST-SGTSTSISILDAPSVSDRPINKN---YYYAALIGFGSGLLFGI
A0A2G4GZA6      SRMKLSYEEAKLRSSN-SGTSTSINILDAPSVSDKPINKN---YYLNALVGMGSGLLFGV
A0A388P514      GRMKLSYEEAKLRSST-SGTSTSISILDQPSVSDKPINKN---YYFNALVGVGSGLLFGV
A0A2A2YG59      GRMKLSYEEAKLRSST-SGTSTSISILDAPSVSDKPINKN---YYFNALVGVGSGLLFGV
A0A2G4F7D5      GRMKLSYEEAKLRSST-SGTSTSISILDQPSVSDKPINKN---YYFNALVGVGSGLLFGV
A0A2V2SDN0      DKLLSVISTVDVGKSV-DQENVSVLEPAS----PAGRASK---LVRNLALAFAMALVLGA
A0A1V6GL40      DQLLATMQTLDVNKEI-SPESVETIEAASP---AYAARLD---LWKGAVNGALLGLALGL
A0A2V5X6Z6      DKTLTLIQTVDVSKKV-EQENVGILEPASV---AAPTH-R---LFRNMAIALVGSLLLGF
A0A2V5VGZ7      DKTLTLIQTVDVSKKV-EQENVGILEPASV---AAPTH-R---LFRNMAIALVGSLLLGF
A0A2V5U130      DKTLTLIQTVDVSKKV-EQENVGILEPASV---ATPTH-R---VLRNMAIALIGSLLLGF
A0A2V6C237      DKTLTLIQTVDVSKKV-EQENVGILEPASV---ATPTH-R---RLRNMAIALVGSLLLGF
A0A3R8L982      AQILDRLSQVNTSRNL-EKLPVRRLDRALPA--GAPYSPN---PRSITQTSVALGLLVFF
A0A6N6QBS9      ES-QNRNLAATTRLAV-EDEQFNVAESGGGD--PIPVAPA---RPQIVLSGVGVGFILGV
A0A2E7HPU9      NSLNTQLAELNAKKGE-TAVEVELDSFSELP--RKPSSPK---QLTTLGAGTILGSVLGF
D5EML0          NKLMNRYRETRIAQQM-NLNNMLVLDRANLP--MQPLTMS---RTQMVAAAIVLGAVFLV
A0A7C4PPJ4      ESLRRKARALEASNTR-GDKELAILEEGIGS--PLPISPN---RQKIILVGLFLGLAAGC
A0A3C1C1M3      LGLLTRIQEARLSADE-NTATVKLASEVAP---ARQIFPR---PARVLLMALLLGLAVGF
A0A2S7U4L6      NTLRTSNVIEELQENM-SIEPIEFYSYPQEPEVADYVSPN---WILNMALGSVAGMIFGI
A0A2E9EYJ1      NGMQSQLAKETIDSAG-QRTPLVIHELAEPQDVDKPARPN---XKLHLVLGAAVGLIFGI
A0A258AXR6      VKMRSRYFEEKAGIEL-VKSPATIYSDAEPE--GKPAKPN---VPLHLALGGVLGLMFGL
A0A3D3NZQ6      RTLKTRYFETKAGLEI-FKSPATIYAKAEPE--GRPAKPN---VALNLALGGILGLMFGF
A0A1T4WVZ9      LQLKSSYFETKAGLEL-VKSPATLYAKAEPE--GKPAKPN---VALNLALGGVLGLMLGV
A0A4R7SSI6      LQLKSSYFETKAGLEL-VKSPATIYAIATPE--GKPAKPN---VALNLVLGGVLGLMLGI
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      GLAFFVNFLDDSIKSQDDVESYLKLPFLGYIP----------------------------
A0A660Q3A0      GLVFGLEYLDDTIRYPEEVTEGLGLPFFGVIP----------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      GCVFLVAVRDDRFITLTDVIEKLGDAVLGQVP-------------------EVRKR----
A0A258AXL1      GGPVLTERLRFTSSFVGEAEKYCQYPACGIVP-------------------LMEID----
A0A2E6T1E0      GLAFFVNFLDDSIKSQDDVETYLNLPFLGYIP----------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      VIPIALEVIDNRIKSPWDIETFVGEDLLTGIQ-------------------KIS-E-ID-
A0A7C5CZ90      GLAFFIEYLDTSVKTIEDVERSLQAPVLGVIP-------------------QNV-K-L--
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      ----------------DDVEHYLGVPVLAVIP-------------------KDV-G-V--
A0A2V5U7A0      GMAFALEYIDSHLNTPEHVWRAVDLNTLGVVPDLDSLGHRPLISYAPASRAKLLPTRMGQ
A0A3D4CZT6      AIAFSLEYLDTSVKTLEDVERYLQVPVLAVIP-----------------------TDVG-
A0A4V1S9Q4      GIAFFLEYLDTSVKSLEDVERYLQVPVLAVIP-----------------------KDVG-
A0A355VK99      LAFMGVAMLNNKVNNKHDLPSVNRQPVIAELP-----------------------QMSK-
A0A2V6N5E0      AILILLDRIDDRMASFSEFQHHFSENILGQIP------------------------KEK-
A0A2V6NH44      MILLLLDRIDDRMASYGEFQRHFSENVVGQIP------------------------KEK-
A0A432FDF6      GLAFFIEYLDTSVKTIDDVERALNAAVLGVIP-----------------------QNVG-
A0A522ACN3      GLAFFIEYLDTSVKTIDDVERTLQSPVLGVIP-----------------------QNVG-
A0A353DCA1      GIAFLLEHLDTSVKSLEDVERYLQVPVLAVIP-----------------------KDVG-
A0A3C1AXQ2      GLAFFLEYMDTSVKSLDDVERFLGVPVLAVIP-----------------------KDVA-
A0A3D0IZR7      SLAFFIEYLDTSIKTMDDVERFLGISVLAVIP----------------------------
A0A520LRZ3      GMAFFLEYLDTSVKSLDEVEHFLELPVLAVIP-----------------------QAVG-
A0A356FSV4      GLVFGIAFLDDRVKSAFDIEGTIGLPLIGIIP---------------------QIKKLD-
A0A3D3DET9      GLLLVLDRLDDRVGSFTELQDLFDENVLGQVP---------------------REKLVA-
A0A355SVK9      GFVLLIAFLDDRVKSAFDIEGAIGLPLLGVVP---------------------QIKKLD-
A0A2E5D7I3      GLVLLLLXLDNRFXTVSQVEXETGMPVLAAVPVLEAKKLEAAEXSESXSXAKTXEGEGA-
A0A2V5NYE2      VLLLILDRLDDRVNSVTELQDLFDEPILGQVP---------------------QERAPA-
A0A2V6FIP7      GLAFFVNYLDDSIKSQDDVETYLRLPFLGYVP-------------------NIKTNSVL-
A0A353DI77      ALAFMFQFVDNKIHGVADIEQTFGISILSAIQ-------------------KLP------
A0A1V6GCZ3      GLAFFIEYLDTSVKTIDDVERALQCPVLGVIP-------------------QNV-G-LL-
A0A3C1UJT2      GYLYLMNMMDQSIKSVEQAEKILQLPVLAAVP-------------------VSEINGKP-
A0A2S7U0Z3      AAAFGLSILDYKIYDVRSAEEATGLTCMAAIP-------------------ASS-KFGR-
A0A5E6MKA7      GLAIGLAKFDTRLRGKEEVERALGLPVLGMVP-------------------DTE-K-LR-
A0A6B3L936      GLVFLLSLMDYKIYDVRSAEEATGLPCLAAIP-------------------LSS-AVDS-
A0A2N8IR72      LAFMGAAMLNNKVNNKHDLPAANRQPVIAELP-------------------QMS---KK-
A0A2N8IV96      GLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------------------KNV-P-IL-
R7E1V8          GLALLLEFMDTSVKTMEDVERALQVPVLGIIP-------------------KNV-P-IL-
A0A2E0R252      GIILLLGFLDPTVRTVADLEVLTGTPVIGAMP-------------------ASK---NT-
A0A3E1EF48      ACIFLIGFLDPSIRTVGELERDARLPVIGAVP-------------------SSSSKGDG-
A0A2A2PVG8      AIIMLLGFLDPTLRTVAEVEQFCGIPVVAGLP-------------------AFK---KR-
A0A2E0R421      ALILLMGFLDLTIRTVSELEGMTGKPVLGAIP---------------------D---EK-
A0A2E5EJ69      MLVFIVQQLDKTVKSIDEAERLFGVPVVGAVP-------------------KNP-E-IK-
A0A2G4I5Z5      GLIWLLVQLDTTIKSVDHAERLLGIPVLGAVP-------------------KNK---LI-
A0A4P5QQV6      VCLLGISMFDDRIDSVVDFQATFPDRLLATIP-------------------HVSCA-VG-
A0A2E7ALI1      GLVFLLLRLDNRFRTVSQVEEETGMPVLSAVP-------------------VLELRKIE-
A0A178IDB9      GLPIGIGLMDTRVKSSHDVETGLDHPLLGGIK-------------------TMK-K-LT-
A0A290QD69      GIPVGLGFLDTRVKSSHDVESGLNQTLLGGIK-------------------AMK-K-LS-
A0A2E7VDS1      LIPMAFEFIDNRVKSPWDIEVFLGRDLIAGIP-------------------KIS-T-IK-
A0A7C8D3W3      GIVYLCQRLDDRMELAEDIETALELPVLGQIP-------------------QMN---LK-
A0A178IFJ2      GYPVGMELLFNRIKTWTDVERYIGLPLLSEFP-------------------VLK-N-LP-
A0A357FSP9      GLIFVVAFLDDRVKSAFDIEGTVGLSMLGVVP-------------------RIK-K-LD-
A0A1T4WWY4      GVPFLLRRFDSSVVELSEFEGTLGINGIGLVP-------------------LSDPKELE-
A0A3D3LEQ6      GVPFLLKQMDSTVTDLNEFEETLGIPGIGLVP-------------------LTDPEVLE-
A0A3D3NW23      GVPFLLKQMDSTVTDLNEFEETLGIPGIGLVP-------------------LTDPEVLE-
A0A2A2R174      GVIWLLVQLDTTIKSVDHAERILGLPVLGAVP-------------------KNK-L-IR-
A0A1H2DTI1      AILFIIDRFDDRINSTTELRDYFSERILGQMP-------------------FEV-S-LG-
A0A1H1MGC9      AFAFFVAYIDDRVKSSFDIESVVGLPLIGIVP-------------------EIK-R-LD-
A0A1V5L462      AIVFLLAALNNRITSADDLRRMFSSKVIGLIP-------------------QTK-A----
A0A3D3LGD3      GLAFALEFMDTSIKSLDDVERFLGVPVLAVVP-------------------KNV-G-IL-
A0A350ARX4      VIIAAISFLDVRIRNSDELAKRFDHPVIGVIP-------------------EEL-Q--N-
B5JIS2          GVPLGMQLFDQRLKCATDIEKEFGKGLLGGIP-------------------KLS-R-VK-
A0A6N6ZC77      VLIAGLGLIDNRVVSGEDLRNRFDAPILGLIP-------------------VED-Q--R-
A0A7C5H7K5      LLIMILERVDDRICSYSDVVNNFSEPLLGQIP-------------------NWK-SFRT-
A0A538NJ59      GCVFLVAVRDDRFITLTDVIEKLGDAVLGQVP-------------------EVR-K-RR-
A0A2A2R3V9      GILFLLDRIDDRINSFTELRDHFEEPVLGQIP-------------------MDP-TLAR-
A0A3C1VFY9      AILILMDRVDDRMSSFTELEELFDEDVLGNVP-------------------REK-S-PD-
A0A2V2SMX4      LVMLFVDRLDDRMASFTELQELFDEEILAQIP-------------------REG-K-AR-
A0A522AC27      AILLLLDRLDDRMNSYTDLQDLFDEEVLGQIP-------------------HEG-L-EK-
A0A6M1RFD0      GLLLIVERFDDRMNTFVELQDHFEEPVLGQIP-------------------RER-S-GR-
A0A7C3HXH0      GLLLLVDRFDDRMNTFVELQDHFEEPVLGQIP-------------------RER-S-SR-
A0A1H2GQN6      SVAFFIEYLDTSVKSLNDVEKTLGVPVLGIIP-------------------RGV-K-PL-
A0A512M3Y3      GGCFGLEKLRSTTSLVTETEKLTGLNAVGVVP-------------------LLA-N-SA-
A0A4P5R5J1      LVLFVLDKMDDRIGSFFEFRERFPEPLLGQVP-----------------------R-EL-
A0A4P5YK43      GIVYVLYRLDDRLDLAEDIEESLQEPVLGQIP-------------------AVD-R-KN-
A0A2A2RPW6      GLIWLLVQVDSSIKSVDHAERVFGLPVLGAIP-------------------KNK-L-IT-
B1ZT68          LIPLGMGLMDTRIKTVSHVEDALGEVLLGAVK-------------------TID-G-LG-
W0J7C2          VLPLGIGLLDSRLRTPAQVEDSLQEPLLGVVK-------------------HMG-K-LG-
B4D1I7          LLLVLIDQLDDRVASYTEFQSYFRERVFAQIP-------------------HSP-S-DG-
A0A353F286      AIALLLEHLDTSVKSLEDVERYLQVPVLAVIP-------------------KDV-G-VL-
A0A354FSA6      AIALLLEHLDTSVKSLEDVERYLQVPVLAVIP-------------------KDV-G-VL-
A0A3B9GA54      AIALLLEHLDTSVKSLEDVERYLQVPVLAVIP-------------------KDV-G-VL-
A0A520LEH8      AIALLLEHLDTSVKSLEDVERYLQVPVLAVIP-------------------KDV-G-VL-
A0A6B2M0T8      CVPFGIHYLNLNLKTATDIEQQLRVPFLGEIR-------------------TFP-R-RL-
A0A2D7B7R6      GYLYLMNMMDQSIKSVEQAEKILQLPVLAAVP-------------------VSE-I-NG-
A0A2E5K4P7      FMVFFTAFIDNRVKSPFDIEQVIKLPLVGVIP-------------------QIR-K-LD-
A0A2V6F9Q9      LILLVLDRIDDRMASYGEFQRHFLENVVGQIP-----------------------K-EK-
A0A2V6NZZ3      MVLLLLDRIDDRMASYGEFQRHFSENVVGQIP-----------------------K-EK-
A0A2V6EBU2      MVLLLLDRIDDRMASYGEFQRHFSENVVGQIP-----------------------K-EK-
A0A2V6EY06      MVLLLLDRIDDRMASYGEFQRHFSENVVGQIP-----------------------K-EK-
A0A2V6ME53      MILLLLDRIDDRMASYGEFQRHFSENVVGQIP-----------------------K-EK-
A0A538NUU0      MILLLLDRIDDRMASYGEFQRHFSENVVGQIP-----------------------K-EK-
A0A2V6NIJ1      VILLLLDRIDDRMASYGEFQRHFSENVVGQIP-----------------------K-EK-
A0A2V6C292      MILLLLDRIDDRMASYGEFQRHFSENVVGQIP-----------------------K-EK-
A0A2V6D2X0      MILLLLDRIDDRMASYGEFQRHFSENVVGQIP-----------------------K-EK-
A0A2V5ZUK1      GILILLDRIDDRMASFSEFQHHFSENVLGQIP-----------------------K-EK-
A0A2V5XFN9      AILILLDRIDDRMASFSEFQHHFSENVLGQIP-----------------------K-EK-
A0A2V6EZC8      AILILLDRIDDRMASFSEFQHHFSENVLGQIP-----------------------K-EK-
A0A2V6I7Z5      AILILLDRIDDRMASFSEFQHHFSENVLGQIP-----------------------K-EK-
A0A3B9LCP2      GILILLDRIDDRMASFGEFQRQFSENVLGQIP-----------------------K-DK-
A0A3C0R669      GILILLDRIDDRMASFGEFQRQFSENVLGQIP-----------------------K-DK-
A0A2V6EID2      GILFLLDRIDDRMASFGEFQHQFSESVLGQIP-----------------------K-EK-
A0A2V6MHB0      GILFLLDRIDDRMASFGEFQHQFSESVLGQIP-----------------------K-EK-
A0A2W5YWL9      GILLLLDRIDDRMASFSEFQHHFTENVLGQIP-----------------------K-EK-
A0A2V5NH62      AILLLLDRIDDRMASFGEFQHHFSENVLGQIP-----------------------K-EK-
A0A2W6A620      GILLLLDRIDDRMASFGEFQHQFSENVLGQIP-----------------------K-EK-
A0A2V5PIJ4      AVLFLLDRIDDRMASFGEFQHQFSENVLGQIP-----------------------R-EK-
A0A2V6K2G8      AILILLDRIDDRMASFSEFQHHFSENVLGQIP-----------------------K-EK-
A0A2V5W206      AILILLDRIDDRMASFSEFQHHFSENILGQIP-----------------------K-EK-
A0A2V6MW77      AILVLLDRIDDRMASFSEFQHHFSENILGQIP-----------------------K-EK-
A0A6N4WVA3      GVLFLLGALDNRILSANELSAQFQHPLIGAIP-------------------YEK-V-NE-
A0A0R2XPB1      GILFVLAAIDNRILTASELSAQFKDPLIGVIP-------------------FEV-N-HD-
A0A348NQP1      GVLFVLAAMDSRILTASELSAQFKDPLIGAIP-------------------FEA-S-ND-
A0A357FV58      GVLFVLAAMDSRILTASELSAQFKDPLIGAIP-------------------FEA-S-ND-
A0A2G4GZN8      VLIIVIGTLDDRIKSAKDVEGSLGLPLIGTIP-------------------RAT-V-TS-
A0A348NPT1      GLIFVVAFLDDRVKSAFDIEGTVGLSMLGVVP-------------------RIK-K-LD-
A0A2E1KV60      GLVFAVALLDDKVKSVFDIEASIGLPMLGIIP-------------------KVK-K-LD-
A0A2D7F4D9      GLVFAVALLDDKVKSVYDIEASLGLPILGIIP-------------------KVK-K-LD-
A0A3R7RBR8      GLVFAVALLDDKVKSVYDIEASLGLPILGIIP-------------------KVK-K-LD-
A0A2E0NH28      GLVFGIAFLDDRVKSAFDIEGTIGLPLIGIIP-------------------QIK-K-LD-
A0A368BGT4      GLIFSVAFLDDRVKSAFDIEGTIGLPMLGVIP-------------------RIK-K-LD-
A0A317ZP96      ALVFAVAFLDDRVKSAFDIEGTIGLPMLGVIP-------------------RIK-K-LD-
A0A350AS32      GLVFIVAFLDDRVKSAFDIEGTIGLPMLGIVP-------------------RIK-K-LD-
A0A6N6PLV8      GLAFFIEYLDTSVKTLDDVERFLQIPVLAVIP-------------------KDI-T-VL-
A0A290QE54      GVAIGLSFIDDRIKSSWDVEHFIGVHLLGIVP-------------------DLS-G-LK-
A0A1H1SWX2      GVAIGLSFLDDRVKSAWDIEGFIGAHLLGIIP-------------------ELG-D-VP-
A0A1D8AZK8      AVAIGLSFIDDRVKSAWDIEGFIGAHLLGIIP-------------------ELG-D-VP-
A0A4Q1C9I5      GVAVGLSFVDDRVKSAWDIEGFIGAHLLGIIP-------------------ELG-D-VP-
A0A2E0V4K6      GLILLLLRIDNRFRTVAQVEEETALPVLAAVP-------------------VLS-A-KR-
A0A1G3ZL71      GVAFGLSVVDDRIKSAWDVESYLGVHLLGIIP-------------------ELA-H-VA-
A0A556QP09      GVAIGLSFIDDRIKSAWDIEHFIGANLLGIIP-------------------DLS-S-LK-
A0A2T6DX88      AVAFGLSIVDDRIKSAWDVESFIGVTLLGIVP-------------------DLS-S-LK-
A0A2T6CWI7      GVALGLSFIDDRIKSAWDVESFVGANLLGIVP-------------------DLG-N-LK-
A0A3E1E5C8      AAGLGLAFLDDRIKSAWDVESYIGANLLGIIP-------------------DLS-A-VT-
B1ZZ74          GVAFGLSFIDDRIKSAWDVESFIGASLLGIIP-------------------DLA-A-LK-
A0A2E6NAH3      GLIFAVAFLDDRVKSAFDIEGTIGLPMLGVIP-------------------RIK-K-LD-
A0A2A5VZA5      GLVFIVAFLDDRVKSAFDIEGTIGLPLLGVIP-------------------RIK-K-LD-
A0A424R295      GLVFIVAFLDDRVKSAFDIEGTIGLPLLGVIP-------------------RIK-K-LD-
B4CZV9          GIPFLIEYLDHTMTNLEEVEHSFRLRGLGVVP-------------------QTE-A-TD-
A0A0E3YV65      AYPVALELIFNRVKGWSDVENYLGLPLLAELP-------------------LLN-K-IK-
W0J900          GYPVGMELIFNRVKTWTDVERYIGLPLLSEFP-------------------VLK-K-LP-
A0A3B9FM17      LIPVCLEFIDNRVKSPWDIEVFVGNDLIGGIP-------------------KIS-E-VE-
A0A2D7WMI4      VVPFLLEFIDNRIKSPWDIEVFLGRELISGIP-------------------KIS-N-II-
A0A2D6VHX5      VIPIALEVIDNRIKSPWDIETFVGEDLLTGIQ-------------------KIS-E-ID-
A0A2D8I214      LIPVSLELVDNRVKSPFDVEVFIGKDLIGGIP-------------------KIS-D-VE-
A0A1Z8VL41      IVPILLEFVDNRVKSPWDVDVFIGKDLIGGIP-------------------QIS-Q-VE-
A0A2E6TNA4      IVPILLEIVDNRVKSPWDVDVFIGKDLIGGIP-------------------QIS-Q-VE-
A0A1Z8RG47      ALPILLEFVDNRVKSPWDVEVFVGHDLIGGIP-------------------KIS-E-VD-
A0A1Z8RJJ5      ALPILLEFVDNRVKSPWDVEVFVGHDLIGGIP-------------------KIS-E-VD-
A0A2D7V631      ALPILLEFVDNRVKSPWDVEVFVGHDLIGGIP-------------------KIS-E-VE-
A0A354RA24      ALPILLEFVDNRVKSPWDVEVFVGHDLIGGIP-------------------KIS-E-VE-
A0A2E9RV62      LIPFGFEFIDNRIKSPWDIEVFLGQDLIAGIP-------------------KIS-E-VK-
A0A2E4AY96      LFPFLLEFIDNRIKSPWDIQVFLGRDLISGIP-------------------KIS-N-ID-
A0A3B9B9P4      LFPFLLEFIDNRIKSPWDIQVFLGRDLISGIP-------------------KIS-N-ID-
A0A2D5Y6N6      IIPFLLEFIDNRVKSPWDVEVFIGRDLIAGIP-------------------KIS-E-VE-
A0A2E7HSS8      LIPICLEFIDNRVKSPWDVEVFIGNDLIGGIP-------------------KIS-E-IE-
A0A2D8VCK3      LIPVCLEFIDNRVKSPWDIEVFVGNDLIGGIP-------------------KIS-E-VE-
A0A350QVY4      LIPVCLEFIDNRVKSPWDIEVFVGNDLIGGIP-------------------KIS-E-VE-
A0A2E4ZYR7      LIPIGFEFIDNRIKSPWDVEVFIGRDLIAGIP-------------------KIS-T-IK-
A0A2E6TCV1      LIPIAFEFIDNRVKSPWDIEVFIGRDLVAGIP-------------------KIS-T-IK-
R7E4L8          LALLAGNALNTKVRDKKDLAGLTDLPLAGELP-------------------LLS-G-KE-
A0A4Q3BVY2      GVPTALNLLNTSASTVPQLEQLTGLEGIGIVP-------------------MTS-K-EM-
A0A4P6PCA7      GLAILMDFMMNRVGSVTDLKD-LGLHVLGILP-------------------RES-K-YM-
A0A2T6DSN5      GIPLGLGLLDTRVKSPSDVEAGLEQVLLGGIK-------------------TMK-K-LS-
A0A317ZIW7      GVLALISFLDNRIFSAADITNHFDEPLLGAIP-------------------FEK-N-HD-
A0A7C4PPT4      GIPFLIEFLDHTVSNVEEMEQNHRLRGLGIVP-------------------RLE-P-SQ-
A0A7C4QZX4      GAPFLLEFLDHTVTSVEQIEQHHRLRGLGVVP-------------------LVA-Q-SQ-
A0A3D4HHL8      GILFIISILDSRIISVEDVENRFDQPLMGIIP---------------------F-Q-KY-
A0A366HV03      GVPLGLEQLNDKITSLAALEKLTGLKGLGIVP-------------------TSS-S-TF-
A0A6G6K911      GVPLGLEQLNDKITSLAALEKLTGLKGLGIVP-------------------TAN-S-TF-
A0A5R8KAF2      GAPTLVNLMHTGVETLQQLENVTGLTAVGVIP-------------------RTT-K-EV-
A0A7C4LRZ6      MIIYLLDRLDDRLELAEDIEAELDQPVLGQLP-------------------LIG-R-RD-
A0A351MR11      GLVVLLGVFDDRVKSAVDIEGGLGLPLVGTVP-------------------RTT-D-TY-
A0A388PR45      GLVLLLGTLDDRLKSVRDLEGGLGIPVLGTVP-------------------KVS-E-TA-
A0A388QR61      GLVVLMGMLDDRIKSVKDIEAGLGVQVLGTVP-------------------KVA-E-TT-
A0A4P5YHI0      GLVLLMGMLDDRIKSVKDIEAGLGVQVLGTVP-------------------KVA-E-TT-
A0A2A2RS01      GLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVP-------------------KVT-E-AV-
A0A2A2Y1A7      GLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVP-------------------KVT-E-AV-
A0A388PDH9      GLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVP-------------------KVI-E-AV-
A0A2G4H1E7      VLVFVLGALDERIKSAADIEGSLGLPLIGTIP-------------------QVV-R-AS-
A0A2G4GZA6      VLIVVIGTLDSRIKSAKDVEGSLGLPLIGTIP-------------------RVA-N-VS-
A0A388P514      VLIVVIGTLDSRIKSAKDVEDSLGLPLIGTVP-------------------RVA-N-VS-
A0A2A2YG59      VLIVVIGTLDSRIKSAKDVEDSLGLPLIGTVP-------------------RVA-N-VS-
A0A2G4F7D5      VLIVVIGTLDSRIKSAKDVEDSLGLPLIGTVP-------------------RIA-N-VS-
A0A2V2SDN0      GLLWVLSKLDDRFVSSTELAEDLPEKVIGQVM-------------------DIQ-L-VK-
A0A1V6GL40      GLLLVLDRLDDRVGSFTELQDLFDENVLGQVP-------------------REK-L-VA-
A0A2V5X6Z6      GLLYCIGLFRDDFASLAELTHQLSEEVVGQIP-------------------AIS-I-KK-
A0A2V5VGZ7      GLLYCIGLFRDDFASLAELTHQLSEEVVGQIP-------------------AIS-I-KK-
A0A2V5U130      GLLYCIGLFQDDFASLAELTNQLCEEVVGQIP-------------------AIS-I-KK-
A0A2V6C237      GLLYCIGLFQDDFASLAELTNQLCEEVVGQIP-------------------AIS-I-KK-
A0A3R8L982      GVAFGLNLIDDRIKSAWDVEHFIGANLLGIIP-------------------SLG-D-IK-
A0A6N6QBS9      VALLLLHKLDDRLDNPERIEEALGEPILGQLP-------------------EVD-K-KH-
A0A2E7HPU9      ALAFLLANLDNKFHTVSQVELMSGLPILATIQ-------------------HID-L-KV-
D5EML0          GCPLVIELIDGRLTSFQDVEQGSHKALLGDVR-------------------FYG-Q-KK-
A0A7C4PPJ4      GIIYLLDKLDDRLELAEDIEAELELPILGQIP-------------------LLT-G-KQ-
A0A3C1C1M3      GLAILTEILEDRVGGIDDIEIGTGVKILAVLP-------------------HVK-T-RK-
A0A2S7U4L6      GIAFSLELMDTSVKSLEDVERYLQVPVLAVVP----------------------------
A0A2E9EYJ1      GMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIP----------------------------
A0A258AXR6      GLAFFLEYMDTTVKSLDDVEHYLGVPVLAVVP----------------------------
A0A3D3NZQ6      GLAFALEFMDTSIKSLDDVERFLGVPVLAVVP----------------------------
A0A1T4WVZ9      GLAFFLEYMDTSVKSLDDVERFLGVPVLAVVP----------------------------
A0A4R7SSI6      GLAFFLEYMDTSVKSLDDVEKFLGVPVLAVIP----------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      ------NIK-TTSVIE----------------------RDLQSHLHPQSNS---------
A0A660Q3A0      ------TAQWDPDDLA----------------------THLLSNIASNSGV---------
A0A4Q3AQI1      ------ETNL--------------------------------------------------
A0A6N2CMN7      --------HV--------------------------------------------------
A0A2V5UAD5      ------RRKSPLPLLE----------------------IDDDRHVY--------------
A0A258AXL1      ------DRRL-VPQLP----------------------DGKESDAKVTTHA---------
A0A2E6T1E0      ------NIKT-TSIIE----------------------RDLQAHLHPQSNS---------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------ELRR-PKIVG----------------------DDLDDSL---------------
A0A7C5CZ90      -------------LIN----------------------EGADSGY---------------
A0A257LYL4      ------------------------------------------------------------
A0A4Q2XXY1      -------------LHK----------------------QSGMSPD---------------
A0A2V5U7A0      TQLDDISTRG-KDLIV----------------------AHNPLSI-----Y---------
A0A3D4CZT6      ------VLHK-QSGMS----------------------P-----------D---------
A0A4V1S9Q4      ------VLHK-QSGMS----------------------P-----------D---------
A0A355VK99      ------KESR-NTKLF----------------------IQDEHSV-----I---------
A0A2V6N5E0      ------TKGK-VDLLQ----------------------PDDARHV-----F---------
A0A2V6NH44      ------VKGR-MALLQ----------------------PDDPRHI-----F---------
A0A432FDF6      ------SLLD-EGDES----------------------P-----------H---------
A0A522ACN3      ------YLFE-EGSES----------------------P-----------H---------
A0A353DCA1      ------VLHK-QSGMS----------------------P-----------D---------
A0A3C1AXQ2      ------VLHR-ASGFN----------------------P-----------D---------
A0A3D0IZR7      --------KG-AKFLT----------------------SDDPNSR-----F---------
A0A520LRZ3      ------VLHR-QSGLS----------------------P-----------D---------
A0A356FSV4      ------STTK-AQAVA----------------------SNVDRH------V---------
A0A3D3DET9      ------SKRQ-PSLIL----------------------PEDTRHS-----F---------
A0A355SVK9      ------AHSK-AQAVA----------------------SNVDRH------V---------
A0A2E5D7I3      ------PREM-VSLAR----------------------DVVFRDGLHSSLY---------
A0A2V5NYE2      ------RRAE-IKLIE----------------------PEDSRHS-----F---------
A0A2V6FIP7      ------ERDL-QAHLH----------------------PQSNA-----------------
A0A353DI77      -------PEE-ELLKE----------------------MESIRDLPVSMKHICPTLAVPG
A0A1V6GCZ3      ------VDEG-TESPH--------------------------------------------
A0A3C1UJT2      ------TDSR-LVMIE----------------------SPNSTC----------------
A0A2S7U0Z3      ------QDKW-QSILS----------------------HDPHSAN---------------
A0A5E6MKA7      ------AKGI-DEIPA-------------DLPMALATHVSPDSAI---------------
A0A6B3L936      ------EDGE-WRSIS----------------------SSDPNTVH--------------
A0A2N8IR72      ------ESKN-TKLFI----------------------QDEHSVI---------------
A0A2N8IV96      ------HSSD-VMGPD--------------------------------------------
R7E1V8          ------HSSD-VMGPD--------------------------------------------
A0A2E0R252      ------ERKG-SLALD----------------------AEDEQSQS--------------
A0A3E1EF48      ------TKRE-LVLLS----------------------RKD--PHA--------------
A0A2A2PVG8      ------ESRA-ESLEL----------------------ARDAQSKP--------------
A0A2E0R421      ------NPGE-GVLVL----------------------NCKDTPLQ--------------
A0A2E5EJ69      ------DDQG-RLFVT----------------------KAPNSSC---------------
A0A2G4I5Z5      ------KNGK-GRLFI----------------------SDDPQSLC--------------
A0A4P5QQV6      ------AVDV-APLL-----------------------PDDERHTF--------------
A0A2E7ALI1      ------AAEK-SHKKK-------------------EKEDSGAEASSEKALNFSQDVVFRD
A0A178IDB9      ------EAER-PNVFR----------------------LHKDDAL---------------
A0A290QD69      ------ETER-PNVFR----------------------LGKDEAL---------------
A0A2E7VDS1      ------EAER-PLIVG----------------------NELDDGL---------------
A0A7C8D3W3      ------DMNQ-DRILI----------------------SNLEKHNVF-------------
A0A178IFJ2      ------GDTL-NHLVL----------------------QDRDPDA---------------
A0A357FSP9      ------SNSK-AQAVA----------------------SNIDRHV---------------
A0A1T4WWY4      ------SLNR-APTVG----------------------ANVPNAL---------------
A0A3D3LEQ6      ------EVNR-SQTVG----------------------SKVPNAL---------------
A0A3D3NW23      ------EVNR-SQTVG----------------------SKVPNAL---------------
A0A2A2R174      ------DGKG-RLFIS----------------------DDPQSLC---------------
A0A1H2DTI1      ------DRSN-RRLIQ----------------------PGDDRHTY--------------
A0A1H1MGC9      ------QPEK-AQIVA----------------------NNQDKQV---------------
A0A1V5L462      ---------K-ITVLR----------------------KEADDVF---------------
A0A3D3LGD3      ------HRAT-GFNPD--------------------------------------------
A0A350ARX4      ------ANGQ-IDLLQ----------------------VNDSRHRF--------------
B5JIS2          ------VADR-PHVVR----------------------DNLDLAK---------------
A0A6N6ZC77      ------QDGR-VELLQ----------------------PADDRHMF--------------
A0A7C5H7K5      ------KQDA-GEIIT----------------------LNDDRQAF--------------
A0A538NJ59      ------RKSP-LPLLE----------------------IDDDRHVY--------------
A0A2A2R3V9      ------KKGG-PSLLV----------------------QDDRRHVY--------------
A0A3C1VFY9      ------KNTV-LPLLQ----------------------PDDLRHPF--------------
A0A2V2SMX4      ------EVSG-LPLIT----------------------QNGSPHSF--------------
A0A522AC27      ------GQKH-LGLIH----------------------AEDPRHQF--------------
A0A6M1RFD0      ------NGD--LPLLR----------------------PDDDRHAF--------------
A0A7C3HXH0      ------NHD--LPLLR----------------------PDDDRHAF--------------
A0A1H2GQN6      ------NKEP-KDTPH--------------------------------------------
A0A512M3Y3      ------QVET-LAINE-------------------HGLANADVNI---------------
A0A4P5R5J1      ------TKAG-LDLLA----------------------SNDPRHAL--------------
A0A4P5YK43      ------HADG-PLLAN----------------------RLEPNSLF--------------
A0A2A2RPW6      ------DGKG-RLFIT----------------------DDPQSLC---------------
B1ZT68          ------EIER-AHVYR----------------------LHKDDGL---------------
W0J7C2          ------ETER-ARIFL----------------------SHASHDL---------------
B4D1I7          ------RSES-PAILM----------------------PEDERHAF--------------
A0A353F286      ------HKQS-GMSPD--------------------------------------------
A0A354FSA6      ------HKQS-GMSPD--------------------------------------------
A0A3B9GA54      ------HKQS-GMSPD--------------------------------------------
A0A520LEH8      ------HKQS-GMSPD--------------------------------------------
A0A6B2M0T8      ------KKLH-RLVLD----------------------QMDPQA----------------
A0A2D7B7R6      ------KPTD-SRLVM----------------------IESPNSTC--------------
A0A2E5K4P7      ------SFKK-ARIIE----------------------SAKDNHV---------------
A0A2V6F9Q9      ------AKGK-MPLLQ----------------------AEDPRHIF--------------
A0A2V6NZZ3      ------VKGT-MALLQ----------------------PDDPRHIF--------------
A0A2V6EBU2      ------VKGT-MALLQ----------------------PDDPRHIF--------------
A0A2V6EY06      ------VKGT-MALLQ----------------------PDDPRHIF--------------
A0A2V6ME53      ------VKGT-MALLQ----------------------PDDPRHIF--------------
A0A538NUU0      ------VKGT-MALLQ----------------------PDDPRHIF--------------
A0A2V6NIJ1      ------VKGT-MALLQ----------------------PDDPRHIF--------------
A0A2V6C292      ------VKGT-MALLQ----------------------PDDPRHIF--------------
A0A2V6D2X0      ------VKGT-MALLQ----------------------PDDPRHIF--------------
A0A2V5ZUK1      ------AKGR-VELLQ----------------------PDDQRHVF--------------
A0A2V5XFN9      ------TKGK-VDLLQ----------------------PDDARHVF--------------
A0A2V6EZC8      ------TKGK-VDLLQ----------------------PDDARHVF--------------
A0A2V6I7Z5      ------TKGK-VDLLQ----------------------PDDARHVF--------------
A0A3B9LCP2      ------TKGE-VTLLQ----------------------PDDARHVF--------------
A0A3C0R669      ------TKGE-VTLLQ----------------------PDDARHVF--------------
A0A2V6EID2      ------TKGK-LTLLQ----------------------PDDARHIF--------------
A0A2V6MHB0      ------TKGK-LILLQ----------------------PDDARHIF--------------
A0A2W5YWL9      ------SKGK-VQLLQ----------------------ADDPRHTF--------------
A0A2V5NH62      ------TKGR-VSLLQ----------------------PDDARHVF--------------
A0A2W6A620      ------TKGR-VTLLQ----------------------PDDARHVF--------------
A0A2V5PIJ4      ------VKGD-VMLLQ----------------------QDDARHVL--------------
A0A2V6K2G8      ------TKGR-VDLLQ----------------------PDDMRHVF--------------
A0A2V5W206      ------TKGK-VDLLQ----------------------PDDARHVF--------------
A0A2V6MW77      ------TKDK-VDLLQ----------------------PDDARHVF--------------
A0A6N4WVA3      ------GDVH-SVLLR----------------------KNDDRYVF--------------
A0A0R2XPB1      ------GDVN-SVLLR----------------------KNDDRYVF--------------
A0A348NQP1      ------GDEN-SVLLR----------------------KNDDRYVF--------------
A0A357FV58      ------GDEN-SVLLR----------------------KNDDRYVF--------------
A0A2G4GZN8      ------GPDR-ALLAR----------------------QDKDRIA---------------
A0A348NPT1      ------SNSK-AQAVA----------------------SNIDRHV---------------
A0A2E1KV60      ------SVSK-SHIVA----------------------SSSDRHV---------------
A0A2D7F4D9      ------SVSK-SHIVT----------------------STTNRHV---------------
A0A3R7RBR8      ------SVSK-SHIVT----------------------STTNRHV---------------
A0A2E0NH28      ------STTK-AQAVA----------------------SNVDRHV---------------
A0A368BGT4      ------SNAK-AQAVA----------------------SNVDSHV---------------
A0A317ZP96      ------TNTK-AQAVA----------------------SNVDRHV---------------
A0A350AS32      ------TNSK-AQAVA----------------------SNVDRHV---------------
A0A6N6PLV8      ------MKTT-GDSPD--------------------------------------------
A0A290QE54      ------DDDK-YSLVL----------------------KNREAPG---------------
A0A1H1SWX2      ------DTEK-HSLVN----------------------SNRTSPG---------------
A0A1D8AZK8      ------DTEK-HSLVN----------------------SNKTSPG---------------
A0A4Q1C9I5      ------DTEK-HSLVN----------------------SNKASPG---------------
A0A2E0V4K6      ------LSAA-EKSNKERQGEGASRDEEHLWDSGIVFRPGLQSSLY--------------
A0A1G3ZL71      ------TDSL-HTLAI----------------------LSKATPG---------------
A0A556QP09      ------DSEK-YKLVL----------------------DNKNTSG---------------
A0A2T6DX88      ------DDEK-YSLVR----------------------RSEEAPG---------------
A0A2T6CWI7      ------DEEK-YTLML----------------------TEKQVQG---------------
A0A3E1E5C8      ------DDDK-YSLLL----------------------KGPQTPG---------------
B1ZZ74          ------DDEK-YSLLL----------------------SGKQAPG---------------
A0A2E6NAH3      ------TSTK-AQAVA----------------------SNVDRHV---------------
A0A2A5VZA5      ------SSTK-AQAVA----------------------ANVDRHV---------------
A0A424R295      ------SSTK-AQAVA----------------------ANVDRHV---------------
B4CZV9          ------MFLP-ATAVA----------------------SDDTTKHGL-------------
A0A0E3YV65      ------TEFL-PHLLT----------------------RAADQDA---------------
W0J900          ------DDKL-NHLVL----------------------QDTDPDA---------------
A0A3B9FM17      ------ERER-PLIVG----------------------NDLDDGL---------------
A0A2D7WMI4      ------ENER-PLIVG----------------------NDLDDGL---------------
A0A2D6VHX5      ------ELRR-PKIVG----------------------DDLDDSL---------------
A0A2D8I214      ------EAHR-PLIVG----------------------NDLDDGL---------------
A0A1Z8VL41      ------ETKR-PLIVG----------------------NDLDDGL---------------
A0A2E6TNA4      ------ETKR-PLIVG----------------------NDLDDGL---------------
A0A1Z8RG47      ------ERER-PLIVG----------------------NDLDDGL---------------
A0A1Z8RJJ5      ------ERER-PLIVG----------------------NDLDDGL---------------
A0A2D7V631      ------ERQR-PLIVG----------------------NDLDDGL---------------
A0A354RA24      ------ERQR-PLIVG----------------------NDLDDGL---------------
A0A2E9RV62      ------EVDR-PLIVG----------------------NELDDGL---------------
A0A2E4AY96      ------EQER-PLIVG----------------------NDLDDGL---------------
A0A3B9B9P4      ------EQER-PLIVG----------------------NDLDDGL---------------
A0A2D5Y6N6      ------ENQR-PLIVG----------------------NDLDDGL---------------
A0A2E7HSS8      ------ERER-PLIVG----------------------NDLDDGL---------------
A0A2D8VCK3      ------ERER-PLIVG----------------------NDLDDGL---------------
A0A350QVY4      ------ERER-PLIVG----------------------NDLDDGL---------------
A0A2E4ZYR7      ------EADR-PLIVG----------------------NELDDSL---------------
A0A2E6TCV1      ------EADR-PLIVG----------------------NELDDSL---------------
R7E4L8          ------RKKL-PLVVT----------------------NGRSFM----------------
A0A4Q3BVY2      ------LEDV-ARSPA----------------------QGASVPNYL-------------
A0A4P6PCA7      ------TRAD-IAKSG-----------------------IVDSFGPM-------------
A0A2T6DSN5      ------ETER-PNVFR----------------------LGKDDSL---------------
A0A317ZIW7      ------GDHT-MVLLR----------------------KSDERYIF--------------
A0A7C4PPT4      ------LPGS-PVAG------------------------GHLDRQI--------------
A0A7C4QZX4      ------GARS-PSIDL----------------------KGNPDRQL--------------
A0A3D4HHL8      ------DGDI-LNPIK----------------------ADDDRIIF--------------
A0A366HV03      ------LESV-TRGIE----------------------SDPRKPNHV-------------
A0A6G6K911      ------LEGV-TRGIE----------------------TDPRKPNHV-------------
A0A5R8KAF2      ------LEDI-ARSPS----------------------IGAKSPNHL-------------
A0A7C4LRZ6      ------FRKS-NLIIT----------------------QMDEHSMF--------------
A0A351MR11      ------GPDR-ALLAR----------------------QTKDKMA---------------
A0A388PR45      ------GPDR-ALLAR----------------------QDKDRQA---------------
A0A388QR61      ------GPDR-ALLAR----------------------QDKDRLA---------------
A0A4P5YHI0      ------GPDR-ALLAR----------------------QDKDRLA---------------
A0A2A2RS01      ------GPDR-ALLAR----------------------QDKDKVA---------------
A0A2A2Y1A7      ------GPDR-ALLAR----------------------QDKDKVA---------------
A0A388PDH9      ------GPDR-ALLAR----------------------QDKDKVA---------------
A0A2G4H1E7      ------GPDR-ALLAR----------------------QESDRIA---------------
A0A2G4GZA6      ------GPDR-ALLAR----------------------QDKDRIA---------------
A0A388P514      ------GPDR-ALLAR----------------------QDKDRIA---------------
A0A2A2YG59      ------GPDR-ALLAR----------------------QDKDRIA---------------
A0A2G4F7D5      ------GPDR-ALLAR----------------------QDKDRIA---------------
A0A2V2SDN0      ------PEGE-LRREA----------------------LAAQRFEF--------------
A0A1V6GL40      ------SKRQ-PSLIL----------------------PEDTRHSF--------------
A0A2V5X6Z6      ------PKRR-LGVEA----------------------LEKQRFEF--------------
A0A2V5VGZ7      ------PKRR-LGVEA----------------------LEKQRFEF--------------
A0A2V5U130      ------PRRQ-LGVEA----------------------LEKQRFEF--------------
A0A2V6C237      ------SKGR-LCVEG----------------------LEKQRFEF--------------
A0A3R8L982      ------DHDR-YKLFAVGPNAADESGGGNNNSEGAPDRRRDPERDPHTNDGQGEHA----
A0A6N6QBS9      ------YKEG-Y-LLL----------------------HRMKSHTMF-------------
A0A2E7HPU9      ------LAQL-KDEKE----------------------KQLKVSDPPGIELWDSRLIFRP
D5EML0          ------GDAV-YQAVL----------------------QKDADL----------------
A0A7C4PPJ4      ------AKQR---ILI----------------------TQMEEHSMF-------------
A0A3C1C1M3      ------RKEI---ATT----------------------SLTHQFGEL-------------
A0A2S7U4L6      -------RDV---GVL----------------------YKMSTASPD-------------
A0A2E9EYJ1      -------KDI---NVL----------------------XXEXGLSPD-------------
A0A258AXR6      -------KEV---GVL----------------------HRSSGFNPD-------------
A0A3D3NZQ6      -------KNV---GIL----------------------HRATGFNPD-------------
A0A1T4WVZ9      -------KDV---AVL----------------------HRTSGFNPD-------------
A0A4R7SSI6      -------KDV---AVL----------------------HRASGFNPD-------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------MYGK--------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      -------AESFRTIRAAI-SL--SQRAGD-LQVMAVTSTIPAEGKSLVASNHAIVMAQTG
A0A660Q3A0      -------AEAYRNVRSAL-IF--SGAEEY-TKALVVTSAVPLEGKTTTCLNVGISLGQAG
A0A4Q3AQI1      -------IENFRVIRTNL-LS--MGALTKAPHVIMVTSALPREGKTVVSSNLSISFAQTG
A0A6N2CMN7      -------TETFRSIHSA--LR--LNDESKNARIILTTSTVPSEGKSFISSNLSLTFANHG
A0A2V5UAD5      -------AESYRNLRSAL-LY--QGTDGQRPRVLLVTSAVPNEGKSTVAANLARILALGG
A0A258AXL1      -------NESFRIIRSSL-PF--YALPDNPKQVIMVTSARPNDGKTTVAAHLAKSFSDSG
A0A2E6T1E0      -------AESFRTVRAAI-AL--SQRAGD-LHLMAVTSTVPSEGKSLVASNHAIVMAQTG
A0A2D5W0Q9      -------AEGFRTVRAAV-SL--VHKSDK-FKVLSMTSTIPSEGKSLVASNLAIVTAQTG
A0A1Z9KB52      -------TESFRSMYGKI-QM--NSHATG-SKSILVTSAIPSEGKSLISANFAHTCANHG
A0A7C5CZ90      -------AEAYRIVRTNL-LF--SRKDER-FNTICVVSAGAGEGKSTTVINLAVTFALAG
A0A257LYL4      --------------RTNI-EF--NRKNPE-DNAITVVSGGAGEGKSTTLVNLAYICAQGG
A0A4Q2XXY1      -------AEAYRILRTNI-EF--NRKSAD-ANAITVVSGGAGEGKSTTLVNLAYICAQGG
A0A2V5U7A0      -------SEAYRTIRTAL--L--LSQPGGNRKVILLTSPSPGEGKTATTLNLGIALAQDG
A0A3D4CZT6      -------AEAYRILRTNI--E--FNRNNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGG
A0A4V1S9Q4      -------AEAYRILRTNI--E--FNRKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGG
A0A355VK99      -------AECFHILRNNVDSM--LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAG
A0A2V6N5E0      -------AESYRNIRSSI-FF--MPYDGPRPKSFLVTSAVPSEGKSTLSANLAITMALSG
A0A2V6NH44      -------AESYRNIRSSL-LF--MPYQGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A432FDF6      -------AEAYRVLRTNI-LF--AGRQSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQG
A0A522ACN3      -------AEAYRVLRTNL-LF---SRKDDKLNSIAIVSAGAGEGKSTTVMNLATVFAQAD
A0A353DCA1      -------AEAYRILRTNI-EF---NRKNPEDNSITVVSGGAGEGKSTTLVNLAYVCSQGG
A0A3C1AXQ2      -------AEAYRILRTNI-EF---NRRNPDANCITVTSGGAGEGKSTTLCNLAFVCAQGG
A0A3D0IZR7      -------AEGYRILCAKL-N---LTGARASARTITVLSGGPGEGKSTTTFNLGWVCAQSG
A0A520LRZ3      -------AEAYRILRTNI-E---FNRKTADANSMTIVSGGAGEGKSTTLVNLAYVCAQGG
A0A356FSV4      -------TETFRSIHSAI-R---LNEESKNAKVFLTTSTVPSEGKSFVSSNLALTFANNG
A0A3D3DET9      -------VEAYRNLRSSL-LY--MTEAGNRPKTILVTSSVPNDGKSITAANLAITMANAG
A0A355SVK9      -------TETFRTIHSSL-R---LNEESKNAKILVTTSTVPGEGKSFVSSNLALTFANHG
A0A2E5D7I3      -------AESYRILRAAV-M---LLGDEKKRKISAFSXALPGEGKTTTSVNYALALASQG
A0A2V5NYE2      -------LEAYRNLRSSL-LY--MVKASERPRTLLVTSSEPNEGKSLTSANLAITMANSG
A0A2V6FIP7      -------AEGFRTIRAAI-AL--APKSDQ-YHLLAITSTIPAEGKSLVASNLAIVTAQTG
A0A353DI77      WKTDFVHSEMFRVLRASI-SL--LGDTNQ-RKITMITSSVPGEGKTFCAANLALAYAKQG
A0A1V6GCZ3      -------AEAYRVLRTNL-LF--SRKDDK-LNTIAIVSAGAGEGKSTTVFNLAAVFAQSG
A0A3C1UJT2      -------SEAFRSLRVNI-ES--MTRKKS-HKVVLFTSSIPSEGKTFTSINYASSLAQQG
A0A2S7U0Z3      -------AESIRNLRASV-IL--LGKHDN-NKVLLVTSAIPGEGKTTVAAELAAAFAMNK
A0A5E6MKA7      -------SNSFRQIRTLL-HY---SIPDGRPQVMMFTSSQMGEGKSSTCVNTATVLGQQG
A0A6B3L936      -------AESIRNLRASI-TL--LGRKEN-NKVLVVTSAMPGEGKTTTAAELAELFALEG
A0A2N8IR72      -------AECFHILRNNV-DS-MLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAG
A0A2N8IV96      -------AEAYRILRTNI-EF--NKKGLE-EISLTFVSGSAGEGKTTTLCNLAYICAQGG
R7E1V8          -------AEAYRILRTNI-EF--NKKGLE-EISLTFVSGSAGEGKTTTLCNLAYICAQGG
A0A2E0R252      -------AEAIRTLRAGL-TF--LGTSEE-RRTFLITSAVPGEGKSWVASNLALSFASQG
A0A3E1EF48      -------SEAIRTLRTGL-TL--LGDSEE-RRIFVVTSSLPGEGKSWISANLACGFAQQG
A0A2A2PVG8      -------AESIRTLRTGL-TF--LGTAEE-RCTFLIASSVPGEGKSWVASNLAHSFALQG
A0A2E0R421      -------AEAIRTLRAGL-TF--LGTPES-KRTFLITSSVPNEGKSWVASNLALAFAKQN
A0A2E5EJ69      -------AEAFRTLRASI-SL--LGREEE-RRVILFTSAVPSEGKTFCSVNYAIANASQG
A0A2G4I5Z5      -------AEAFRSMRASL-GL--LGRDED-RKVVFFTSAVPSEGKSFCCVNYAVCYAQQG
A0A4P5QQV6      -------VESMRSLRSSI-FF--LPVEGPPPRTFLVTSAVPNEGKSTVALNFAITMAMFD
A0A2E7ALI1      GLYSSLYAESYRILRAAV-ML--LGDEKE-RKITAFSSALPGEGKTTTSINYALATASQG
A0A178IDB9      -------AEAYRGIFSEI-EI--RSPVPF-PKRILITSSVPGEGKSLTASNMAAVFAAHG
A0A290QD69      -------SEAYRGVFSEV-EI--RSIVPY-PKRILFTSSIPSEGKSLTASNMAAVFAAHG
A0A2E7VDS1      -------MESFRSMFSRI-QM--NSTADG-PKSILITSAIPSEGKSLLAANLAYSCANHG
A0A7C8D3W3      -------SESLRGVRSAI-MF--DPESKK-NQMIAVTSAIPGDGKTTFTVNFAATMASAG
A0A178IFJ2      -------GEVVRGLYAQL-KL--SSRLDA-PKTLLVTSTIPGEGKSFVASNLATAFAAHG
A0A357FSP9      -------TEAFRSIHSAL-KI--SEESKN-AKVIVTTSTVPGEGKSFISSNLALTFANHG
A0A1T4WWY4      -------LENFRLIRSSI-LL--NGSPKGDGRVIMLTSARPSEGKTTVSSNVAWAFSSLG
A0A3D3LEQ6      -------LENFRLIRSSI-LL--NRSPMGEARVIMLTSARPGEGKTTVSANVAWAFSSMG
A0A3D3NW23      -------LENFRLIRSSI-LL--NRSPMGEARVIMLTSARPGEGKTTVSANVAWAFSSMG
A0A2A2R174      -------AEAFRSMRASL-GL--LGREED-RKVVFFTSAVPSEGKSFCCVNYAVAYAQQG
A0A1H2DTI1      -------SESFRNLRSAL-MF--MEVDGARPRTILFTSASPDEGKTTVATNFAITLAMLE
A0A1H1MGC9      -------VESFLTLHSSL-RL--KDESKR-AQAILVTSTIPGEGKSFTTTNLALTFAAHG
A0A1V5L462      -------AESFRALRSSI-LLHRQDSKEP-RQVFLVTSCAPAEGKSTVSSNLAVTLAYSG
A0A3D3LGD3      -------AEAYRILRTNI-EF--NRKNRD-ANCITVTSGGAGEGKSTTLCNLAVVCAQGG
A0A350ARX4      -------AEACRTLRSTI-LLKQSDAVHTSSQSILITSATPSEGKSTISANLAIALSHLG
B5JIS2          -------VESFMAVVAQL-EL--TSKQEG-PKSFVVTSTTTSEGKSTIAANVASGFVQIK
A0A6N6ZC77      -------AEACRTLRSSL-FF--MGADADRPEVILVTSSVPEEGKSTVAMNLAAAIALTS
A0A7C5H7K5      -------IEAYRTVRSAI-IY--QTRNRP-IKTILVTSSLPGEGKSVTAANLAIALAMAN
A0A538NJ59      -------AESYRNLRSAL-LYQ--GTDGQRPRVLLVTSAVPNEGKSTVAANLARILALGG
A0A2A2R3V9      -------AESFRNVRSSL-LFM--AIDGTRPKTLLITSAIPNEGKSTFASNLAITMAFAG
A0A3C1VFY9      -------VESYRNLRSSL-LYM--AETGTRPHTLLITSAVPNDGKSVTAANLAITLATGG
A0A2V2SMX4      -------VEAYRNLRSSL-LYM---GNGSRPRTLLITSSAPGEGKSLTAENLGAILANTG
A0A522AC27      -------VEAYRNLRSSL-LYM--NEGGNKRRTLLVTSSVPNDGKSMTAANLAITLAITG
A0A6M1RFD0      -------AEAYRNVRSSL-LFMPAGNGSEKPRLLLVTSSIPNDGKSMTTANLAITLALGG
A0A7C3HXH0      -------AEAYRNVRSSL-LFMQPTNGDARPSLLLVTSSIPNDGKSLTTANLAITLALGG
A0A1H2GQN6      -------AESYRILRARI-DL--QAHSGP-GNTLTMISGGPGEGKSTTLFNLAHVCAEAG
A0A512M3Y3      -------GETFRIIRSSI-PL--YVPGENKCQVIMVTSSRPSEGKTMVSSLLARSFADAD
A0A4P5R5J1      -------LESFRTLRSSI-IF--LPIEGARPKTILVTSATPGEGKTTIAANLAITFAFSG
A0A4P5YK43      -------AESIRGVRSAV-MF--GTQSKK-KQVMVITSALPGDGKTTFSVNFASTLANAG
A0A2A2RPW6      -------AEAFRTLRAAL-SL--LGRDED-RKVVLFTSAVPSEGKSFTGANYAVAHAQQG
B1ZT68          -------TESYRGIYSAI-DI--HSTEPF-PKAIISTSSMPGDGKSLTASNLAAAFAAHG
W0J7C2          -------SEAYRGIFSEI-EV--RSPLAF-PKALLVTSSVPAEGKSLLCCNLAAVFASHK
B4D1I7          -------AEAFRSLRSSI-AF--LPVAGAPPKVILITSAVPNEGKSTVAVNFAITLALAG
A0A353F286      -------AEAYRILRTNI-EF--NRKNPD-NNSITVVSGGAGEGKSTTLVNLAYVCAQGG
A0A354FSA6      -------AEAYRILRTNI-EF--NRKNPD-NNSITVVSGGAGEGKSTTLVNLAYVCAQGG
A0A3B9GA54      -------AEAYRILRTNI-EF--NRKNPE-NNSITVVSGGAGEGKSTTLVNLAYVCAQGG
A0A520LEH8      -------AEAYRILRTNI-EF--NRKNPE-NNSITVVSGGAGEGKSTTLVNLAYVCAQGG
A0A6B2M0T8      -------SELFRQIHSQI-LL--KNKKLQPGHTFVVTSALPKEGKSFFSINLAASFGRHH
A0A2D7B7R6      -------SEAFRSLRVNI-ES--MTRKKS-HKVVLFTSSIPSEGKTFTSINYASSLAQQG
A0A2E5K4P7      -------KEAFRSIFSTL-GV--NDASKD-AQVILNTSTIPGEGKSFVSTNLAFTYAESG
A0A2V6F9Q9      -------AESYRNIRSSI-LF--MSYEGPRPKTILVTSAIPNEGKSTVSANLAIALALSG
A0A2V6NZZ3      -------AESYRNIRSSL-LF--MPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A2V6EBU2      -------AESYRNIRSSL-LF--MPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A2V6EY06      -------AESYRNIRSSL-LF--MPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A2V6ME53      -------AESYRNIRSSL-LF--MPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A538NUU0      -------AESYRNIRSSL-LF--MPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A2V6NIJ1      -------AESYRNIRSSI-LF--MPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A2V6C292      -------AESYRNIRSSI-LF--MPYAGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A2V6D2X0      -------AESYRNIRSSI-LF--MPYAGPRPKTILVTSAVPNEGKSTVSANLAIALALSG
A0A2V5ZUK1      -------AESYRNIRSSI-FF--MPYEGPRPKSFLITSAVPSEGKSTVSSNLAITMALSG
A0A2V5XFN9      -------AESYRNIRSSI-FF--MPYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSG
A0A2V6EZC8      -------AESYRNIRSSI-FF--MPYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSG
A0A2V6I7Z5      -------AESYRNIRSSI-FF--MPYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSG
A0A3B9LCP2      -------AESYRNIRSSI-FF--MPYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSG
A0A3C0R669      -------AESYRNIRSSI-FF--MPYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSG
A0A2V6EID2      -------AESYRNVRSSI-FF--MPYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSG
A0A2V6MHB0      -------AESYRNVRSSI-FF--MPYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSG
A0A2W5YWL9      -------AESYRNVRSSI-FF--MPYDGPRPKTLLITSAVPSEGKSTISANLAITMALSG
A0A2V5NH62      -------AESYRNVRSSI-FF--MPYEGPRPKTMLVTSSVPNEGKSTISSNLAITMALSG
A0A2W6A620      -------AESYRNIRSSI-FF--MPYEGPRPKTLLITSSVPNEGKSTISSNLAITMALSG
A0A2V5PIJ4      -------SESFRNVRSSI-FF--MPYEGPRPKTFLVTSAIPNEGKSTVSANLSITMALAG
A0A2V6K2G8      -------AESYRNIRSSI-FF--MPYEGPRPKSFLVTSAVPSEGKSTVSANLAITMALSG
A0A2V5W206      -------AESYRNIRSSI-FF--MPYDGPRPKSFLVTSAVPSEGKSTLSANLAITMALSG
A0A2V6MW77      -------AESYRNIRSSI-FF--MPYDGPRPKSFLVTSAVPSEGKSTISANLAITMALSG
A0A6N4WVA3      -------AEACRNLRTSV-FF--MGDEHVKPSVFAVTSAVPSEGKSTVAANLAVALSFAH
A0A0R2XPB1      -------AEACRNLRTSV-FF--MGDEHVKPSVFAVTSAIPSEGKSTVSANLAVALSFAH
A0A348NQP1      -------AEACRNLRTSV-FF--MGDEHEKPSVFAVTSAIPSEGKSTVSANLAVALSFAH
A0A357FV58      -------AEACRNLRTSV-FF--MGDEHEKPSVFAVTSAIPSEGKSTVSANLAVALSFAH
A0A2G4GZN8      -------TEAVRSIYSAL-KV--NPAVSK-TRVFLVTSTRPSEGKTFVATNLALLFAQHS
A0A348NPT1      -------TEAFRSIHSAL-KI--SEESKN-AKVIVTTSTVPGEGKSFISSNLALTFANHG
A0A2E1KV60      -------IENFRSMLSYL-KI--SEHSKN-SNVFLITSTTPSEGKSFISSNLALSFSAHG
A0A2D7F4D9      -------TENFRSMLSYL-KI--NDQTKN-SNVFLLTSTVPSEGKSFISSNLALSFASNG
A0A3R7RBR8      -------TENFRSMLSYL-KI--NDQTKN-SNVFLLTSTVPSEGKSFISSNLALSFASNG
A0A2E0NH28      -------TETFRSIHSAI-RL--NEESKN-AKVFLTTSTVPSEGKSFVSSNLALTFANNG
A0A368BGT4      -------TETFRSIHSAL-KL--NDQSKN-AKIILATSTVPGEGKSFVSSNLSLTFANHG
A0A317ZP96      -------TETFRTIHSAL-KL--NDESKN-AKVIITTSTVPGEGKSFISSNMALTFANHG
A0A350AS32      -------TETFRSIHSAL-KL--NDESKN-AKVIVTTSTVPGEGKSFVSSNLALTFANHG
A0A6N6PLV8      -------AEAYRILRAAV-EF--NKPHRD-ANTYTLISGGPGEGKSTTMNNLAYICAKGG
A0A290QE54      -------VESFLSVYSSA-KI--HSKLDY-PKSILVTSTIPGEGKTLVSSNLAASFARHG
A0A1H1SWX2      -------SEAFLSVYSAV-KI--QSKLDF-PKSILVTSTIPGEGKTMISCNLAGSFARHG
A0A1D8AZK8      -------SEAFLSVYSAV-KI--QSKLDF-PKSVLVTSTIPGEGKTMISCNLAASFARHG
A0A4Q1C9I5      -------SEAFLSVYSAV-KI--QSKLDF-PKSILVTSTIPGEGKTMISCNLAASFARHG
A0A2E0V4K6      -------AESYRILRASV-VL--LGDEKE-RKVSLFFSALPGEGKTTTSINYALATASQG
A0A1G3ZL71      -------VESFLSVYSAV-KI--QSKIDY-PKVILVTSTIPGEGKTLVSCNLAGSFARHG
A0A556QP09      -------VEPFLGVYSSV-KI--HSKLDF-PKSILVTSTIPGEGKTLISSNLAGSFARHG
A0A2T6DX88      -------TESFLSIYSSV-KI--HSKLDF-PKAILVTSTIPGEGKTLVSCNLAASFARHG
A0A2T6CWI7      -------AESFLSVYSSI-KI--HSKLDF-PKSVLVTSTIPGEGKTLISCNVAGCFARHG
A0A3E1E5C8      -------AEAFLSVYSSV-KI--HSKLDF-PKSILITSTIPGEGKTLIACNLAGSFARHG
B1ZZ74          -------VEAFLSVYSSV-KI--HSKLDF-PKTVLVTSTIPGEGKTLISCNLAGSFARHG
A0A2E6NAH3      -------TETFRSIHSAL-KL--SDHSKN-AKVILTTSTVPGEGKSFVSSNLSLTFANHG
A0A2A5VZA5      -------TETFRSIHSSL-KL--NDESKN-AKIILATSTVPSEGKSFVSSNMALTFANHG
A0A424R295      -------TETFRSIHSSL-KL--NDESKN-AKVILATSTVPSEGKSFVSSNMALTFANHG
B4CZV9          -------VENFRVIRTNI-LS--MGELSKPPHVVMVTSAMPKEGKTVVSSNLAASFALTG
A0A0E3YV65      -------AETIRNLYGQL-KA--GSRLDL-PKILLVTSTLPGEGKSFVASNLAASFASHG
W0J900          -------GEIIQTLYSQL-RL--NSRLDA-PKTLIVTSTVPGEGKSFVASNLATAFAAHG
A0A3B9FM17      -------TEAFRSMYSRI-QM--NSQTDY-PKLILVTSAIPSEGKSLISANLAYSCANHG
A0A2D7WMI4      -------GESFRSMFSKI-QM--YSKTDY-PKIILVTSAIPSEGKSLISANLAYTCANHG
A0A2D6VHX5      -------TESFRSMYGKI-QM--NSHVTG-SKSILVTSAIPSEGKSLISANFAHTCANHG
A0A2D8I214      -------TESFRSMFSRI-QM--NSQTEY-PKTILITSAIPSEGKSLISANLAYSCANHG
A0A1Z8VL41      -------TESFRSMYSRI-QM--NSNADY-PKIILVTSAIPSEGKSLISANLAXSCANHG
A0A2E6TNA4      -------TESFRSMYSRI-QM--NSNADH-PKIILVTSAIPSEGKSLISANLAFSCANHG
A0A1Z8RG47      -------TESFRSMYSRI-QM--NSNADY-PKVLLVTSAIPSEGKSLISANLAFSCANHG
A0A1Z8RJJ5      -------TESFRSMYSRI-QM--NSNADY-PKVLLVTSAIPSEGKSLISANLAFSCANHG
A0A2D7V631      -------TESFRSMYSRI-QM--NSNSDY-PKVLLVTSAIPSEGKSLISANLAYSCANHG
A0A354RA24      -------TESFRSMYSRI-QM--NSNSDY-PKVLLVTSAIPSEGKSLISANLAYSCANHG
A0A2E9RV62      -------TEAFRSMYSRI-QM--NSKTDY-PKTILITSAIPSEGKSLLAANLAYSCANHG
A0A2E4AY96      -------AESFRSMFSKI-QV--NSLVDF-PKVILVTSAIPSEGKSLISTNLAFTCANHG
A0A3B9B9P4      -------AESFRSMFSKI-QV--NSLVDF-PKVILVTSAIPSEGKSLISTNLAFTCANHG
A0A2D5Y6N6      -------TESFRSMFSRI-QM--NSLNDY-PKTILVTSAIPSEGKSLISANLAYSCANHG
A0A2E7HSS8      -------TESFRSMYSRI-QM--NSLSDY-PKLILVTSAIPSEGKSLISANLAHSCANHG
A0A2D8VCK3      -------TEAFRSMYSRI-QM--NSQTDY-PKLILVTSAIPSEGKSLISANLAYSCANHG
A0A350QVY4      -------TEAFRSMYSRI-QM--NSQTDY-PKLILVTSAIPSEGKSLISANLAYSCANHG
A0A2E4ZYR7      -------MESFRSMFSRI-QM--NSHVEY-PKSMLITSAIPSEGKSLLAANLAYSCANHG
A0A2E6TCV1      -------MESFRSMFSRM-QM--NSHIDY-PKSMLITSAIPSEGKSLLAANLAYSCANHG
R7E4L8          -------EECFHILRNNA-ELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTG
A0A4Q3BVY2      -------LECFRVIRANI-IM-HPNRRNR-SQVVLVTSARPQEGKTTQATNLAWAFQSMG
A0A4P6PCA7      -------VEVFVGINGYI-LS--EKYKEQ-SRVLMISSAGPGEGKTISSCNLAISLARNG
A0A2T6DSN5      -------SEAYRGVFSEI-EI--RSVVPF-PKRLLVTSSVPSEGKSLTASNLAAVFAAHG
A0A317ZIW7      -------AEACRNLRTSV-FF-MGDESWK-PSVFAVTSAVPSEGKSTVSANLAVALSFSH
A0A7C4PPT4      -------VENFRVIRTNL-LS-MGAVTHD-PQAIVIASAMPEEGKTVVSYNLARSFAQMG
A0A7C4QZX4      -------TENFRVIRTNL-LS-MGAVTRN-PQALVVASAMPEEGKTMVSFNLAQSFAQMG
A0A3D4HHL8      -------AEACRNLRSSV-LF-GGDENEA-HQVVAVTSSVPGEGKSTMAANLAVTLAFAG
A0A366HV03      -------LECYRVLRAHL-GL-QLGNREG-AKVVMFTSARPSEGKTVTAANLAWTLQSIG
A0A6G6K911      -------LECYRVLRAHL-GL-QLGNREG-AKVVMFTSARPSEGKTVTAANLAWTLQSIG
A0A5R8KAF2      -------LESFRLIRSHI-LL-HPNSKGK-SQVIMVTSARPSEGKTSQAANLAWAFQSMG
A0A7C4LRZ6      -------AESVRVVRSAV-ML--GVEGGK-KQVQVITSAVPGDGKTTFSVNFAITLAIAG
A0A351MR11      -------IESLRAIHSVM-KI--NPSAAN-AKVLLTTSTRPGEGKTFVTTNIALTFAQHG
A0A388PR45      -------TEAVRAIYSAM-KI--NPASAA-GRVFLVTSTRPGEGKTFVATNLALAFAQHA
A0A388QR61      -------TESVRAIYSAM-KI--NPATAA-GRVFLVTSTRPGEGKTFVATNLALTFAQHS
A0A4P5YHI0      -------TESVRAIYSAM-KI--NPATAA-GRVFLVTSTRPGEGKTFVATNLALTFAQHS
A0A2A2RS01      -------TEAVRAIYSAM-KV--SPATAN-SRVFLVTSTRPGEGKTFVVTNLALSFAQHA
A0A2A2Y1A7      -------TEAVRAIYSAM-KV--SPATAN-SRVFLVTSTRPGEGKTFVVTNLALSFAQHA
A0A388PDH9      -------TEAVRSIYSAM-KV--SPATAN-SRVFLVTSTRPGEGKTFVATNLALSFAQHA
A0A2G4H1E7      -------TEAIRSIYSAL-KV--NPAVSK-ARVFLLTSTRPSEGKTFVATNLAMIFAQHS
A0A2G4GZA6      -------TEAVRSIYSAL-KV--NPAVSK-ARVFLVTSTRPSEGKTFVATNLALIFAQHS
A0A388P514      -------TEAVRSIYSAL-KV--NPAVSK-ARVFLVTSTRPSEGKTFVATNLALIFAQHS
A0A2A2YG59      -------TEAVRSIYSAL-KV--NPAVSK-ARVFLVTSTRPSEGKTFVATNLALIFAQHS
A0A2G4F7D5      -------TEAVRSIYSAL-KV--NPAVSK-ARVFLVTSTRPSEGKTFIATNLALIFAQHS
A0A2V2SDN0      -------LESFRNIRSCL-WF-MHQNGNK-PKSLLIGSSVPQEGKSTVALYLAATMAIGG
A0A1V6GL40      -------VEAYRNLRSSL-LY-MTEAGNR-PKTILVTSSVPNDGKSITAANLAITMANAG
A0A2V5X6Z6      -------LEAFRSIRSSL-LF-MSNGGTK-PKTIVVASSVPEEGKSTVALYLAATLAKGN
A0A2V5VGZ7      -------LEAFRSIRSSL-LF-MSNGGTK-PKTIIVASSVPEEGKSTVALYLAATLARAN
A0A2V5U130      -------LEAFRSIRSSL-LF-MSNGGTK-PKTIIVASSVPEEGKSTVALYLAATLARAN
A0A2V6C237      -------LEAFRSIRSSL-LF-MSNGGTK-PKTIIVASSVPEEGKSTVALYLAATLARAN
A0A3R8L982      -------TEAFLSIFSAV-KI--HSRLDF-PKSILVTSTIPGEGKTLISCNLAGAFARHG
A0A6N6QBS9      -------AESLRGIRSAL-LL--SPEGTS-KRLLAVTSAVPGDGKTTFTANFAITLANSG
A0A2E7HPU9      ALLQTLYTEAYRILRASV-TL--LGKEDE-RKVSLFTSSIPGEGKTTTSSNFAIAAAQQG
D5EML0          -------LESFRSIYSSI-RMRADLSAKR-KASFVITSSVPNEGKSMVACNLSAVIAKHN
A0A7C4PPJ4      -------AESIRVVRSAI-ML--GVDSPQ-KQVQLITSAVPGDGKTTFSVNYAITLALAG
A0A3C1C1M3      -------AEAFAGLRSVL-DS--PLYRDH-SQIVLVASSLPEEGKTTTSCNLATACALNG
A0A2S7U4L6      -------AEAYRILRTNI-EF--NRPSQD-DNAITVVSGGAGEGKSTTLVNLAYICAQGG
A0A2E9EYJ1      -------AEAYRILRTNX-EF--NRKNAD-AXAITLVSGGAGEGKSTTLVXLAYVCAQGG
A0A258AXR6      -------AEAYRILRTNI-EF--NRKTPD-ANCLSVVSGGAGEGKSTTMVNLAYVCAQGG
A0A3D3NZQ6      -------AEAYRILRTNI-EF--NRKNRD-ANCITVTSGGAGEGKSTTLCNLAVVCAQGG
A0A1T4WVZ9      -------AEAYRILRTNI-EF--NRKNPD-ANCITVTSGGAGEGKSTTLCNLAFVCAQGG
A0A4R7SSI6      -------AEAYRILRTNI-EF--NRRNPD-ANCITVTSGGAGEGKSTTLCNLAFVCAQGG
A0A4P6PD26      ----------MVSCASNK-PC--FLRGGSHRGAFAVLSSGAGEGKSTTCFNLAFVCAQQG
A0A1Z8SVB5      -------IQMNSNVRGS--------------RSILVTSAIPSEGKSLISANYAHTCANHG
A0A2V5W3Y0      -------AESYRNVRSSI-FF--MPYEGPRPKTMLVTSSVPNEGKSTISSNLAITMALSG
                                                          :**:      .       

A0A432FAS4      AKTLLVDFDLRRPSVHKAFQLQS---P---R-GLSSYLLGKIDSIE--E-------I-VH
A0A660Q3A0      SRVLLVDADLRRGTMHKFFGVEA---D---R-GLTDILVGRAKP-E--A-------V-IQ
A0A4Q3AQI1      ARTLLMDTDLRRGRLHRLFGYRK---S---P-GLSNVLLGE-CTLD--E-------A-LR
A0A6N2CMN7      EKTLLLDADLRLPNVARSLQLEN---D---Y-GLLDHIDKG-VSLD--E-------V-II
A0A2V5UAD5      SRVLLVDGDLRKGALHELMGMNH---E---P-GLSEMLRCP-EDLE--K-------I-IQ
A0A258AXL1      ERVLLIDADLRRGTLHKAFNLGN---K---NLGLMEILADR-VKWN--D-------A-VR
A0A2E6T1E0      VKTLLVDFDLRRPSVHKAFQLQS---P---R-GLSSYLLGK-VDSI--D-------AIVH
A0A2D5W0Q9      VKTLLIDADLRRPSMHKAFQMQS-------PIGLSAYLTGQITDPS--E-------I-TQ
A0A1Z9KB52      SKTILIDFDLRRPGLHNFCDESN---D---E-GVMTILNTP-NATE--EEVTDKLKK-VL
A0A7C5CZ90      DRVLLVDSDFRRPSLHKLLGVSN---K---I-GLTDLLFRE-KKLD--D-------V-IV
A0A257LYL4      YTTLMIDGDLRRPRLHTFFDINN---S---V-GLTNYLTTE-LMLE--D-------V-IL
A0A4Q2XXY1      YNTLMIDGDLRRPKLHTFFDINN---S---V-GLTNYLTTA-LQLE--D-------V-IL
A0A2V5U7A0      YRILIIDADLRRGSCHSRIGLRN---H---R-GLSNVLGGE-MPIE--Q-------L-IQ
A0A3D4CZT6      YTTLMIDADLRRPNVHTFFDINN---S---V-GLSNYLTTD-LMLE--D-------V-IL
A0A4V1S9Q4      YTTLMIDADLRRPRLHTFFDINN---S---V-GLTNYLTTE-LMLE--D-------V-IL
A0A355VK99      KKVLLIDGDLRKSSLTRRLGGSG---R---K-GLTSILLRQ-NPDT--A-------G-VI
A0A2V6N5E0      ARTLLIDCDLRRGALRETFGISS---K---I-GFSEVLKQE-VNWR--E-------V-VV
A0A2V6NH44      ARILLIDGDLRRGALREQFGSDS---R---L-GFSEVLQQE-VPWQ--E-------V-VM
A0A432FDF6      DRVLVVDSDLRRPSMHRFFKLSN---K---I-GLTNYLLGQ-ATIE--E-------V-IQ
A0A522ACN3      SRVVVVDSDLRRPTLHKMLGVSN---S---L-GLTNYLLKQ-NKLE--E-------V-IQ
A0A353DCA1      YTTLMVDADLRRPRLHSFFDINN---S---V-GLTNYLTTD-LALE--D-------V-IL
A0A3C1AXQ2      YSVLLIDADLRRPRMHTLFDVSN---S---V-GLTNFLTTN-VQLE--E-------V-VV
A0A3D0IZR7      MKVLLIDGDIRRPNMHNALQIEN---T---L-GLGEYLAGQ-ASLD--E-------L-IQ
A0A520LRZ3      YNTLMIDGDLRRPQLHTFFNINN---S---V-GLTNYLTTD-LALE--D-------V-IL
A0A356FSV4      DKTLLLDGDLRLPNIARSLQVSN---D---N-GLIDYIDHD-VDIN--A-------V-IV
A0A3D3DET9      SRVLLVDADLRKGTLHRLFGVSP---E---P-GLSDVLAKG-TAWE--T-------T-VS
A0A355SVK9      ERTLLLDADLRLPNVAKSLQLEN---D---Y-GLLNHVDKG-VSLD--E-------L-II
A0A2E5D7I3      KKTLLMDMDLRKPKVHRQFNLRR---GDLET-GMSEVLSNQ-CDAS--E-------A-V-
A0A2V5NYE2      SRVLLVDADLRKGVLHTLFGLPS---G---P-GLSEALSQG-LNWS--E-------A-VQ
A0A2V6FIP7      LKTLLVDADLRRPSVHKVFRLQS---P---V-GLSSYLMEKVSRVD--E-------F-IH
A0A353DI77      TRTLLVDFDLRKPAVHKIFNEERA--A---RPGIVNVLNGTAAANQ--A-------I-TV
A0A1V6GCZ3      QRTIIVDSDLRRPTLHKMLRVTN---A---I-GLTNYLLRQ-NTLE--E-------V-IQ
A0A3C1UJT2      HRTLLVDMDLRKPAVGPEFKLGE---E---YVGVSDLLQSE-------D-------K-LG
A0A2S7U0Z3      ERTLLVDLDLRRPALSGTFPDLD---G---GPGIVEVLAGQ-ASIQ--D-------V-FS
A0A5E6MKA7      T-VLLIDADLRRPSLHKTLGLRP---H---P-GLSELLTNQ-APLE--Q-------A-VQ
A0A6B3L936      ERTVLIDFDLRKPRVHELYPKLK---G---QPGTVDVLIGH-AQFD--D-------V-VA
A0A2N8IR72      KKVLLIDGDFRKSSLTRRLGGSG---R---K-GLTSILLQQ-------T-------T-DT
A0A2N8IV96      YATLMIDADLRRSKLHRYYELDN---E---V-GLTSYLLED-YPLE--E-------V-IF
R7E1V8          YATLMIDADLRRSKLHRYYELDN---E---V-GLTSYLLED-YPLE--E-------V-IF
A0A2E0R252      DRTLLIDGDLRKPVQSQVFDYDK---E---HPGLSDHLSLN-RPLK--E-------V-VM
A0A3E1EF48      ERTVLIDADLRKGVLHSTFNLSR---E---APGVTNLLSRT-SSLA--E-------V-IH
A0A2A2PVG8      DRTLLIDADMRRPVQGEVFGYGR---E---PKGLADVLSLG-TPLK--E-------V-IL
A0A2E0R421      ERTLLIDGDLRRPRIHKIFGFDR---D---EAGLSDHLSLR-TPLN--K-------V-VK
A0A2E5EJ69      KKTLIMDFDLRRPSVGDTFHIDR---K---TPGVTDLLLAN-KTLD--E-------V-AL
A0A2G4I5Z5      RRTLIIDFDLRKPTLAESFGVEG---E---HFGVSDVLLGK-VPLD--Q-------C-VQ
A0A4P5QQV6      VRVLLVDGDLRRGELHHALDLPN---G---A-GFGDVLNGD-CALQ--S-------A-VQ
A0A2E7ALI1      KKTLLLDMDLRKPKVHRQFNLRRSELE---K-GMSEVLSNQ-CTPE--E-------A-LT
A0A178IDB9      RRTLLVDCDFRRPSLRRYFGTAP---G---T-GLLSWLRAHPDDGA--D-------T-PL
A0A290QD69      KKTLLVDCDFRRPTLRRYFGTQS---G---V-GLLPWLRENGSNAA----------A-QV
A0A2E7VDS1      RRTILLDFDLRRPGLHKFCGVSN---D---K-GLLTLINEIHGEHG-------------T
A0A7C8D3W3      HRVLLVDADMRRGNIHNYFETDR---S---P-GLSELLNGE-LHWA--D-------V-IN
A0A178IFJ2      LRTLIIDGDLRRPVQHRLADAPN---T---H-GLLRWLDKG-GKSG--G-------P-LA
A0A357FSP9      EKTLLLDGDLRLPNVARSLQLEN---D---F-GMLDHIEKE-VALD--E-------V-IM
A0A1T4WWY4      EKTLLIDCDLRRGRVHEVIGASN---A---V-GMTDLLTGR-ASLS--E-------C-VQ
A0A3D3LEQ6      EKTLLIDCDLRRGRVHNVAGVPN---L---P-GLTRLLTGQ-ATLE--E-------C-LV
A0A3D3NW23      EKTLLIDCDLRRGRVHNVAGVPN---L---P-GLTRLLTGQ-ATLE--E-------C-LV
A0A2A2R174      KRTLIIDFDLRKPTLAESFGIKE---D---HFGVSDVLLNK-AQLE--Q-------A-VQ
A0A1H2DTI1      GRVLLVDADLRRGGLNRLLDIDA---P---L-GFTDVLLHG-ADWR--K-------A-VV
A0A1H1MGC9      EKVVIVDCDLRKPNIHKSFRLEN---L---K-GVIDVCAGT-QTVD--Q-------V-LC
A0A1V5L462      AKTLLIDCDLRRGHLHNKFGIDR---D---P-GLAELLEHPEMDVQDVI-------L-VG
A0A3D3LGD3      YSVLLIDADLRRPSMHTHFDAGN---T---T-GLTNFLTTN-VRME--D-------V-VV
A0A350ARX4      KRVLLIDADMRRGGVHHLFSLSA---E---N-GLSDLLSCE-SDFD--G-------Y-VQ
B5JIS2          RKTIIIDGDLRRPCLHQFNRIKK---S---G-GLIRWAEEG-YPMD--D-------I-YG
A0A6N6ZC77      SKVLLVDADLRRGQIAPTLHAAR---A---P-GLAEVLQQQ-VALD--A-------A-IQ
A0A7C5H7K5      AKVLLVDADLRKGRLHDWIGVEP---T---P-GLSHVLNGP-EQWD--T-------T-IV
A0A538NJ59      SRVLLVDGDLRKGALHELMGMNR---E---P-GLSEMLRCP-EDLE--K-------I-IQ
A0A2A2R3V9      SRVLLVDADLRRGRIHDAFSVSN---Q---R-GLSDVLSNQ-MNWR--D-------A-IQ
A0A3C1VFY9      SRVLLVDGDLRKGSLHSRFKIQA---D---T-GLSESLAQG-MDWH--K-------A-VK
A0A2V2SMX4      SRVLLVDGDLRKGVLHSRFGLDA---M---P-GLTEVLADG-KPVR--D-------V-IR
A0A522AC27      SRTLLVDADLRKGLLHARFGLKP---E---T-GLSEVLLAK-KDWR--N-------C-IC
A0A6M1RFD0      ARVLLVDADLRKGVLHRRFGVEN---S---S-GFSEVLQQK-TDWR--E-------V-VR
A0A7C3HXH0      SRVLLVDADLRKGVIHRRFKLEN---T---A-GFSEVLQQK-AKWN--D-------V-VR
A0A1H2GQN6      QSVIILDADLRRPSQHTILDIAS---G---P-GLADHLIRG-VPIA--D-------L-IR
A0A512M3Y3      QKTLLIDADMRRGRVHRVFDMEP---G---I-GLSGFLAGEVSQLT--D-------A-VI
A0A4P5R5J1      ARTLLVDADLRLGRIAKAFKIES---E---L-GLSDVLRQR-THWR--E-------V-IV
A0A4P5YK43      LKVLLIDSDLRRGTVSNYFNQPR---T---P-GFSEVLAGD-RPWQ--Q-------S-VR
A0A2A2RPW6      KKTLIIDLDLRKPSLSETFGVSS---N---QIGATDVMLGR-EPFE--K-------G-VQ
B1ZT68          RRTLLVDCDLRRPVLHRYFGVDL---S---N-GWIRALATSAAGGQ-------------P
W0J7C2          RRTLLVDCDLRRPTLHRLFGVKP---D---T-GWVDWLETDPA--Q-------------R
B4D1I7          SRVLLVDGDLRRGELHRSFGLTN---D---A-GFGDVLSGR-KSLD--D-------A-IQ
A0A353F286      YTTLMIDADLRRPRLHTFFDINN---S---V-GLTNYLTTD-LALE--D-------V-IL
A0A354FSA6      YTTLMIDADLRRPRLHTFFDINN---S---V-GLTNYLTTD-LALE--D-------V-IL
A0A3B9GA54      YTTLMIDADLRRPRLHTFFDINN---S---V-GLTNYLTTD-VALE--D-------V-IL
A0A520LEH8      YTTLMIDADLRRPRLHTFFDINN---S---V-GLTNYLTTD-LALE--D-------V-IL
A0A6B2M0T8      YKTLLIDCDFRRPSIGERM-------E---E-DLVKLLEQREDPEK--P-------L-VL
A0A2D7B7R6      HRTLLVDMDLRKPAVGPEFKLGE---E---YVGVSDLLQSE-------D-------K-LG
A0A2E5K4P7      NRVLLLDCDLRLPNIAKSLQLEL---T---T-GLLDYVQGT-ATLE--E-------V-IV
A0A2V6F9Q9      ARVLLIDGDLRRGTLREQFNSNS---R---L-GFSEVLRQE-VPWS--E-------V-VM
A0A2V6NZZ3      ARTLLIDGDLRRGALREQFGSNS---R---V-GFAEVLQQE-VPWQ--E-------V-VM
A0A2V6EBU2      ARTLLIDGDLRRGALREQFGSNS---R---I-GFAEVLQQE-VPWQ--E-------V-VM
A0A2V6EY06      ARTLLIDGDLRRGALREQFGSNS---R---I-GFAEVLQQE-VPWQ--E-------V-VM
A0A2V6ME53      ARTLLIDGDLRRGALREQFGSNS---R---V-GFAEVLQQE-VPWQ--E-------V-VM
A0A538NUU0      ARTLLIDGDLRRGALREQFGSNS---R---V-GFAEVLQQE-VPWQ--E-------V-VM
A0A2V6NIJ1      ARTLLIDGDLRRGALREQFGSNS---R---V-GFAEILQQE-VPWQ--E-------V-VM
A0A2V6C292      ARTLLIDGDLRRGVLREQFGSNS---R---V-GFSEVLQQE-VPWQ--E-------V-VM
A0A2V6D2X0      ARTLLIDGDLRRGVLREQFGSNS---R---V-GFSEVLQQE-VPWQ--E-------V-VM
A0A2V5ZUK1      AKVLLIDCDLRRGAIREAFGIDS---K---I-GFSEVLKGE-VNWR--E-------V-VV
A0A2V5XFN9      ARTLLIDCDLRRGALCEAFGITS---K---I-GFSEVLKQE-VNWR--E-------V-VV
A0A2V6EZC8      ARTLLIDCDLRRGALCEAFGITS---K---I-GFSEVLKQE-VNWR--E-------V-VV
A0A2V6I7Z5      ARTLLIDCDLRRGALCEAFGITS---K---I-GFSEVLKQE-VNWR--E-------V-VV
A0A3B9LCP2      APTLLIDADLRRGALREAFGISS---E---I-GFSEVLKQE-VNWQ--E-------V-VV
A0A3C0R669      APTLLIDADLRRGALREAFGISS---K---I-GFSEVLKQE-VNWQ--E-------V-VV
A0A2V6EID2      ARTLLIDADLRRGALREAFGISS---K---L-GLSEVLKQE-VNWQ--E-------V-VV
A0A2V6MHB0      ARTLLIDADLRRGALREAFGISS---K---L-GLSEVLKQE-VNWQ--E-------V-VV
A0A2W5YWL9      ARTLLIDGDLRRGALREQFGVSS---R---I-GFAEALKQE-VNWR--E-------V-VV
A0A2V5NH62      ARTLLIDGDLRRGALREAFGISS---K---I-GFSEVLKQE-VNWQ--E-------V-VV
A0A2W6A620      ARTLLIDGDLRRGALRESFGVSS---K---I-GFSEVLKQE-VNWQ--E-------V-VV
A0A2V5PIJ4      ARTLLIDGDLRRGALRDAFGVSS---K---I-GFSEVLQQE-VNWR--Q-------V-VV
A0A2V6K2G8      ARTLLIDCDLRRGALREAFGITS---K---I-GFSEVLKQE-VNWR--E-------V-VV
A0A2V5W206      ARTLLIDCDLRRGALRETFGISS---K---I-GFSEVLKQE-VNWR--E-------V-VV
A0A2V6MW77      ARTLLIDCDLRRGGLREAFGISS---K---I-GFSEVLKQE-VNWR--E-------V-VV
A0A6N4WVA3      SKVLLVDADLRRGRLHHLLKLNR---E---N-GFSDILDGR-LTLD--T-------A-LQ
A0A0R2XPB1      SKVLLVDADLRRGRLHHLMQLNR---E---N-GFSDILEGS-LTLD--S-------A-VQ
A0A348NQP1      SKVLLVDADLRRGRLHHLMQLNR---E---N-GFSDILDGN-LTLD--N-------A-VQ
A0A357FV58      SKVLLVDADLRRGRLHHLMQLNR---E---N-GFSDILDGN-LTLD--N-------A-VQ
A0A2G4GZN8      ERVLVIDADLRLPNVGPSLGFTG---D---G-GLSKWFNAE-MTLD--D-------A-IV
A0A348NPT1      EKTLLLDGDLRLPNVARSLQLEN---D---F-GMLDHIEKE-VALD--E-------V-IM
A0A2E1KV60      EKVLLLDADLRLPNVAKSLQLEN---D---S-GVIDFINGD-DSIS--N-------F-IV
A0A2D7F4D9      EKVLLLDGDLRLPNVAKSLQLEN---E---S-GVLDYIQGE-GTFD--S-------Y-IA
A0A3R7RBR8      EKVLLLDGDLRLPNVAKSLQLEN---E---S-GVLDYIQGE-GTFD--S-------Y-IA
A0A2E0NH28      DKTLLLDGDLRLPNIARSLQVSN---D---N-GLIDYIDHD-VDIN--A-------V-IV
A0A368BGT4      EKTLLIDGDLRLPNVARSLQLKN---D---L-GLLDHVEKG-VSLE--D-------I-II
A0A317ZP96      EKTLLLDGDLRLPNVARSLQLEN---E---K-GLLDHVEQG-KDLD--D-------V-IV
A0A350AS32      EKTLLLDGDLRLPNVARSLQLEN---D---F-GLLDHVDKD-VAID--E-------V-II
A0A6N6PLV8      YNVLVVDADLRRATQHKLFGVSN---E---F-GLTDYLVGR-AEID--E-------I-IK
A0A290QE54      KRTLLIDCDLRRPMVHRHFNQPN---D---N-GLITWFEHG-ASLD--G-------D-LT
A0A1H1SWX2      KKVLLIDCDMRRPMLHRHFKLTN---E---A-GLIAWFEAG-AKIP--A-------D-PF
A0A1D8AZK8      KRVLIIDCDMRRPMLHRHFKLTN---E---V-GLIAWFEAG-AKIP--A-------D-PF
A0A4Q1C9I5      KRVLIIDCDMRRPMLHRHFQLPN---E---A-GLLAWFEAG-AKIP--E-------D-PF
A0A2E0V4K6      RKTLLLDMDLRKPRVHRQLGRRRSEQG---K-GMAEILARQ-CPPE--E-------A-VC
A0A1G3ZL71      RSTLIIDCDMRRPMLHRHFKMEN---D---A-GLLAWAEAG-ASLD--G-------D-LT
A0A556QP09      KSVLLIDCDLRRPMMHRHFELAN---E---A-GLITWYEKG-ASLD--G-------D-LT
A0A2T6DX88      KSTLIVDCDLRRPMLHRRFGKEN---E---A-GLLTWFEKG-GKVE--G-------D-LA
A0A2T6CWI7      KKTLLIDCDLRRPMLHRHFKQEN---K---N-GLITWFESG-AMLD--S-------N-LT
A0A3E1E5C8      KRTLLIDCDLRRPMLHRNFKQEN---L---H-GLITWFEGG-AKLD--G-------D-LS
B1ZZ74          KNTLLIDCDLRRPMLHRHYKQQN---N---A-GLITWFEAG-SPLD--G-------E-LA
A0A2E6NAH3      EKTLLLDCDLRLPNVARSLQIEN---D---L-GMLDYVENG-VSLD--E-------V-IV
A0A2A5VZA5      ERTLLLDADLRLPNIASSLQLPN---E---F-GLLDHIEQG-SRLD--D-------M-IV
A0A424R295      ERTLLLDADLRLPNIASSLQLPN---E---F-GLLDHIEQG-SRLD--D-------M-IV
B4CZV9          AKTLLIDTDLRRGRLHRLFGYRK---E---P-GLSNVLLGE-CTLE--D-------A-FR
A0A0E3YV65      IKTLLVDTDFRRPTLHRYYGQSN---D---A-GLLRWLDTK-SKTE--P-------A-LL
W0J900          MRTLIIDGDLRRPVQHRLAGAPN---T---H-GLLRWLDKG-GRSD--G-------P-LA
A0A3B9FM17      RKTILVDFDLRRPGLHKFCNLEN---S---K-GLLSLVNDV-GKPG--Q-------D-VQ
A0A2D7WMI4      KNTILIDFDLRRPGLHKFAGLDN---E---S-GIITLVNE-MSQNP--N-------F-ID
A0A2D6VHX5      SKTILIDFDLRRPGLHNFCDESN---D---E-GVMTILNT-PNATE--E-------E-VT
A0A2D8I214      RRTVLVDFDLRRPGLHKFCGIEN---K---T-GLVSLVN--VASSK--E-------N-LK
A0A1Z8VL41      RKTILIDFDLRRPGLHKFCSITN---D---N-GLLTLINE-AKNGV--E-------N-LR
A0A2E6TNA4      RKTILIDFDLRRPGLHKFCSISN---D---K-GLLTLINE-AKNGV--E-------N-LH
A0A1Z8RG47      RKTILIDFDLRRPGLHNLCNITN---E---K-GIVTLVNE-VVKGS--K-------D-ID
A0A1Z8RJJ5      RKTILIDFDLRRPGLHNLCNITN---E---K-GIVTLVNE-VVKGS--K-------D-ID
A0A2D7V631      RKTILIDFDLRRPGLHNFCNITN---E---K-GIVSLVNE-VVKGS--S-------D-ID
A0A354RA24      RKTILIDFDLRRPGLHNFCNITN---E---K-GIVSLVNE-VVKGS--S-------D-ID
A0A2E9RV62      RKTILVDFDLRRPGLHKFCGVNN---D---R-GLLTLINETVANPT--P-------N-YN
A0A2E4AY96      KKTILIDFDLRRPGLHKFVGLEN---E---G-GLIPIINK-SAEQP--N-------Y-IK
A0A3B9B9P4      KKTILIDFDLRRPGLHKFVGLEN---E---G-GLIPIINK-SAEQP--N-------Y-IK
A0A2D5Y6N6      KKTILIDFDLRRPGIHKFCNITN---E---K-GLLSLINS-EKTDL--K-------E-LQ
A0A2E7HSS8      RKTILIDFDLRRPGLHKFCNMEN---E---R-GLLSLVNE-VSQKG--G-------D-ID
A0A2D8VCK3      RKTILVDFDLRRPGLHKFCNLEN---S---K-GLLSLVND-VGKPG--Q-------D-VQ
A0A350QVY4      RKTILVDFDLRRPGLHKFCNLEN---S---K-GLLSLVND-VGKPG--Q-------D-VQ
A0A2E4ZYR7      RRTILIDFDLRRPGLHKFCGVSN---D---R-GLLTLVNE-I--NG--E-------H-DT
A0A2E6TCV1      RRTILIDFDLRRPGLHKFCGVSN---D---R-GLLTLVNE-I--NG--E-------H-GT
R7E4L8          KKVLLIDGDLRKASLSAFYGGKN---A---R-GLVHLLMNPQVSPD--S-------V-LQ
A0A4Q3BVY2      EKTLLLDCDLRRGRIHGVVDIDK---A---P-GMTRLLLGE-CTLE--Q-------A-IH
A0A4P6PCA7      LKTLLIDADLRRPQIGNIFEIPA---E---HPSLLEWLSSGSSELERSE-------L-VS
A0A2T6DSN5      RRTLLVDCDFRRPTLRRYFGATA---G---V-GLLPWLREN-AHRP--D-------V-QI
A0A317ZIW7      SKVLLVDADLRRGRLHKLMNLDF---D---G-GLTDVLEGR-KEME--E-------V-IQ
A0A7C4PPT4      EKTLIIDADLRRGRLHRIFGQRS---A---P-GLSNILMQH-ADWR--D-------V-IR
A0A7C4QZX4      EKTLLIDADLRRGRLHRVFNQRS---A---P-GLSNILMQG-LDWR--E-------V-VR
A0A3D4HHL8      KKTLLLDADLRRGVLHNAFNVPN---D---K-GLSDVIRER-ISFD--D-------A-IQ
A0A366HV03      AKTLLVDLDFRKGRVHNLFGVDR---Y---P-GFCQALTGE-LVLE--D-------V-VR
A0A6G6K911      VKTLLVDLDFRKGRVHNLFGVNR---S---P-GFCQALTGE-LALE--D-------V-IQ
A0A5R8KAF2      SRTLLIDCDLRRGRVHQVLDVAN---D---I-GITQLLLNR-FPVQ--E-------A-VL
A0A7C4LRZ6      HRVLMVDADMRRGNIHNYFDLTR---E---N-GLSELLNGE-AHWL--D-------V-VK
A0A351MR11      ERVLVVDADLRLPNVAPSMGIET---D---N-GISKYFNNE-ITLD--E-------A-IL
A0A388PR45      ERVIVVDADLRLPNVGPSLGFAG---D---G-GVSRWFNGE-MTLD--E-------A-IV
A0A388QR61      ERVIVVDADLRLPNVGPSLGFAG---D---G-GVSRWYNGE-MTLD--E-------A-IV
A0A4P5YHI0      ERVIVVDADLRLPNVGPSLGFAG---D---G-GVSRWYNGE-MTLD--E-------A-IV
A0A2A2RS01      ERVLVIDADLRLPNVGPSLGFSG---D---G-GVSRWFNGE-MTLD--E-------A-IV
A0A2A2Y1A7      ERVLVIDADLRLPNVGPSLGFSG---D---G-GVSRWFNGE-MTLD--E-------A-IV
A0A388PDH9      ERVLVIDADLRLPNVGPSLGFSG---D---G-GVSRWFNGE-MTLD--E-------A-IV
A0A2G4H1E7      ERVLIIDADLRLPNVGPTLGFTG---D---A-GLSKWFNGE-IPLD--D-------A-II
A0A2G4GZA6      ERVLIIDADLRLPNVGPSLGFTG---D---G-GLSKWFNAE-MSLD--E-------A-IV
A0A388P514      ERVLIIDADLRLPNVGPSLGFTG---D---G-GLSKWFNGE-MSIE--E-------A-IV
A0A2A2YG59      ERVLIIDADLRLPNVGPSLGFTG---D---G-GLSKWFNGE-MSID--E-------A-IV
A0A2G4F7D5      ERVLIIDADLRLPNVGPSLGFTG---D---G-GLSKWFNGE-MSID--E-------A-IV
A0A2V2SDN0      SKVLLIDGDMRRAKLHRHFGVAS---S---P-GLAEILNQE-TYPN--Y-------G-IV
A0A1V6GL40      SRVLLVDADLRKGTLHRLFGVSP---E---P-GLSDVLAKG-TAWE--T-------T-VS
A0A2V5X6Z6      SRVLLIDADMRRTALHKFFGAAS---S---P-GLAEVLNEE-ISFA--E-------A-IV
A0A2V5VGZ7      SRVLLIDADLRRATLHTFFGTAS---S---P-GLAEILNEE-ISFK--E-------A-IV
A0A2V5U130      SRVLLIDADLRRATLHTFFGTAP---R---P-GLAEILNEE-ISFA--E-------A-IV
A0A2V6C237      SRVLLIDADLRRATLHTFFGTAS---S---P-GLAEILNEE-ISFK--E-------A-IV
A0A3R8L982      RRTLLIDCDLRRPTIHRHFGIEN---N---A-GLLAWFEAG-APFD--D-------L-LP
A0A6N6QBS9      HKTLLVDADLRRGNIHGYFEQPL---E---R-GLSEVLEGT-LGLS--D-------A-IR
A0A2E7HPU9      KKTILVDFDLRKPAVHKAFGLKRRDLP---T-GLTEVLTGKATLAE--A-------I-QE
D5EML0          YRVLLVDCDLRNPSLHRAHGVED---D---A-GLCPWFDSGSTDME--D-------L-LG
A0A7C4PPJ4      NRVLMVDADLRRGNINGFFNLER---D---Q-GLAEVLAGE-VHWL--D-------V-IK
A0A3C1C1M3      QKTLLIDFDLRRPRVGNIFPRPE---A---VCGLLEYLDSDQMKPE--E-------I-VY
A0A2S7U4L6      YSTLMIDADLRRPRLHTFFDINN---S---V-GLTNYLTTT-LPLE--D-------V-VL
A0A2E9EYJ1      YNTLMIDGDLRRPQLHTFFNINN---S---V-GLTNYLTTD-LXLE--D-------V-IL
A0A258AXR6      YNVLLIDADLRRPSLHTHFDVSH---A---T-GLTNFLTTD-IRLE--D-------V-VL
A0A3D3NZQ6      YSVLLIDADLRRPSMHTHFDAGN---T---T-GLTNFLTTN-VRME--D-------V-VV
A0A1T4WVZ9      YSVLLIDADLRRPRMHTLFDVSN---A---V-GLTNYLTTN-VTLE--E-------V-VV
A0A4R7SSI6      YSVLLIDADLRRPRMHTLFDVSN---A---V-GLTNYLTTN-VQLE--E-------V-VV
A0A4P6PD26      EKVLLIDADLRRPVQHTILGVSN---R---F-GLTNVLLRD-VPVE--E-------A-I-
A0A1Z8SVB5      SKTILIDFDLRRPGLHNFCNESN---D---A-GVMTILNTP-NATE--E-------Q-IS
A0A2V5W3Y0      ARTLLIDGDLRRGALREAFGVSS---K---I-GFSEVLKQE-VNWQ--E-------V-V-
                   :::* *:*                     .                           

A0A432FAS4      HAEV-------PNLDVIC---CGAV-PN-----NPSELAGSQRMKDFIEEIRSKYDKIMF
A0A660Q3A0      RTPI-------PNVDFIG---SGPY-PP-----NPAELLMRPELSAFLDYARRTYDRVMF
A0A4Q3AQI1      PTVS-------ENLTVLS---AGKH-LD-----TGTELLGSPRFTEIMQTLRERFDRIVM
A0A6N2CMN7      KDVY-------PNLDVLP---TGGK-SK-----NPTQVLNSAQFEAMFAELRDRYDRIVV
A0A2V5UAD5      TNSL-------PNFFFVS---SGGR-LS-----NPGDLFLNPALSQVLAWARQHFDYVLI
A0A258AXL1      SSGV-------ENLDFIS---RGND-SA-----RGHDLLSSSRFKEFLDALKHHFDRIIV
A0A2E6T1E0      QTEV-------PNLDVIC---CGAV-PN-----NPSELSGSQRMRDFVEEVRTKYQKIVF
A0A2D5W0Q9      TTEV-------PNLDLIC---CGAV-PN-----NPSELVGSKRMGELLDSLRDRYDRIFV
A0A1Z9KB52      CSIH-------PNLFLLP---SGGK-TR-----AATEIIEKKEFELLLTCLKKLADVVIF
A0A7C5CZ90      HTKL-------ETLDFIP---SGRI-ST-----SALGLLNSNQMKSLISELKRRYDYVFF
A0A257LYL4      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELIQDVKQRFDLVLV
A0A4Q2XXY1      QTPV-------ENLYFMP---SGIL-PA-----DAAGILNSRRMSELIADVKNRFDLVLI
A0A2V5U7A0      PTSI-------AGLSLVT---RGVC-PP-----NPSELLGTRKMKELVMDLRESYDFILL
A0A3D4CZT6      QTPV-------DNLYFLP---SGIL-PA-----DAAGLLNSRRMSELIQDVKQRFDLVLV
A0A4V1S9Q4      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELIQDVKQRFDLVLV
A0A355VK99      RPVG-------EDTRGMDVLYTGPT-VP-----NPVTLLSHPLLGQILSILKKQYDAVII
A0A2V6N5E0      PTAY-------ETLFVLP---RGKT-LS-----QPSEHLLRESTEALLKEMYQHYDYIII
A0A2V6NH44      PTTY-------PSLFLLT---RGKA-LP-----QPSEHLLRDSTDQFLKEIYHQYDYIII
A0A432FDF6      TTEL-------PSLHFIP---SGKL-PS-----SSMGILSSAKMKEFVAEMKSRYDYVFL
A0A522ACN3      HSNV-------ANLDFLP---SGKL-PS-----SSLGILSSNQMKDLISGLKQRYDYVFL
A0A353DCA1      QTPV-------DNLYFLP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A3C1AXQ2      RTPV-------ENLYFLP---SGML-PA-----DSAGVLNSQRMSELIADAKSRFDLVLI
A0A3D0IZR7      STAI-------PNLEILT---AGSL-GP-----EELGGFSRSRLATLMEACRPNYDVILV
A0A520LRZ3      QTAY-------ENLFFMP---SGIL-PS-----DAAGILNSRRMSELIADVKSRFDLVLV
A0A356FSV4      NEVY-------PHLDVLP---AGGK-SK-----NPTQILNSAKYSSLLGSLREKYDRIVI
A0A3D3DET9      ATKI-------ANLHILP---AGTF-TA-----RSSELFISEATQRFLRDAASRYDYVIF
A0A355SVK9      KEVY-------PNLDVLP---TGGK-SK-----NPTQVLNSAKFEAMLADLRERYDRIVI
A0A2E5D7I3      -TKT-------PGIERLDAIFAGGK-AP-----NPGELLREEAISKLFAWAREHYDHIVI
A0A2V5NYE2      ATRT-------PNLFLLP---RGAI-TH-----KSSEFFIGEVTERFLRDAAAKYDYVMI
A0A2V6FIP7      TTEV-------PHLDVVC---CGAV-PS-----SPSELAGSKRMRQFLEEVRNRYDRVIL
A0A353DI77      YPGL-------DTLSVIY---SGPK-SP-----NPGELLEPGRLRDLVEMFSSNFDHIVI
A0A1V6GCZ3      TTSL-------PTLDFLS---SGKL-PS-----SSLGILSSTQMKDLIGELKQRYDFVFF
A0A3C1UJT2      QFPDLAIYEATEKLFVLH---GGSH-IS-----NPSEHISGSAIEELILKARQNFDRIVI
A0A2S7U0Z3      DTEI-------ENLTVVC---SGAK-AP-----NPSELLNEGEFNSLLEDLIPEFDRIIL
A0A5E6MKA7      ATAL-------PNVWAIG---AGRT-PC-----HPADLLGAAAMAYLCQWARSHFGYVLL
A0A6B3L936      PTRV-------EGLFVVP---SGKK-PP-----NPLGLLQPDEIMELVDEASKEFDRVII
A0A2N8IR72      TGIIRPLGENSRGMDILY---TGPM-VP-----NPVTLLSHPLLGHILGILKKQYDAVII
A0A2N8IV96      QTPI-------ENLYVMP---AGPT-PF-----DPSGALNSRKFNELLQEVKQRFDIVLV
R7E1V8          QTPI-------ENLYVMP---AGPT-PF-----DPSGALNSRKFNELLQEVKQRFDIVLV
A0A2E0R252      KTRES------ENLFIMP---AGSR-SA-----NPSELLAGKGLKGAIGALEEYFDRIII
A0A3E1EF48      QT-EI------ENLWFVP---GGGK-SA-----NPAELLGGRHLGTFLADLCRDFDRVVI
A0A2A2PVG8      RSEVS------EDLFLIP---AGSW-SA-----NPAELLSGKSLRPLLEKLSEYFDRIVI
A0A2E0R421      PTDKS------GKLYVLL---AGSP-SA-----SPSELLASKALPALVDKLGKYFDRIII
A0A2E5EJ69      KTDF-------ENLTLIP---AGST-VP-----NPSELIASDHVKKLIDDVVGKYDQVVI
A0A2G4I5Z5      KTRF-------DNLFLLT---AGTM-VP-----NPAELLSGQWTAKLIQEASAKFDHVVL
A0A4P5QQV6      QTRV-------PGLSLLS---RGST-VQ-----NPGELFLSTDTDRFLRAADAQYDYVIM
A0A2E7ALI1      KTPGI------ETLDAIF---AGGK-AP-----NPGELLREGMIEKLFDWAREHYDHVVI
A0A178IDB9      DLATLGIATVENNLHLLP---AGHA-IK-----NPTEIIDQIAHSELFNKLSKSYEVIII
A0A290QD69      ETQKMGIVTIAPGLDLLP---AGDA-IK-----NPTEVIDQLAHCDLFNKLSKIYDLVII
A0A2E7VDS1      EPERNALTEIYPNLYVLP---SGGK-TR-----AATEMLARPDFDILLSNLKKLCDILII
A0A7C8D3W3      STPI-------ETLETIN---TGRL-PN-----NPGELLVSPITQQFLDEARNHYEYIII
A0A178IFJ2      NDPDLDLLRPAPNLFVLR---AGGT-SR-----RISELLDNEKLKGLFEQARREFDILVI
A0A357FSP9      KAVY-------PNLDVLP---SGGK-SK-----NPTQVLNSAKFEAMLADLRDRYDRIVI
A0A1T4WWY4      KVEA-------ENLWAIT---RGMV-VP-----GTTELLNSGVFAAILEELKKKYDRIIL
A0A3D3LEQ6      KSPA-------ENLWLLP---RGQV-IA-----GTTELLNTEVFSQLLDTLRKQFSRIIL
A0A3D3NW23      KSPA-------ENLWLLP---RGQV-IA-----GTTELLNTEVFSQLLDSLRKQFSRIIL
A0A2A2R174      TTRF-------DNLFLLT---AGTT-VP-----NPAELLSGQWTSKLIKEASAKFDHVVL
A0A1H2DTI1      PSKH-------KNLSVMV---CGKY-TS-----QGAELFLSPITDGILREMYNEFDYIIF
A0A1H1MGC9      RNVH-------PNLDVIP---AGGR-AK-----NPTQILNSKNFELMLSELRKRYDRIFI
A0A1V5L462      DQEL-------GNLSVIS---AGRP-QE-----NPGDLFLNERMDAILEACRKQYDFVIL
A0A3D3LGD3      RTAV-------ENLYFLP---SGLL-PA-----DSAGILNSQRMSDLIEDAKSRFDIVLI
A0A350ARX4      QTQH-------AKLDLIA---NGRS-LL-----NSGELLLSERMDNLLEWARERYTYVIV
B5JIS2          EDSPLGIQKLKGGAYLLP---AGGV-FP-----LPSKLLVSTKIDALLRKLEETFEVIIV
A0A6N6ZC77      PTEI-------ENLSFLA---SGAY-PQ-----RPGELLLSRRMDEILTQAREAYDYVVI
A0A7C5H7K5      ATPY-------QNLWFMP---RGES-VL-----NASELFLSDRCDSFLQQASEQFEFVVF
A0A538NJ59      TNSL-------PNFFFVS---SGGR-LS-----NPGDLFLNPALSQVLAWARQQFDYVLI
A0A2A2R3V9      ESAA-------YHFHIIP---RGPT-PP-----NPGELFLSSLVPSIFQEMRDEYDYVVV
A0A3C1VFY9      ETTV-------GNLFLLP---RGAS-TQ-----HSSELFLGPVMGKFLQETIKEYDYVLI
A0A2V2SMX4      ETTI-------PNLWLLP---RGST-TH-----HSSELFISQAAADFLKNAAMQYDYVIM
A0A522AC27      KTGV-------ANLDLLP---RGGT-TQ-----RSSELFVHQDTKDFLKAAAAEYDCVVV
A0A6M1RFD0      PTSV-------PNLWVVP---SGTP-TQ-----NSSELFLQPVTRRVLEEMAAAYDYVVL
A0A7C3HXH0      PTSI-------PNLWVIT---SGSP-TQ-----KSSELFLQPLTRTVLQEMAAQYDYVVL
A0A1H2GQN6      ETAI-------PNLHIIP---AGED-AH-----DAISRFDNQVLREIIVELKEKYQVIFI
A0A512M3Y3      KTDS-------PKLEVLS---RGKN-SA-----PRFEILSAARFVNTINDLRKQYDRIII
A0A4P5R5J1      PSST-------PNLSILP---RGKT-LP-----HPAEHFLGKVTDQLLQEVYAEFDYIIF
A0A4P5YK43      ETPI-------PTLHLLT---TGQL-IA-----NPGELLMGEVAHKVISEARQFYDHVII
A0A2A2RPW6      TTRF-------ENLFLMT---AGKM-VP-----NPAELLAGPWAKQLIEEASKRYDKVVL
B1ZT68          PPLPTTIA-FSENLDLLP---SGGV-AK-----NPTETLERFVTSGMLKRLLERYDLVIL
W0J7C2          PTLPVGIVPVADHLDLLP---AGRS-LG-----RPTELLDQLSRRETLQPLLDNYDLILF
B4D1I7          LTLV-------PGLMLLS---RGRG-VP-----NPGELYLGRSADEFLKTVHAEFDYVVL
A0A353F286      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A354FSA6      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A3B9GA54      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A520LEH8      QTPV-------DNLYFMP---SGIL-PA-----DAAGILNSRRMSELLQDVKQRFDLVLV
A0A6B2M0T8      S----------EGLHILP---FENS-TV-----EATELIESPAFRQSIEKFQEQYDIIII
A0A2D7B7R6      QFPDLAIYEATEKLFVLH---GGSH-IS-----NPSEHISGSAIEELILKARQNFDRIVI
A0A2E5K4P7      PGVF-------TNLDILP---AGGR-SR-----TPMTIFNNEYFPFLMNEIRQYYDKIII
A0A2V6F9Q9      PTAY-------HSLSLLT---RGKP-LT-----QPSEHLLRDSTDQFLKEIYHQYDYIII
A0A2V6NZZ3      PTAY-------PSLLLVT---RGKT-LA-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A2V6EBU2      PTAY-------PSLLLVT---RGKT-LA-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A2V6EY06      PTAY-------PSLLLVT---RGKT-LA-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A2V6ME53      PTTY-------PSLFLVT---RGKT-LP-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A538NUU0      PTTY-------PSLFLVT---RGKT-LP-----QPSEHLLRDSTDQFLKEIYHQFDYIII
A0A2V6NIJ1      PTVY-------PSLFLLT---RGKA-LT-----QPSEHLLRDSTDQFLKEIYHQYDYIII
A0A2V6C292      PTAY-------PSLFLLM---RGKA-LA-----QPSEHLLRESTDQFLKEIYHQYDYIII
A0A2V6D2X0      PTAY-------PSLFLLM---RGKA-LA-----QPSEHLLRESTDQFLKEIYHQYDYIII
A0A2V5ZUK1      PTAY-------ETLFVLP---RGKT-LG-----QPSERLLHETTDVLLREIYQHYDYVII
A0A2V5XFN9      PTAV-------PTLFVLP---RGKP-LS-----QPSEHLLRESTEALLKEIYQNYDYVII
A0A2V6EZC8      PTAV-------PTLFVLP---RGKP-LS-----QPSEHLLRASTEALLKEIYQNYDYVII
A0A2V6I7Z5      PTAV-------PTLFVLP---RGKP-LS-----QPSEHLLRESTEALLKEIYQNYDYVII
A0A3B9LCP2      PTFY-------PSLFVLP---RGKI-SA-----QPSEHLLRDSTDAILKEMYNYYDYIII
A0A3C0R669      PTFY-------PSLFVLP---RGKI-SA-----QPSEHLLRDSTDAILKEMYNYYDYIII
A0A2V6EID2      PTSY-------PSLFILP---RGKS-LS-----QPSEHLLRDSTDVLLKEMYKHYEYILI
A0A2V6MHB0      PTSY-------PSLFILP---RGKS-LS-----QPSEHLLRDSTDVLLKEMYKHYEYILI
A0A2W5YWL9      PTSC-------SNLSLLP---RGKT-VA-----QPSEHLLRDSTDQMLKDMYQQYDYILI
A0A2V5NH62      PTTY-------ENLFVLP---RGKT-LG-----QPSEHLLRDSTDALLRDMYNHYDYIII
A0A2W6A620      PTSY-------PNLYLMP---RGKT-LG-----QPSEHLLRESTDQLLKEMYNHYDYILI
A0A2V5PIJ4      PTSY-------PNLFLMP---RGKT-IG-----QPSEFLLRESTDALLREINTFFDYIII
A0A2V6K2G8      PTAV-------STLFVLP---RGKT-LG-----QPSEHLLRESTEALLKEIYQDYDYVII
A0A2V5W206      PTAY-------ETLFVLP---RGKT-LS-----QPSEHLLRESTEALLKEMYQHYDYIII
A0A2V6MW77      PTAY-------ETLFVLP---RGKT-LS-----QPSEQLLRDSTEALLKELYQHYDYVII
A0A6N4WVA3      SSRY-------EHLDFVS---IGGY-PD-----HPAELLMSENMDAFIREARERYDFVIF
A0A0R2XPB1      SSSY-------EHLDFVS---IGGY-PD-----HPAELLMSKYMDQFIRDARAQYDFVIF
A0A348NQP1      STSY-------KHLDFVS---IGGY-PD-----HPAELLMSEYMDQFISEARERYDFVIF
A0A357FV58      STSY-------KHLDFVS---IGGY-PD-----HPAELLMSEYMDQFISEARERYDFVIF
A0A2G4GZN8      RDVA-------PGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIEELRGRYDRIFI
A0A348NPT1      KAVY-------PNLDVLP---SGGK-SK-----NPTQVLNSAKFEAMLADLRDRYDRIVI
A0A2E1KV60      KDVY-------PNFDVLP---SGGK-SK-----NPTAVLSDEKYQSMMLELRDRYDKIIV
A0A2D7F4D9      KEVY-------PNLDILA---SGGK-AK-----NPTAILNDSKFESMLLQLRDRYDKIII
A0A3R7RBR8      KEVY-------PNLDILA---SGGK-AK-----NPTAILNDSKFESMLLQLRDRYDKIII
A0A2E0NH28      NEVY-------PHLDVLP---AGGK-SK-----NPTQILNSAKYSSLLGSLREKYDRIVI
A0A368BGT4      KDVC-------PNLDVLP---TGGK-SK-----NPTQVLNSAQFEEMLAVLRDRYDRIVI
A0A317ZP96      KEVY-------PNLDVLP---SGGK-SK-----NPTQILNSASFESMLAELRDRYDRIII
A0A350AS32      KEVY-------PNLDVLP---SGGK-SK-----NPTQVLNSAKFEAMFADLRDRYDRIVV
A0A6N6PLV8      TTKI-------DNLSFIP---AGEL-PG-----DSEGILNSQRMTDLIAKVKGQYDLVFF
A0A290QE54      ENQHLGITRLSENFSLLC---SGGR-SK-----TPTEILENPAFGQLLARLKKHFDLIIV
A0A1H1SWX2      TDASLGFTKVDENLFLLR---SGGR-SK-----SPTELLETAVFGQFIEAMKQHFDLIVV
A0A1D8AZK8      TDAALGLAKVDENLYLLR---SGGR-SK-----SPTELLENPVFGQFIEAMKQHFDLIVV
A0A4Q1C9I5      TDASLGLTKAEENLFLLR---SGGR-SK-----SPTEFLENPIFGQFIEAMKQHFDLIVV
A0A2E0V4K6      QDVG------HGNLDAVF---AGGK-VR-----NPGELLKPGAIRELLQWAREHYDHVVI
A0A1G3ZL71      TDPKLGLARIADNLMLLR---SGGR-SK-----VPTELLEKPEFGELILQLKKRFDLIVI
A0A556QP09      INPSLGITSIGENLSLLS---SGGR-SK-----SPTQLLESPIFGQLLEKLKKHYDLIVV
A0A2T6DX88      NDPTLGIVKLEDNLSLLR---SGGR-SK-----IPTELLEDPRFGQLIAKLKNQYDLVVV
A0A2T6CWI7      THPSLGIVPVAENLWLLC---SGGR-SK-----SPTELLENPVFGQLLERLKKEFDLVIV
A0A3E1E5C8      TDPSLGIIKLADNLSLLC---SGGR-AK-----SPTELLENPAFGQLLEKLKKDYDLVVV
B1ZZ74          STPALGIIKISENLSLLC---SGGR-SK-----SPTEFLENPVFGQLLERLKREYDLVII
A0A2E6NAH3      KEVY-------PNLDVLS---TGGK-SK-----NPTQVLNSAQFEAMFSDLRNRYDRIVV
A0A2A5VZA5      SEVY-------PNLDVLP---SGGK-SK-----NPTQVLVSAQFEAMLADLRDRYDRIVV
A0A424R295      SEVY-------PNLDVLP---SGGK-SK-----NPTQVLVSAQFEAMLADLRDRYDRIVV
B4CZV9          PSGQ-------ENLTVLS---AGRH-LD-----HGTELLGSAQFSELLNSLRGRFDRIVI
A0A0E3YV65      RDPALGITAFGPSLHLLR---SGGT-TR-----RSTEILDSAAFRDLLDFLHKQYDAVII
W0J900          GDPDLGLLRPAPNLFVLR---AGGI-SR-----RISELLESKKLKALIEQAQREFDILLI
A0A3B9FM17      NCISESLTEVHPNLFLLP---SGGK-TR-----AATEMLEQNDFSTVIDLLRRNAEVIII
A0A2D7WMI4      SGLKKHLKNIHPNLNMLT---SGGK-TR-----SVTELIERKEFGILLDKLKAESDVIVV
A0A2D6VHX5      DKLKKVLCSIHPNLFLLP---SGGK-TR-----AATEIIEKKEFELLLTCLKKLADVVIF
A0A2D8I214      NSINDSVQEIHPNLYILP---SGGK-TR-----AATEMLEQKEFDIVHNELKEMFDVIIV
A0A1Z8VL41      ELTDKTLHPIHDNLYILP---SGGK-TR-----AATEILESAEFEMVTNHLKSLAEVIII
A0A2E6TNA4      ELADKTLHPIHDNLYILP---SGGK-TR-----AATEILESTEFEMVTNHLKSLAEVIII
A0A1Z8RG47      THIQESLHETHPNLHVLP---SGGK-TR-----AATEMLERAEFDLVMNKLRQIADVIIV
A0A1Z8RJJ5      THIQESLHETHPNLHVLP---SGGK-TR-----AATEMLERTEFDLVMNKLRQIADVIIV
A0A2D7V631      EQIKSCLHEIHPNLHVLP---SGGK-TR-----AATEMLERSEFDYVMNKLRQIAEVIIV
A0A354RA24      EQIKSCLHEIHPNLHVLP---SGGK-TR-----AATEMLERSEFDYVMNKLRQIAEVIIV
A0A2E9RV62      FWDSGTLVEIYPNLLILP---SGGK-TR-----AATEMLEKPEFDKMLFSLRQNAEIIII
A0A2E4AY96      ENLDSELHDIHPNLKMLT---SGGK-TR-----SVTELIEKNQFHELLGKLKSSADIIVV
A0A3B9B9P4      ENLDSELHDIHPNLKMLT---SGGK-TR-----SVTELIEKNQFHELLGKLKSSADIIVV
A0A2D5Y6N6      ELAQSTVTQIHPNLLVLP---SGGK-TR-----AATELLESNSFDRIHKILRTIADVIII
A0A2E7HSS8      QSVTETLTEIHPNLFVLP---SGGK-TR-----AATEMLEHNDFSVVIDSLKRHAEVIII
A0A2D8VCK3      NCISESLTEVHPNLFLLP---SGGK-TR-----AATEMLEQNDFSTVIDLLRRNAEVIII
A0A350QVY4      NCISESLTEVHPNLFLLP---SGGK-TR-----AATEMLEQNDFSTVIDLLRTNAEVVII
A0A2E4ZYR7      EAERNALTEIYPNLYVLP---SGGK-TR-----AATEMLERPDFDILLNNLKKLCDILII
A0A2E6TCV1      EAERNALTEIYPNLYVLP---SGGK-TR-----AATEMLERPDFDHLLNNLKKLCDILII
R7E4L8          SGKRF------PGFDLVT---AGPV-PP-----NPVALLTQGRLEELLRYWRARYDRIIL
A0A4Q3BVY2      SMGQ-------GGFDVIP---RGPV-IA-----GTTELLCQDVFSNMLEHFRKTYDRIVI
A0A4P6PCA7      RNVI-------EHLDVIT---SRPLKNV-----NPAEMLGRKELAELIKWARDEYDRVII
A0A2T6DSN5      DAHKMGIMNIGPAFDLLP---AGDA-IK-----NPTEVIDQIASCDLFNKLSKHYDIIVI
A0A317ZIW7      RSTY-------DNLDFVS---IGGH-PD-----HPAELLMSDSMEQFIKHAREHYDFIVF
A0A7C4PPT4      PTDH-------ENLFLMA---CGKH-LE-----GATELVGSPVFEKLLAELRQEFRRIII
A0A7C4QZX4      TTDK-------ENLLLLT---CGKH-LD-----GATELVGSPIFEKILQEFRQEFKRIVI
A0A3D4HHL8      RPGI-------ENLDFVA---HGTT-TK-----RPGELLSGVYFATMLEGLRKRYDFIVF
A0A366HV03      HTHL-------ANFHYCT---RGNT-SA-----GSAELLCRLSLEENVAIWRQQYDWIIL
A0A6G6K911      HTHL-------TNFHFCT---RGNT-SA-----GSAELLCRLGLEESINIWRQQYDWIIL
A0A5R8KAF2      KTSN-------PLLDVIP---RGPI-IT-----GTTELLCQKGFVDLVERFRGEYDQIVI
A0A7C4LRZ6      QTSV-------PTLKLIS---TGRL-PP-----NPGELLIGPITKELIEQARKEFDYIVF
A0A351MR11      KDFE-------PNLDILP---VGGI-CK-----NPTQVINSPRFDELIRELRTRYDRIFI
A0A388PR45      KDVA-------PGLDVLP---VGLS-CR-----NPTQVINHPRFGEMIDELRRRYDRVFI
A0A388QR61      KDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFAEMIDELRRRYDRVFI
A0A4P5YHI0      KDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFAEMIDELRRRYDRVFI
A0A2A2RS01      RDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFLAMLDEMKTRYDRIFI
A0A2A2Y1A7      RDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFLAMLDEMKTRYDRIFI
A0A388PDH9      RDVA-------PGLDVLP---VGMS-CR-----NPTQVINNPKFLAMLDEMKTRYDRVFI
A0A2G4H1E7      REVA-------PGLDVLP---VGLS-CK-----NPTQVINHPKFLAMIDGFRERYDRIFI
A0A2G4GZA6      HDVS-------PGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIDELRGRYDRIFI
A0A388P514      HDVS-------PGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIDELRGRYDRIFI
A0A2A2YG59      HDVS-------PGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIDELRGRYDRIFI
A0A2G4F7D5      HDVA-------SGLDVLP---VGLS-CK-----NPTQVINNPKFLAMIDELRGRYDRIFI
A0A2V2SDN0      TTAL-------ENLSFLP---AGAP-TL-----EPGELVLRSQFSSLLSDVYSRFDYIII
A0A1V6GL40      ATKI-------ANLHILP---AGTF-TA-----RSSELFISEATQRFLRDAASRYDYVIF
A0A2V5X6Z6      PTGL-------ENLALLP---AGEA-RQ-----NPGELALSPVWLSFLAEAKSQFDYVLV
A0A2V5VGZ7      PTGL-------ENLALLP---AGEA-NR-----NPGELVLSQVWPGFLAEAKPQFDYILV
A0A2V5U130      PTGL-------ENLALLP---AGEA-NR-----NPGELVLSQVWPGFLAEAKPQFDYILV
A0A2V6C237      PTGL-------ENLALLP---AGEA-NR-----NPGELVLSPVWPGFLAEAKPQFDYILV
A0A3R8L982      ENPHLGVIKIGENFDLLR---SGGR-SR-----TPTEFLESAAFTQLLTKLKKHYDLVIV
A0A6N6QBS9      ETPI-------KNLSLMV---AGAR-PG-----NPSELLIGAATKDLIMELRRQFDYVVF
A0A2E7HPU9      QAGQ-------ENFSIIF---AGQKAP------NPGELLTTEGVVAVLKELKQEFDVIVI
D5EML0          NESL-------GILKLSP---SLSLLRAGGGCEHPTELLGDLRVSALFSKLKDLYDIVVF
A0A7C4PPJ4      DTSV-------SHLKLLT---TGKL-PG-----NPGELLIGPITAQFIAEARKHFDFVVF
A0A3C1C1M3      ASEC-------RNLSVIS---SRVVGRS-----RPAELVGGAKVAALLAWARAHFDRIVL
A0A2S7U4L6      QTSI-------ENLYFMP---SGIL-PA-----DASGILNSRRMSELIQEVKSRFDLVLV
A0A2E9EYJ1      QTAY-------ENLYFMP---SGIL-PA-----DAAGILNSRRMSELIAXVKSRFDLVFI
A0A258AXR6      RTQV-------ENLFFLP---SGLL-PA-----DSAGLLNSQRMVDLIAEVKSRFDLVLI
A0A3D3NZQ6      RTAV-------ENLYFLP---SGLL-PA-----DSAGILNSQRMSDLIEDAKSRFDIVLI
A0A1T4WVZ9      RTPV-------ENLYFLP---SGML-PA-----DSAGVLNSQRMTELIEDAKSRFDIVLI
A0A4R7SSI6      RTPV-------ENLYFLP---SGML-PA-----DSAGVLNSQRMSELIADAKSRFDLVLI
A0A4P6PD26      ------KATSVPNLHFLP---SGRL-PR-----TSLGVLDPKRIGELISSLKSKYDVVLI
A0A1Z8SVB5      EKIEKCLCNIHPNLFLLP---SGGK-TR-----AATEIIEKKEFELLLAAXKKMADVVIF
A0A2V5W3Y0      ------VPTSYPNLFLLP---RGKT-LG-----QPSEHLLRDSTDALLADLYNHYDYIII
                                                                         :..

A0A432FAS4      DCPPVSAVSDPLMIAAATDGIIFVSKFNKVRREHARKTVQRIQDAGIYIAGICINDLD--
A0A660Q3A0      DCPPVLAVSEAAILCTLVDGVIFVVWAGQTSRKLSQLAVQTLRERGANILGCVLNNLD--
A0A4Q3AQI1      DTPPVLGLSDTSVMQSQVDGVLFVIWSAHTPIRTMKAAVEMLQTNGANFYGFVLNRLD--
A0A6N2CMN7      DSPPLAAVSDALNLLPLVDGIIYVIKFNTVKRKTAVVNVRRLWESNTPVFGAILNNIS--
A0A2V5UAD5      DSSPVFAADDTATLAPMVDGTLFVVRNRFSRPRPAREALELLFQRQAKVLGLVFNRAD--
A0A258AXL1      DTPPLLGLADSLLISKAVDGLIFVIRADQTTQRDVATASEILHQSGAQVYGFVLNCVN--
A0A2E6T1E0      DCPPVSAVSDPLIIAAATDGIIFVNKFNKIRREHARKTVQRIQDAGINIVGVCINDLD--
A0A2D5W0Q9      DCPPVSAVSDPLMVGARTDGMVFVSKFNKIRREHARKTVQRIQDAGIYILGTVINDID--
A0A1Z9KB52      DSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGDLKATGANILGVILNDLP--
A0A7C5CZ90      DSPPIIGVSDAAILASEVDMTIQVIQYRRYPQPMYLRAKQIIEKVGGNLVGIVLNNIN--
A0A257LYL4      DSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLMRVKQAVENVGGHVIGVVLNNVD--
A0A4Q2XXY1      DSPPILGVSDASVLASEVDLTMIVIQHRKLPRTMLMRVKQAIENVGGNLLGVVLNNVD--
A0A2V5U7A0      DTPPAIAVSDPAILSSVADGIILVFHARKTTVHSARQVKERFDAVRGPILGVILNGIN--
A0A3D4CZT6      DSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLVRVKQAVENVGGHVIGVVLNNVD--
A0A4V1S9Q4      DSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLLRVKQAVENVGGNVIGVVLNNVD--
A0A355VK99      DAPPYGILADTAILASLSDITLYTVRSGKIDKRYLTQIQQLADQGKLPNMAYIINGVN--
A0A2V6N5E0      DSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALELLYGRQVNIPGVILNFVD--
A0A2V6NH44      DSSPVLAADDTTSLAPKIDATLLVVRLSHTSARLTKKALESLYSRQVNVPGIILNYVD--
A0A432FDF6      DAPPIMGVSDASVLASMVDMCVLVVQYRKYPQLMTQRAKDMVTKVGGELVGVVLNNIN--
A0A522ACN3      DSPPIMGVSDASILASEVDITLQVIQYRRYPQPMNIRAKQLIEKVGGNLVGIVLNNIN--
A0A353DCA1      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLLRVKQAVENVGGQVIGVVLNNVD--
A0A3C1AXQ2      DSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLMRVKQTVENVGGTVLGVVLNNVD--
A0A3D0IZR7      DSPPVLGISDASVISQEVDVSLLLIQHRRYPRNVSQRAKRVIEDVGGKLFGVILNNVN--
A0A520LRZ3      DSPPILGVSDASVLASEVDLTIIVIQHRKLPRGMLIRVKQAIENVGGKALGVVLNNVD--
A0A356FSV4      DSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRRLWESNTPVFGSVLNNV---
A0A3D3DET9      DTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVRLLGLVFNAVR--
A0A355SVK9      DSPPLGAVSDALNLLPLVDGVIYVVKFNTVKRKTAMVNARRMAESNTPVFGAILNNI---
A0A2E5D7I3      DSAPILPVPDTRIIFPLVDNPCLVIRANVVPKPAVFRALDVMEEDGSRIVGVVLNGYR--
A0A2V5NYE2      DTAPVMAADDVTSLAPHLDGVLFVIRAERTSARVGRAALELLYHRQVSVLGLVFNGVR--
A0A2V6FIP7      DCPPVSAVSDPLIIASLSDGVAFVTKFNKIRRDHASRTIQRIQDAGIHILGVVLNDID--
A0A353DI77      DSAPLLPVPDTRILAPLVDNLALVIRAEHTPVKSIQRAFDMLEDDGVFSSGVILNDFT--
A0A1V6GCZ3      DSPPIMGVSDASILASEVDMTIQVIQYRRYPQPMNIRAKQLIEKVGGNLVGIVLNNIN--
A0A3C1UJT2      DSAPLGPIGDTLSVARLADMLCLVVRSGKTTSKVVLRIIDYLHRHGHTPSGIVLNFLR--
A0A2S7U0Z3      DSAPVLPVADSRLLAKHAHAVILVVRTRKTPIGAMIRACDLLKASGAKLGGVVVNGMK--
A0A5E6MKA7      DCPPLTGMPDAAVVGTLADGAVLVIRDGYVDRSEARRVVETLLGVNTRILGAVLNRVQ--
A0A6B3L936      DSPPVLPVSDTRLVAQHAHKVILVVRALKTPVGAVLRAKDLLLGAKLDLAGVVVNALK--
A0A2N8IR72      DAPPYGILADTAILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVN--
A0A2N8IV96      DSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVD--
R7E1V8          DSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVD--
A0A2E0R252      DSAPLVPVSDSLPLAKLAESVVLVCRVGKTPRGAIKRAIRVLEANHSAPVGVVANGLP--
A0A3E1EF48      DTAPLVPVSDTLPIAKRAQSVIMVYRMGKTPRKALFRGLKTLRSNHAEPVGIVANLLP--
A0A2A2PVG8      DSAPLVPVSDSIPIAKLVQSVVLVVRMGSTPKGAIKRAIRVLSDNGSHPVGIVANGLP--
A0A2E0R421      DSAPIVSVSDTYPLAKIAQSVVLVCRMSMTSRSSIMRALRILKVNQSDPVGIVANGLP--
A0A2E5EJ69      DNAPVTAVSDTLLILEYVQTICMVTRAAKTSYRLIGRALELVRRSGKNVSGLVLNFVP--
A0A2G4I5Z5      DNAPINAVSDALLIVKEAQTVCLVANAGKTSYRVVLRALEMLRRAGAKPSGVVLNFLP--
A0A4P5QQV6      DSAPVTAADDTSSLAPKVHATLFVFRFATSSMRISQKALDTLRERQVNVLGLVCNDVD--
A0A2E7ALI1      DTAPVLAVPDTRIIXPLVSNPXLVVRANVVPKPAVFRALEMLEEDGSRVVGIILNGYR--
A0A178IDB9      DTPPAAVFPDALLLSRFCAELVYVCRFRTVRRKLIKKTLSKFTESGISILGVVLNRMP--
A0A290QD69      DTPPAAVFPDALLLSRFCTEMIYVCRFKTVRKAVIRKALEKFQESGITILGVVLNCMP--
A0A2E7VDS1      DSPPVGLFPDSMAMARKVDEVLCVIRYGKVSRKVVKNLLAKVDETGANVLGVVLNDLP--
A0A7C8D3W3      DSPPVTAIDDTFSFVKIVDAFTFIVKAGETPMRFAKNAINEIIRRGAYISGIVVNGIK--
A0A178IFJ2      DTPPAGIFPDAFDLVPFASELVYVVRFNHVSRPQVHRVTERFRSTGLEMPGIVLNMMP--
A0A357FSP9      DSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNIS--
A0A1T4WWY4      DTPPVLGLSETAFLQHHADGVAIVVRCGKTLRKDVEDAVQSLQKLGAHFYGFILNGVD--
A0A3D3LEQ6      DTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQLEKLGGHFFGFVLNRVD--
A0A3D3NW23      DTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQLEKLGGHFFGFVLNRVD--
A0A2A2R174      DNAPINAVSDALMIVKEAQTVCLVANARKTSYRAVLRALEMLRRAGAKPSGVVLNFLP--
A0A1H2DTI1      DTSPVMAADDATSLAPKIDGTIFVLRASMTSARAARNALDQLYHRQVNVLGLVLNSVN--
A0A1H1MGC9      DTPPLAAVSDALIILPLLDGSLFTIFFNRVRRKAAQFSARKLLEVNVPCFGAVLNGLN--
A0A1V5L462      DTAPILAVDDTIGLLRRADDVIFVVKSGQTNFRQVKISLERLSVTKTKVWGFVMNYVK--
A0A3D3LGD3      DSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQTVENVGGTVLGVVLNNVD--
A0A350ARX4      DAPPILAVNDTIGLSNKTDSMMFVVRASQTSTRQVQSSLERLSSRTSKIMGLVFNCAP--
B5JIS2          DTPPVGLYPDALIFAKSVGETLLVARESKAPISQIRQVIGDIDSTGAPVLGLVLNDYS--
A0A6N6ZC77      DSAPILATDDTTSLAQRVDVALFVVRTNYTQTRQIKNSLERLRLRGAKIGGFVLNYVN--
A0A7C5H7K5      DSVPVLVSDDAGSLGPKIDGVIFVVRSGTTSARLAKAALDQLNVRGAKVLGLVLNALR--
A0A538NJ59      DSSPVFAADDTATLAPMVDGTLFVVRNRFSRPRPAREALELLFQRQAKVLGLVFNRAD--
A0A2A2R3V9      DSAPILATDDTASLAPKLDGTIFLMRTSYTSARLSRNAMDLLYQRQVNILGLVMNFVD--
A0A3C1VFY9      DTAPVMAADDVTSLAPRVDGVIFVVRAEFTSARVVRASLDMLYQRKARVLGLVFNAVR--
A0A2V2SMX4      DTAPVMAADDVASLAPNMDSTIFLVRAEHTSARVARAALDILYQRRVKVMGLVFNAVR--
A0A522AC27      DTAPVMAADDVTSLAPLIDGTIFVIRAGETSGRVARAALELLYQRNVPVLGLVFNAVQ--
A0A6M1RFD0      DTPPVMAADDVTTLAPLAHGVIFVVRAQHTSARVARAALDLLYQRNVKVLGLVFNAVN--
A0A7C3HXH0      DTPPVMAADDVTTLAPLTHGVIFVIRAQHTSARVARAALDLLYQRNVHVLGLVFNAVN--
A0A1H2GQN6      DSPPALGVSDASVIAHEVDKVVMVIQHRRYPREISIRTKKAIEEVQGNLVGVALNSVA--
A0A512M3Y3      DTPPLLGLADSIMVSKCVDGAIFVIRAEQTTQRDIATAMEVLVGTRTPIYGFVLNGVD--
A0A4P5R5J1      DSPPVMAADDVLSLSPKIDGTIFVVRFSTSSARRSRTAINLLVQRQANLLGIVCNDVR--
A0A4P5YK43      DCPPITAIDDTFCLIPITDGLLFVVKSGQTSMRFAKSALGALRHRGAEILGVVLNGIT--
A0A2A2RPW6      DNAPVNAVSDTLLICKEAQTICLVMHSRRTPVRVVSRALEMLRRAGGKPSGVVLNFLP--
B1ZT68          DTPPVAVFPDALLLSRYCKELIFVCKYGSVRLNSVRKTLARVHETGIKVLGLVINQMP--
W0J7C2          DTPPAAVFPDALMLARCCHEMIYVCRYRTVRPAIIRKVIDRFHGTGISLLGVVLNRLP--
B4D1I7          DSSPVMAADDTTSLAPKADAAVFVFRFTSSSTRASRKALELLRERQTNVIGIVCNDVS--
A0A353F286      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD--
A0A354FSA6      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD--
A0A3B9GA54      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD--
A0A520LEH8      DSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVD--
A0A6B2M0T8      DTAPAGLFPDAGLIGNYAQNFIFLTQLNKHRKATLKAILGRLSQSKAEILGVVVNKVS--
A0A2D7B7R6      DSAPLGPIGDTLSVARLADMLCLVVRSGKTTSKVVLRIIDYLHRHGHTPSGIVLNFLR--
A0A2E5K4P7      DSPPLAAVSDALNIVPFVDGILFVVKYNTVKRNTASLTVRKLAEAGKPIFGVILNNMA--
A0A2V6F9Q9      DSSPVLAADDTTSLAPKVDATLLVVRLSHTSARLTKKALELLYSRQVNVPGIILNFVD--
A0A2V6NZZ3      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVGVPGVILNCVD--
A0A2V6EBU2      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVGVPGVILNCVD--
A0A2V6EY06      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVGVPGVILNCVD--
A0A2V6ME53      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVNVPGVILNFVD--
A0A538NUU0      DSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVNVPGVILNFVD--
A0A2V6NIJ1      DSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYSRQVNVPGIILNYVD--
A0A2V6C292      DSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKAFELLYSRQVNVPGVILNFVD--
A0A2V6D2X0      DSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKAFELLYSRQVNVPGVILNFVD--
A0A2V5ZUK1      DSSPVLAADDTTSLAPKIDATLFVVRLAYTSARLTKKALELLYSRQVNVPGVILNFVD--
A0A2V5XFN9      DTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVNVPGVILNFVD--
A0A2V6EZC8      DTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVNVPGVILNFVD--
A0A2V6I7Z5      DTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVNVPGVILNFVD--
A0A3B9LCP2      DSPPVLAADDTTSFAPKIDATLFVVRLSHTSARLARKGLELLYDRQVNVPGIILNFVD--
A0A3C0R669      DSPPVLAADDTTSFAPKIDATLFVVRLSHTSARLARKGLELLYDRQVNVPGIILNFVD--
A0A2V6EID2      DSSPVLAADDTASLAPKIDATLFVVRLSYTSARLIRKGLELLYGRQVNVPGIILNFVD--
A0A2V6MHB0      DSSPVLAADDTASLAPKIDATLFVVRLSYTSARLIRKGLELLYGRQVNVPGIILNFVD--
A0A2W5YWL9      DSSPVLAADDTTSLAPKIDATLFVVRLGYTSARLTRKALELLYSRQVNVAGVILNYVD--
A0A2V5NH62      DSSPVLAADDSTSLAPKIDATLFVVRLSYTSARLTRKSLELLYNRQVNVPGVILNYVD--
A0A2W6A620      DSSPVLAADDSTSLAPKIDATLFVVRLSYTSARLTRKSLELLYNRQVNVPGVILNYVD--
A0A2V5PIJ4      DSAPVLAADDATSLAPKIDATLFVVRLSHTSARLTRKSLELLYNRQVNVPGVILNQVD--
A0A2V6K2G8      DSSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYNRQVNVPGVILNFVD--
A0A2V5W206      DSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALELLYGRQVNIPGVILNFVD--
A0A2V6MW77      DSSPVLAADDTTSIAPKIDATIFVVRLSYTSARLTKKALELLYGRQVNIPGVILNFVD--
A0A6N4WVA3      DTAPILATDDTSGFAGKVDAVLFTIRCAYTQVRQIKPAMARLRERNIDVSGLILNYVD--
A0A0R2XPB1      DTAPILATDDTCGFAAKMDAVLFTIRCAHTQVRQIKPAMARLRERKIDISGLILNYVD--
A0A348NQP1      DTAPILATDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMARLRERNIEISGLILNFVD--
A0A357FV58      DTAPILATDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMARLRERNIEISGLILNFVD--
A0A2G4GZN8      DSPPIGAVSDALHILPKTDGVIYVVRYNVVNARNAVSCISRLRDAHAPILGVVLNSMS--
A0A348NPT1      DSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNIS--
A0A2E1KV60      DSPPLAAVSDALNVVPYIDAVLFVIKYDSVKKSLVNSCVRRLWESKKPVLGAILNNVS--
A0A2D7F4D9      DSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRRLWESKTPLLGAVLNNVS--
A0A3R7RBR8      DSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRRLWESKTPLLGAVLNNVS--
A0A2E0NH28      DSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRRLWESNTPVFGSVLNNVS--
A0A368BGT4      DSPPLAAVSDALNLLPLVDGVIYIIKFNTVKRKTAVLNVRRLWESNTPVFGAILNNIT--
A0A317ZP96      DTPPLAAVSDALNLLPLVDGILYVIKFNTVKRKTAVVNVRRLWESNTPVFGAVLNNIT--
A0A350AS32      DSPPLAAVSDALNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPVFGAILNNIT--
A0A6N6PLV8      DSPPILGLSDGAVLASEVDVTIMVVQHRRFPRAMLQRVKQAVLGVGGRLIGVVLNNVD--
A0A290QE54      DSPPMGAVTDSLLIAERTDEVVYVCRFNKAYRKHIKLYIRALHNGKNDILGIVLNGLS--
A0A1H1SWX2      DSPPMGAVTDSLLIAERTDEVIYVCRFNRAYRKHIRLYIKQLKESKNELLGIVLNGLS--
A0A1D8AZK8      DSPPMGAVTDSLLISERTDEIIYVCRFNRAYRKHIRLYIKQLRESKNELLGIVLNGLS--
A0A4Q1C9I5      DSPPMGAVTDSLLISERTDEVIYVCRFNRAYRKHIRLYIKQLRESKNELLGVVLNGLS--
A0A2E0V4K6      DTAPVLAVPDTRIILPQADNRCLVIRANVVPKPAVFRAIDLLEEDGVKLAGVVMNGYR--
A0A1G3ZL71      DSPPLGAVTDSLLIAEQTDEVIYVCRFNRALRKHIKVFVRTLREGKNAFLGIVLNGLT--
A0A556QP09      DSPPLGAVTDSLLIAERVDEVIYVCRFNRAFRKHIRLYIKALRSGKNEILGVVLNGLS--
A0A2T6DX88      DSPPMGAVTDAMLVAERTDEVVYVCRFNHAARKHIRLYIRALQSGKNEILGIVMNGMS--
A0A2T6CWI7      DSPPLGAVTDSVLIAERVDEIVYVCRFNRAYRKHIRLYMRTLRQGKNEVLGIVLNGLS--
A0A3E1E5C8      DSPPLGAVTDSLLIAERTDEVIYVCRFNCAAKKHVRLYMKTLRNGKNEVLGVVLNGLS--
B1ZZ74          DSPPLGAVTDSMLIAERTDEIIYVCRFNRAYRKHIRLYMKALRDAKNEVLGVVLNGLS--
A0A2E6NAH3      DSPPLAAVSDALNLLPMVDGILYVIKFNTVKRKTAVINVRRLWESNTPVYGAILNNIT--
A0A2A5VZA5      DSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRRLWESNTPVFGAILNNIT--
A0A424R295      DSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRRLWESNTPVFGAILNNIT--
B4CZV9          DTPPVLGLSETSIMQSLVDGVLFVIWTGQTPVRCVKSAIETLRANRANFYGFVLNRLD--
A0A0E3YV65      DTPPAGVFSDAMVLAEQAGELVFVVRYNYTSRPGVRRLIETFKRSQIDLAGIVLNRMP--
W0J900          DTPPAGIFPDALSLAPFANELIYVVRFNYVSRPQVHRVTERLRSTGLELPGIVLNMMP--
A0A3B9FM17      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLP--
A0A2D7WMI4      DSPPIGLFPDALAFSKIADDIIFVTRYGKVARRVAKNLLYSIEESGTNILGVVLNDLP--
A0A2D6VHX5      DSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGDLKATGANILGVILNDLP--
A0A2D8I214      DSPPIGLFPDSLAIARKVDDVLFVTRYGKVSRKIAKNLVENLEETGVNVLGVVLNDLP--
A0A1Z8VL41      DSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIENIEETGANILGVVLNDLP--
A0A2E6TNA4      DSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIENIEETGANILGVVLNDLP--
A0A1Z8RG47      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLP--
A0A1Z8RJJ5      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLP--
A0A2D7V631      DSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLP--
A0A354RA24      DSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLP--
A0A2E9RV62      DSPPIGLFPDSLAMARKVDEVIFVTRYGKVARKVAKNLIESLEETGANMLGVVLNDLP--
A0A2E4AY96      DSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSNLEESGSNILGVVLNDLP--
A0A3B9B9P4      DSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSNLEESGSNILGVVLNDLP--
A0A2D5Y6N6      DSPPIGLFPDSLAMARKVEEVLFVTRYGKVSRKIAKSLLENLDETGAKILGVVLNDLP--
A0A2E7HSS8      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVVKSLIASIKETGANLLGVVLNDLP--
A0A2D8VCK3      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLP--
A0A350QVY4      DSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLP--
A0A2E4ZYR7      DSPPVGLFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLMRMDETGANTLGVVLNDLP--
A0A2E6TCV1      DSPPLALFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLTRVDETGANILGVVLNDLP--
R7E4L8          DGCPYEAVADASLMARHADLVLYVIRCGMIEKQYVPVIQGLADKGEFRSGAVILNAEN--
A0A4Q3BVY2      DAPPVLGLSESSSLQKVVDGTVLVVRAEVTGRKDVLDALALLRRSQAHFFGFVLNAVD--
A0A4P6PCA7      DTPPIGPVGDGVILASYVDSVIVVSRVGKTKMRGLKTMLSRLLEVDALVLGCIANDVP--
A0A2T6DSN5      DTPPSAVFPDALLLSRFCSEMVYVCRFKTVRKALIKKTLHKFAESGIHVLGVVLNCVP--
A0A317ZIW7      DTAPILATDDTTSFAPFVDAVLFTVRCSYTHLRQIKPAIARLKERSTNVDGIILNYVD--
A0A7C4PPT4      DTPPVLGLSETAMLQRLVDGVVLVVWCGRTPARYVKSAVEILQANHANFYGFVLNRLD--
A0A7C4QZX4      DTPPVLGLSETAMMQKHVDGVVLVVWCGRTPANYVKSAVETLQANHANLYGFVLNRLD--
A0A3D4HHL8      DLPPVLATDDTPGFVQKVDGVLFVVRSNTTRVKQAKSAFHILMFRRAKILGIVLNAFD--
A0A366HV03      DTPPVLGLSETTNLQRVADAVVLVVKAEKTHGRDVTEAVEQLMRAGAPMAGFVLNNID--
A0A6G6K911      DTPPVLGLSETTNLQRVADAVVLVVKAEKTHGRDVTEAIEQLMRAGAPMAGFVLNNID--
A0A5R8KAF2      DTPPVLGLSETAALRIVVDGVIMVVRAEKTTRRDVSDAVALLRKTDAHFFGMVLNDLD--
A0A7C4LRZ6      DCPPLTAIDDTFALLNLSDGVLFVVRAGQTSMRFARNAIAAVHQRGARLFGVVLNGIT--
A0A351MR11      DSPPLGAVSDALHLVPKVDGVIYVVRFNLVKKRNAMSCIARLREAGVPIVGAVLNSMA--
A0A388PR45      DSPPIGAVSDALHLIPKVDGVVYVVRFNVVSARNAAACLARLRDAGAPMLCAVLNQMS--
A0A388QR61      DSPPIGAVSDALHLIPKADGVVYVVRFNVVSARNAAACIGRLREAGVPMLCAVLNQMS--
A0A4P5YHI0      DSPPIGAVSDALHLIPKADGVVYVVRFNVVSARNAAACIGRLREAGVPMLCAVLNQMS--
A0A2A2RS01      DSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGRLAETGVPILGAVLNRMS--
A0A2A2Y1A7      DSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGRLAETGVPILGAVLNRMS--
A0A388PDH9      DSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGACLARLAETGVPILGAVLNRMS--
A0A2G4H1E7      DSPPLGAVSDSLHLLPKVDGVIYIVRYNAVNLRHATSCLARLREAQAPLLGVILNAMS--
A0A2G4GZA6      DSPPIGAVSDALHLLPKVDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVVLNAMS--
A0A388P514      DSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVVLNAMS--
A0A2A2YG59      DSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVVLNAMS--
A0A2G4F7D5      DSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVVLNAMS--
A0A2V2SDN0      DSPPVLAADDAATLAPKVDGVLFVVRGSHTSARMVREGLDTLRQRRARVLGVIFNRAV--
A0A1V6GL40      DTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVRLLGLVFN-AV--
A0A2V5X6Z6      DTPPVLAADDAATLAPKVDGVLFVVRGSFTSARMARGALDALRQRRVHVLGLIFNRAA--
A0A2V5VGZ7      DTPPVLATDDAGSLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVRVLGLIFNRTV--
A0A2V5U130      DTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVHVLGLIFNRAA--
A0A2V6C237      DTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVRVLGLIFNRTV--
A0A3R8L982      DSPPLGAVSDSLLIAERTDEVLYVCRFNRALRKHIKLYIKALRAGKNEILGVVLNGLT--
A0A6N6QBS9      DCPPLTAIDDTFSIAAFLDGLFFVVRAGKTSMRFAKMGINTVQQRGAPILGLIVNGVP--
A0A2E7HPU9      DSAPLLAVPDTRLLVPEVDNFCLVVRAEHTPKGAVAKCLDMLRDDDNEPAGIVVNDYQ--
D5EML0          DTPPIGLFSDATIVADSADSCVMVARQFAVKRTKFQHSVNQMERSTAPVVGVVFNGIKDV
A0A7C4PPJ4      DCPPLTAIDDTFALASHADGMLFVVRAGKTSMRFARNALNAVQQRGARLFGIVLNGIT--
A0A3C1C1M3      DVPPLGIVSDALSLAHLSDCVLVMARPATSRKRAVRHTIQRFQAAGMANLAVVMNDVE--
A0A2S7U4L6      DSPPILGVSDASVISSEVDLTMIVVQHRKLPRNMLVRVKQAVENVGGTVLGVVLNNVD--
A0A2E9EYJ1      DSPPILGVSDASVISSXVDLTIIVIQHRKLPRGMLXRVKQAIQNVGGTAXGVVLNNVD--
A0A258AXR6      DSPPILGVSDASVLANLADMTMIVVQHRKLPRHMLMRVKQGVENVGGKVVGVVLNNVD--
A0A3D3NZQ6      DSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQTVENVGGTVLGVVLNNVD--
A0A1T4WVZ9      DAPPILGVSDASVLANEADLTIIVVQHRKLPRHMLLRVKQTIENVGGTVLGVVLNNVD--
A0A4R7SSI6      DSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLLRVKQTVENVGGTVLGVVLNNVD--
A0A4P6PD26      DTPPLVGISDSSIIAKETDGAIIVVQYRKYPRDMLVKAKAMIETLGVNVVGAVLNNIN--
A0A1Z8SVB5      DSPPAGLFPDSIALARKTDEVLFVTRYGKVSRHVVKRLIGDLKITGANILGVILNDLP--
A0A2V5W3Y0      DSSPVLAADDSTSLAPKIDATLFVVWLSYTSARLVRKSLELLYNRQVNVPGIILNYVD--
                *  *     :   .                                        *     

A0A432FAS4      ------------FEGKDSYYYSYY------YYQNRYYASH------Y-------------
A0A660Q3A0      ------------FSRIGYYYYSTY------Y---GYYDYD------Y-------------
A0A4Q3AQI1      -------------LNATTNYYQYY--------YYSNDYYY------H-------------
A0A6N2CMN7      -------------GSLSSYYYSSY--------SDKAYQNY------Y-------------
A0A2V5UAD5      ------------ASARSHYY----------------------------------------
A0A258AXL1      ------------LRRLENNYYYGH------YYSRYYEPTY------Y-------------
A0A2E6T1E0      ------------FEGKDSYYYSYY------YYQNRYYASH------Y-------------
A0A2D5W0Q9      ------------FEGKDSYYYSYY------YYQNRYYASY------Y-------------
A0A1Z9KB52      -----------SKKATGY-YYSGY--YGYGYYRYKYYSKY------Y-------------
A0A7C5CZ90      -----------IAQDESYYYYSGY--YHDYYY-------Y------Y-------------
A0A257LYL4      -----------VRSDSQYQYYTSY--YT-----------Y------Y-------------
A0A4Q2XXY1      -----------VRSDSQYQYYTSY--YT-----------Y------Y-------------
A0A2V5U7A0      -----------VEDPDYAYYRHYY-------------GSD------Y-------------
A0A3D4CZT6      -----------VRSDSQYQYYTSY-------------YTY------Y-------------
A0A4V1S9Q4      -----------VRSDSQYQYYTSY-------------YTY------Y-------------
A0A355VK99      -----------FKSASYSYYGYGY-------------GYQ------Y-------------
A0A2V6N5E0      -----------TSLPEY--YYYQY-------------SEY------Y-------------
A0A2V6NH44      -----------TSLPEY--YYYQY-------------SEY------Y-------------
A0A432FDF6      -----------ISQDSYYYYYSGY-------------YYD------Y-------------
A0A522ACN3      -----------MSQDESYYYYSGY-------------YHD------Y-------------
A0A353DCA1      -----------VRSDSQYQYYTSY-------------YTY------Y-------------
A0A3C1AXQ2      -----------LRSDSQYQYYTSY-------------YTY------Y-------------
A0A3D0IZR7      -----------IKTDDNYYYYAGY-------------STQ----YGY-------------
A0A520LRZ3      -----------VRSDNQYQYYTSY-------------YTY------Y-------------
A0A356FSV4      -----------STALSSY-YYSHY-------------SDKSYQDY-Y-------------
A0A3D3DET9      -----------PSSED-Y-YYYRY-------------KDY------Y-------------
A0A355SVK9      -----------SSTLSSY-YYYSY-------------SDKSYSDY-Y-------------
A0A2E5D7I3      -----------ETRRLXG-YNYSY-------------GSYRYGKYGY-------------
A0A2V5NYE2      -----------PSSVDYY-YYYKY-------------KDY------Y-------------
A0A2V6FIP7      ------------FEGKDSYYYNYY------YYQNRYYSSH------Y-------------
A0A353DI77      -----------ENRLQGGKYGYGY------------GYGH------Y-------------
A0A1V6GCZ3      -----------MSQDESYYYYSGY------------YHDY------Y-------------
A0A3C1UJT2      ------------NNNNKGSYYYYY---------SSDKDKT------Y-------------
A0A2S7U0Z3      --------------RTGGSNYLGY---KGHGEYGGEEYGY------Y-------------
A0A5E6MKA7      -------------TSARSYYAYHY---------------A------Y-------------
A0A6B3L936      -------------ARHSGSGYFGY-----RDYGEYGHDSY------Y-------------
A0A2N8IR72      -------------FKSASYSYYGY-----------GYGYQ------Y-------------
A0A2N8IV96      -----------ITSDHQYQYYTTY-------------YSY------Y-------------
R7E1V8          -----------ITSDHQYQYYTTY-------------YSY------Y-------------
A0A2E0R252      ----------RTRTKGAYGYYYSY-------YGGGNYANY--------------------
A0A3E1EF48      ----------RVAGRGAYGYYYGY-------HGGGAIDGY------V-------------
A0A2A2PVG8      ----------QTRTAGAHGYYYSY-------SSGGSYSGY------S-------------
A0A2E0R421      ----------VAKTKTGHDYYYSY-------PGSGSYGSG------N-------------
A0A2E5EJ69      ------------EKRRAGYNYYYY-----------TDKKY------Y-------------
A0A2G4I5Z5      ------------QSAGSGYYYYYS------------GNKY------Y-------------
A0A4P5QQV6      -------------ESLQDYYYYRY-------------SEY------Y-------------
A0A2E7ALI1      ----ESRRLXGXXYSYGSYRYGKYGYSQYGYGGYGSYGSY------G-------------
A0A178IDB9      ------------HASIMNYGYDGY---------GAYGSDY------Y-------------
A0A290QD69      ------------HASVMNYGYDGY---------GAYKADY------Y-------------
A0A2E7VDS1      ------------EKKTPGYYYAGY--YGYGYFRYKYYNKY------Y-------------
A0A7C8D3W3      -------------PDNPSYYYTYY------------YHAY------YNKDLTEMPEEEPG
A0A178IFJ2      ------------SGRGSAAYYSGY-----GYYGSKHYSSY------Y-------------
A0A357FSP9      -------------STLASYYYSSY--------SDKAYQDY------Y-------------
A0A1T4WWY4      -----------FSKRVNHYYYYYY------------SASY------Y-------------
A0A3D3LEQ6      -----------FSKRSNHYDYYYY------------SSNY------Y-------------
A0A3D3NW23      -----------FSKRSNHYDYYYY------------SSNY------Y-------------
A0A2A2R174      ------------QSAGSGYYYYYS------------GNKY------Y-------------
A0A1H2DTI1      ------------ALLPDYYYYYRY-------------YEY------Y-------------
A0A1H1MGC9      -------------LAVSGYYYAQY--------YDKSYKDY------Y-------------
A0A1V5L462      ------------AGGNDYYYYGRY-------------KSY------R-------------
A0A3D3LGD3      -----------LRADSQYQYYTNY-------------YTY------Y-------------
A0A350ARX4      --------------ATGVDYYYNY----------RHYDSY------H-------------
B5JIS2          -----------FGSLNPRLAYGGK-------GKYKYHNNI------K-------------
A0A6N6ZC77      ------------VKGSDYYYYKKY-------------NDY------Y-------------
A0A7C5H7K5      -----------PTMGGYHYYYRKY-------------RDY------F-------------
A0A538NJ59      ------------ASARSHYY----------------------------------------
A0A2A2R3V9      ------------TNLPEYYYY-QY-------------KEY------Y-------------
A0A3C1VFY9      ------------MSVGGYYNYYRY-------------QDY------Y-------------
A0A2V2SMX4      ------------PTTAD-YYYSKY-------------SEY------Y-------------
A0A522AC27      ------------TGSGDYYYYYRY-------------KDY------Y-------------
A0A6M1RFD0      ------------PRTGEYYYYSRY-------------KDY------Y-------------
A0A7C3HXH0      ------------PRTGEYYYYSRY-------------KDY------Y-------------
A0A1H2GQN6      -----------TNSDEGYYYYGAY-------------ADY------Y-------------
A0A512M3Y3      -----------LSRMENYYYYSSY------------YPKY------Y-------------
A0A4P5R5J1      -------------LAESEYGYGNY----------YQYSAY------R-------------
A0A4P5YK43      -------------SDNPHYYYNNY------------YHAY------Y-------------
A0A2A2RPW6      -------------GSAGAGYYYYY-----------SGNKY------Y-------------
B1ZT68          ------------ESRFRASGYEGY---------GAYGQDY------Y-------------
W0J7C2          ------------QSKARSYGYHGY---------GTQSAAY------Y-------------
B4D1I7          -------------EAMQDYYYYRY-------------PDY------Y-------------
A0A353F286      -----------VRSDSQYQYYTSY-------------YTY------Y-------------
A0A354FSA6      -----------VRSDSQYQYYTSY-------------YTY------Y-------------
A0A3B9GA54      -----------VRSDSQYQYYTSY-------------YTY------Y-------------
A0A520LEH8      -----------VRSDSQYQYYTSY-------------YTY------Y-------------
A0A6B2M0T8      ---------RSKSRNLGTYKYVDY----------GKYKSY------Y-------------
A0A2D7B7R6      ------------NNNNKGSYYYYY---------SSDKDKT------Y-------------
A0A2E5K4P7      -------------SKSAEYYYSEY--------YTGQYKKY------Y-------------
A0A2V6F9Q9      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6NZZ3      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6EBU2      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6EY06      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6ME53      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A538NUU0      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6NIJ1      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6C292      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6D2X0      -------------TSLPEYYYYQY-------------S----------------------
A0A2V5ZUK1      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V5XFN9      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6EZC8      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6I7Z5      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A3B9LCP2      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A3C0R669      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6EID2      -------------TSLPEYYYYQY-------------AEY------Y-------------
A0A2V6MHB0      -------------TSLPEYYYYQY-------------AEY------Y-------------
A0A2W5YWL9      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V5NH62      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2W6A620      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V5PIJ4      -------------TSLSEYYYYQY-------------AEY------Y-------------
A0A2V6K2G8      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V5W206      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A2V6MW77      -------------TSLPEYYYYQY-------------SEY------Y-------------
A0A6N4WVA3      -------------AMQPGYYYYKY-------------SEY------Y-------------
A0A0R2XPB1      -------------TTQPGYYYYKY-------------SEY------Y-------------
A0A348NQP1      -------------TTQPGYYYYKY-------------SEY------Y-------------
A0A357FV58      -------------TTQPGYYYYKY-------------SEY------Y-------------
A0A2G4GZN8      -------------IRMASAYTDTY-------DS--SYRKY------Y------------V
A0A348NPT1      -------------STLASYYYSSY-------SD-KAYQDY------Y------------I
A0A2E1KV60      -------------SGLSSYYYSQY-------SS-EKYSQY------Y------------L
A0A2D7F4D9      -------------LGLSHYYYSQY-------SANKKYSAY------Y------------M
A0A3R7RBR8      -------------LGLSHYYYSQY-------SANKKYSAY------Y------------M
A0A2E0NH28      -------------TALSSYYYSHY-------SD-KSYQDY------Y------------I
A0A368BGT4      -------------SSLSSYYYSNY-------SD-KAYKNY------YTNRGEELDQGEEL
A0A317ZP96      -------------STLSSYYYSQY-------SD-KSYQDY------Y------------I
A0A350AS32      -------------STLSSYYYSHY-------SD-KAYQDY------Y------------I
A0A6N6PLV8      -----------AKHDDGYSYYNSY-------------NEY------Y-------------
A0A290QE54      --------------TRRIEYYSNY-------RYYRSYKKY------Y-------------
A0A1H1SWX2      --------------PRRIEYYSNY-------RYYRSYKKY------Y-------------
A0A1D8AZK8      --------------PRRIEYYSNY-------RYYRSYKKY------Y-------------
A0A4Q1C9I5      --------------PRRIEYYSNY-------RYYRSYKKY------Y-------------
A0A2E0V4K6      ----ESRRLLGYNYSYGAYRTGRYGYRQYGYGGYGSYGAY------G-------------
A0A1G3ZL71      --------------ARRIAYYTNY-------RYYRSYKKY------Y-------------
A0A556QP09      --------------PRRIEYYSNY-------RYYRSYKKY------Y-------------
A0A2T6DX88      --------------TRRIEYYSNY-------RYYRSYKKY------Y-------------
A0A2T6CWI7      --------------PRRIEYYSNY-------RYYRSYKKY------Y-------------
A0A3E1E5C8      --------------PRRIEYYSNY-------RYYRSYKKY------Y-------------
B1ZZ74          --------------PRRIEYYSNY-------RYYRSYKKY------Y-------------
A0A2E6NAH3      -------------SVLSSYYYSNY--------SDKAYQDY------Y-------------
A0A2A5VZA5      -------------TSLSSYYYSQY--------TDKAYQDY------Y-------------
A0A424R295      -------------TSLSSYYYSQY--------TDKAYQDY------Y-------------
B4CZV9          ------------LNATQNYYQYYY-----------YSHDY------Y-------------
A0A0E3YV65      ------------AGTHSDAYYSSY-----GHYGSKYAADY------I-------------
W0J900          ------------SGRGSSGYYSGY-----GYYGSRYYASY------Y-------------
A0A3B9FM17      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A2D7WMI4      ------------QKRSTGYYYSGY--YGYGYYRYKYYNKY------Y-------------
A0A2D6VHX5      ------------SKKATGYYYSGY--YGYGYYRYKYYSKY------Y-------------
A0A2D8I214      ------------QKKAPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A1Z8VL41      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A2E6TNA4      ------------QKKTPGYYYSGY--YGYGYFRYKYYYKY------Y-------------
A0A1Z8RG47      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A1Z8RJJ5      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A2D7V631      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A354RA24      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A2E9RV62      ------------EKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A2E4AY96      ------------SKKSTGYYYSGYYGYGYGYYRYKYYNKY------Y-------------
A0A3B9B9P4      ------------SKKSTGYYYSGYYGYGYGYYRYKYYNKY------Y-------------
A0A2D5Y6N6      ------------QKKAPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A2E7HSS8      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A2D8VCK3      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A350QVY4      ------------QKKTPGYYYSGY--YGYGYFRYKYYNKY------Y-------------
A0A2E4ZYR7      ------------EKKTPGYYYAGY--YGYGYFRYKYYNKY------Y-------------
A0A2E6TCV1      ------------EKKTPGYYYAGY--YGYGYFRYKYYNKY------Y-------------
R7E4L8          ------------FKNSRFHYYDEY------------SE----------------------
A0A4Q3BVY2      -----------LSKLGNYYNYYYY------------SAPY------Y-------------
A0A4P6PCA7      -----YSLAGKFSGAEGYGYGHSY------------KS-Y------V-------------
A0A2T6DSN5      ---------SSSVRNYGYDGYGSY------------ESDY------Y-------------
A0A317ZIW7      -------------TAQPGYYYYRY------------SE-Y------Y-------------
A0A7C4PPT4      ---------LSVTSNYYNYYNYYY------------YSYH------Y-------------
A0A7C4QZX4      ---------LSVTSNYYNYYNYYY------------YSYH------Y-------------
A0A3D4HHL8      -------------VRGPGYYYHRY------------GE-Y------Y-------------
A0A366HV03      ------------MSKVSNYYYYYY------------SSSY------Y-------------
A0A6G6K911      ------------MSKVSNYYYYYY------------SSSY------Y-------------
A0A5R8KAF2      -----------LNKAKNYYNYYYY------------SASY------Y-------------
A0A7C4LRZ6      -------------ADNPYYYYNHY------------YHGY------Y-------------
A0A351MR11      ---------TRLAAFYTNSYDASY------------SK-Y------Y-------------
A0A388PR45      ---------VRLASVYTDTYDPSA------------GK-Y------Y-------------
A0A388QR61      ---------VRMASVYTDTYDPTA------------GK-Y------Y-------------
A0A4P5YHI0      ---------VRMASVYTDTYDPTA------------GK-Y------Y-------------
A0A2A2RS01      ---------IRMASVYTDSYDPAN------------KK-Y------Y-------------
A0A2A2Y1A7      ---------IRMASVYTDSYDPAN------------KK-Y------Y-------------
A0A388PDH9      ---------IRMASVYTDSYDPAN------------KK-Y------Y-------------
A0A2G4H1E7      ---------LRMASAYTDSYDSSY------------RK-Y------Y-------------
A0A2G4GZA6      ---------LRMASAYTDTYDSSY------------RK-Y------Y-------------
A0A388P514      ---------LRMASAYTDTYDSSY------------RK-Y------Y-------------
A0A2A2YG59      ---------LRMASAYTDTYDSSY------------RK-Y------Y-------------
A0A2G4F7D5      ---------LRMASAYTDTYDSSY------------RK-Y------Y-------------
A0A2V2SDN0      ------------SSSFEYHHYQRY------------KD-D------Y-------------
A0A1V6GL40      ------------RPSSEDYYYYRY------------KD-Y------Y-------------
A0A2V5X6Z6      ------------SSPCERQYYQRY------------RR-A------Y-------------
A0A2V5VGZ7      ------------SSPYEHDYYQRY------------RR-A------Y-------------
A0A2V5U130      ------------SSPYGHDYYQRY------------RR-A------Y-------------
A0A2V6C237      ------------SSPYEHDYYQRY------------RR-A------Y-------------
A0A3R8L982      --------ARRIEYYSNYRYYRSY------------KK-Y------Y-------------
A0A6N6QBS9      -------------IDNPYYYYTTY------------YYAS------Y-------------
A0A2E7HPU9      -----------ERGGFARKYLYKY------------GG-Y------G-------------
D5EML0          NAAVGFGRNGVSHYGYGYEKDPEK------------YKAY------Y-------------
A0A7C4PPJ4      -------------ADNPYYYYNYY------------YHGY------Y-------------
A0A3C1C1M3      ------------HSKFTYHSYGPY------------YH-Y------Q-------------
A0A2S7U4L6      -----------LRSDSQYQYYTSY------------YT-Y------Y-------------
A0A2E9EYJ1      -----------VRSDNXYQYYTSY------------YT-Y------Y-------------
A0A258AXR6      -----------LRSDAQYQYYTSY------------YT-Y------Y-------------
A0A3D3NZQ6      -----------LRADSQYQYYTNY------------YT-Y------Y-------------
A0A1T4WVZ9      -----------LRSDSQYQYYTSY------------YT-Y------Y-------------
A0A4R7SSI6      -----------LRSDSQYQYYTSY------------YT-Y------Y-------------
A0A4P6PD26      ------------VMRDDYYYYY-----------HSYYSDY------Y-------------
A0A1Z8SVB5      ------------SKKATGYYYSGY--YGYGYYRYKYYSKY------Y-------------
A0A2V5W3Y0      ------------TSLPEYYYYQ--------------YSEY------Y-------------
                                                                            

A0A432FAS4      -----------------------KSDKPGGKDEETNSKKPEKESSAA-------------
A0A660Q3A0      -----------------------RY--------------PSGETGSA-------------
A0A4Q3AQI1      -----------------------TQLENA-------------------------------
A0A6N2CMN7      -----------------------IQHEEELEEELAAKVEPAGSKS---------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      -----------------------NNPKEGGEAA---------------------------
A0A2E6T1E0      -----------------------KSDKSDSEHGKEEEFDSKKTKKKAV------------
A0A2D5W0Q9      -----------------------SNEKKLGSKKGEGAKDGELVQGGKAGKDDEPSKA---
A0A1Z9KB52      -----------------------SPTEDT-------------------------------
A0A7C5CZ90      -----------------------SRHDEEE--------SKEPSSEKSPKTEKSGGMEGLE
A0A257LYL4      -----------------------APAESQSAAQLGPVAPQGSAVAPAPRS--QPAAKGDS
A0A4Q2XXY1      -----------------------SPTNIEK-ARPRPAASASTPATAGSRSGGKSSPKDDK
A0A2V5U7A0      -----------------------GTVAAAENGNGGEHADVEVLMAHDSFEKDPWPKIAAS
A0A3D4CZT6      -----------------------APSADSDPVPTVGATASATSGSALESKVVANDSEEDE
A0A4V1S9Q4      -----------------------APAESQIGPPVAAATSSSPAKPQAQSPSRGNDSE---
A0A355VK99      -----------------------GYGAKDPQQTARKRD----------------------
A0A2V6N5E0      -----------------------STPTSVPDGEAVAPVRRQRPKPIETT-----------
A0A2V6NH44      -----------------------NRPVAPPESAAAV---QHRTGQAQSS-----------
A0A432FDF6      -----------------------YYKSREK--------EESADEAQDGKK-----DAKLL
A0A522ACN3      -----------------------YSKNEDS--------MTEGEHKGDAKK----------
A0A353DCA1      -----------------------APSSLEETGTPQQMTAAPASSKTEEKK----------
A0A3C1AXQ2      -----------------------SPDNM----------AAPADKKPERRKKPTPAGQPSP
A0A3D0IZR7      -----------------------KKRAPRAAQRSKATATVAAVEIPAATPAASVDEVVEH
A0A520LRZ3      -----------------------SPSNIDPNQKISSDKPKAPQSEESKSSSEEVSIEDKF
A0A356FSV4      -----------------------INNEDDFEDQLVESTASGDEDTSEIARET--------
A0A3D3DET9      -----------------------RPYPSGGTKAAESVRTEQT------------------
A0A355SVK9      -----------------------VHHDVESEQDLGKGALKPELQGKS-------------
A0A2E5D7I3      -----------------------SQYGYGGYGSYGSYGSDDXED----------------
A0A2V5NYE2      -----------------------KAYPTSPSQSAATASPKREQAHRA-------------
A0A2V6FIP7      -----------------------NPRPDKPLKDKSEEVKKAG------------------
A0A353DI77      -----------------------GDDT---------------------------------
A0A1V6GCZ3      -----------------------YRSEEQEPVVKEGAESGGKDKLDIKQKY---------
A0A3C1UJT2      -----------------------SKSGYQKKQVTNSPMEVGASAEDEPVKS---------
A0A2S7U0Z3      -----------------------GGDK---------------------------------
A0A5E6MKA7      -----------------------RLPEEQKREQSLKAPSQPS------------------
A0A6B3L936      -----------------------GQED---------------------------------
A0A2N8IR72      -----------------------GYGTKEPQQTSRKQNK---------------------
A0A2N8IV96      -----------------------SADGASSGENADASSMKKVERSGKAKELAATQSHDSE
R7E1V8          -----------------------SADGGSSGENADASSMKKAERSGKAKELAATQSHDSE
A0A2E0R252      ------------------------SDAK--------------------------------
A0A3E1EF48      -----------------------SNDSK--------------------------------
A0A2A2PVG8      -----------------------SNEK---------------------------------
A0A2E0R421      -----------------------NSDTEKIKTTRVRVPLFQNILNLGSKMKDHDFFSKKQ
A0A2E5EJ69      -----------------------GYGEDKR------------------------------
A0A2G4I5Z5      -----------------------GQKGVYGASTPRS------------------------
A0A4P5QQV6      -----------------------GSQKKDAGKKQAARA----------------------
A0A2E7ALI1      -----------------------SDDDED-------------------------------
A0A178IDB9      -----------------------KAYQEEEAAAVK-------------------------
A0A290QD69      -----------------------KSYQGEKAESK--------------------------
A0A2E7VDS1      -----------------------GENEPQEHGKAKAG-----------------------
A0A7C8D3W3      DGPMKAPARTMAAPKKESSIEISIQAAARKKAEETRSPNDFPALAPEPALEADKRKAELF
A0A178IFJ2      -----------------------KEGQLAARSG---------------------------
A0A357FSP9      -----------------------ISQDVELEDELAGSVEPEMEPRA--------------
A0A1T4WWY4      -----------------------DANW----------DVKPAKKET--------------
A0A3D3LEQ6      -----------------------DSNW-EEEKEEREADERPGRKKRRGSSQSA-------
A0A3D3NW23      -----------------------DSNWEEEEKEDREADERPGRKKRRGSSQAA-------
A0A2A2R174      -----------------------GQKGVYGATSSKG------------------------
A0A1H2DTI1      -----------------------RPKDEVIEGAPGTPRRGKDGSKL--------------
A0A1H1MGC9      -----------------------VTMAKQDPGTVER------------------------
A0A1V5L462      -----------------------YQHKESGDSGNEEIRKKTGRLSPKEK-----------
A0A3D3LGD3      -----------------------SPDNRPAAEGGKPKKRRKAAGETAPARTPGGDLF---
A0A350ARX4      -----------------------QQPDAKQKRERS-------------------------
B5JIS2          -----------------------KHAKGAGRVKSKSMVGKLMAEDVEDDDNLEAVEANGK
A0A6N6ZC77      -----------------------APPSSGAGS----------------------------
A0A7C5H7K5      -----------------------QTAATKS------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A2A2R3V9      -----------------------NRGAKAS------------------------------
A0A3C1VFY9      -----------------------STHPGK-------------------------------
A0A2V2SMX4      -----------------------RTYPGKG------------------------------
A0A522AC27      -----------------------KPYPAKPA-----------------------------
A0A6M1RFD0      -----------------------HRSSRAKA-----------------------------
A0A7C3HXH0      -----------------------HRPSRARA-----------------------------
A0A1H2GQN6      -----------------------NNPKNRKKKKKGSSLQPRPAPPLPPGTTPPPTPPSQP
A0A512M3Y3      -----------------------DPSYVLQHADA--------------------------
A0A4P5R5J1      -----------------------ENADSEPLEPLPR------------------------
A0A4P5YK43      -----------------------GKQAQHAATAPTPIPAAVHRATPPNRPITLAVATAVP
A0A2A2RPW6      -----------------------GSKGVYGASSSKG------------------------
B1ZT68          -----------------------QAYAKTSAAQ---------------------------
W0J7C2          -----------------------KAYEEQTPA----------------------------
B4D1I7          -----------------------ATAKSDQAGV---------------------------
A0A353F286      -----------------------SPSNMEENQKPQAMTARKSSKSEPKGSSSSDTSNDDL
A0A354FSA6      -----------------------SPSNMEENQKPQAMTARKSSKSEPKGSSSSDTSNDDL
A0A3B9GA54      -----------------------SPSNMEENQKPQAMTARKSSKSEPKSSSVSDTSNDDL
A0A520LEH8      -----------------------SPSNMEENQKPQAMTARKSSKSEPKGSSSSDTSNDDL
A0A6B2M0T8      -----------------------PQKSEKTR-----------------------------
A0A2D7B7R6      -----------------------SKSGYQKKQVTNSPMEVGASAEDEPVKS---------
A0A2E5K4P7      -----------------------TSQGAPEVSLGETSNSHPKPARKMNLEQGSEAQA---
A0A2V6F9Q9      -----------------------NRSVAVLESEATAQRQPTR------------------
A0A2V6NZZ3      -----------------------NRPVAPSESEA------IA-QRSSG------------
A0A2V6EBU2      -----------------------NRPVAPSESEA------IA-QRSSG------------
A0A2V6EY06      -----------------------NRPVAPSESEA------IA-QRSSG------------
A0A2V6ME53      -----------------------NRPIAPPESEA------TA-QHSSG------------
A0A538NUU0      -----------------------NRPIAPPESEA------TA-QHSSG------------
A0A2V6NIJ1      -----------------------NRPVASSESEA------TT-QHHPTSQAQSS------
A0A2V6C292      -----------------------NRPVTSSASDA------IA-Q-HSSDQAQSF------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      -----------------------STPS-VPETDAQPVAPPVR-RQRPRPIETQI------
A0A2V5XFN9      -----------------------STPA-APDGEA---VTSVG-REHPKPIETA-------
A0A2V6EZC8      -----------------------STPA-APDGEA---VTPVG-REHPKPIETA-------
A0A2V6I7Z5      -----------------------STPA-APDGEA---VTPVG-REHPKPIETA-------
A0A3B9LCP2      -----------------------NAPASAPEGET---VAAPH-REQAKPVETS-------
A0A3C0R669      -----------------------NAPASAPEGET---VAAPH-REQAKHVQTS-------
A0A2V6EID2      -----------------------NPPASVTDDEA---LTAPP-PREPAKQPS--------
A0A2V6MHB0      -----------------------NPPASVTDDEA---LTAPP-PREPAKQPS--------
A0A2W5YWL9      -----------------------NTPAEPAE------------RPATHQVQPS-------
A0A2V5NH62      -----------------------NTPVPVEEHDD---VAAAHRHHQPRQIQSS-------
A0A2W6A620      -----------------------NTPVPVEEHDE---VAATTLHPQPKQIQSS-------
A0A2V5PIJ4      -----------------------NTPEPVDERAA---PAALH-HREPKQIQSS-------
A0A2V6K2G8      -----------------------STPT-VPDAET---VTPVR-RERPKPIETA-------
A0A2V5W206      -----------------------STPTSVPDGEA---VAPVR-RQRPKPIETT-------
A0A2V6MW77      -----------------------STPTSVPDGEA---VAPVR-RQRSKPMETT-------
A0A6N4WVA3      -----------------------TDSKSGSSSSSKATST---------------------
A0A0R2XPB1      -----------------------TDPKNGVQSTSQQTTASS-------------------
A0A348NQP1      -----------------------TDPKNSEQSLSQQTTA---------------------
A0A357FV58      -----------------------TDPKNSEQSLSQQTTA---------------------
A0A2G4GZN8      DE---------------------------------PRGATDSDSAKS-------------
A0A348NPT1      SQ---------------------DVELEDELA-----GSVEP-EMEPRA-----------
A0A2E1KV60      QDSYL-DLNESNATKSLDSSTANDQSAGVDTAVAESDTNTDTDKLDS-------------
A0A2D7F4D9      QESYLGNMDESEAEES-------NQAIVADTFTETKTDSDSEDKLDS-------------
A0A3R7RBR8      QESYLGNMDESEAEES-------NQAIVADTFTETKTDSDSEDKLDS-------------
A0A2E0NH28      NN---------------------EDDFEDQLVESTASGDEDTSEIARET-----------
A0A368BGT4      VQ---------------------GEELEDELV-----GDIET-ELESKS-----------
A0A317ZP96      QQ---------------------EEEFEHELE-----GEVEPEELQTKS-----------
A0A350AS32      HN---------------------DEEFEEELA-----GSVEP-TVDSKS-----------
A0A6N6PLV8      -----------------------GARREAPARIETAAPQLARPRPASREDY---------
A0A290QE54      -----------------------GTQT---------------------------------
A0A1H1SWX2      -----------------------GSQS---------------------------------
A0A1D8AZK8      -----------------------GSQS---------------------------------
A0A4Q1C9I5      -----------------------GSQS---------------------------------
A0A2E0V4K6      -----------------------SDDEED-------------------------------
A0A1G3ZL71      -----------------------GTQG---------------------------------
A0A556QP09      -----------------------GTQD---------------------------------
A0A2T6DX88      -----------------------GTQA---------------------------------
A0A2T6CWI7      -----------------------GAQT---------------------------------
A0A3E1E5C8      -----------------------GTQS---------------------------------
B1ZZ74          -----------------------GSQS---------------------------------
A0A2E6NAH3      -----------------------INQEEELEEELVGDIETELESKS--------------
A0A2A5VZA5      -----------------------IGQEDEMEDELAASTEPEEKVES--------------
A0A424R295      -----------------------IGQEDEMEDELAASTEPEEKVES--------------
B4CZV9          -----------------------YQHAIEST-----------------------------
A0A0E3YV65      -----------------------REEKA--------------------------------
W0J900          -----------------------KEEQLAGQSG---------------------------
A0A3B9FM17      -----------------------GKSDAEEKRKKKQAVS---------------------
A0A2D7WMI4      -----------------------GKNQDS-------------------------------
A0A2D6VHX5      -----------------------SPTEDT-------------------------------
A0A2D8I214      -----------------------GKEKKSEA-----------------------------
A0A1Z8VL41      -----------------------GSEKDTSTKIEV-------------------------
A0A2E6TNA4      -----------------------GSEKDTSSKIEA-------------------------
A0A1Z8RG47      -----------------------GKEKDEKAPVEKLTS----------------------
A0A1Z8RJJ5      -----------------------GKEKDEKAPVEKLTS----------------------
A0A2D7V631      -----------------------GKDKDEKPPVEKLTT----------------------
A0A354RA24      -----------------------GKDKDEKPPVEKLTT----------------------
A0A2E9RV62      -----------------------GKQGAEKAQ----GKNAKLS-----------------
A0A2E4AY96      -----------------------GGSKSNTG-----------------------------
A0A3B9B9P4      -----------------------GGSKSNTG-----------------------------
A0A2D5Y6N6      -----------------------GRERDDEPSSPTVQGKESVS-----------------
A0A2E7HSS8      -----------------------GKSDAEEKR----KSVSS-------------------
A0A2D8VCK3      -----------------------GKSDAEEKR----KKKQAVS-----------------
A0A350QVY4      -----------------------GKPDAEEKR----KNKQAVS-----------------
A0A2E4ZYR7      -----------------------GGRGEDEKA----EKKAQAS-----------------
A0A2E6TCV1      -----------------------GGKEGAESE----LPREKAS-----------------
R7E4L8          ------------------------------------------------------------
A0A4Q3BVY2      -----------------------DQMESEEEPAAMVQTRS--------------------
A0A4P6PCA7      -----------------------SDTAETAN-----------------------------
A0A2T6DSN5      -----------------------KSYQSEKVSS---------------------------
A0A317ZIW7      -----------------------TSTQKPEDSVKSVGGV---------------------
A0A7C4PPT4      -----------------------YKSYKTLEANPPAEPNSTPAEKSTS------------
A0A7C4QZX4      -----------------------YKSYKALENQPPAPVQG--------------------
A0A3D4HHL8      -----------------------TRREEPSPKVSKKMQAVSKT-----------------
A0A366HV03      -----------------------YQAFEEDDVAGRSAPVSA-------------------
A0A6G6K911      -----------------------YQAFEEDDMPGRSAPASA-------------------
A0A5R8KAF2      -----------------------EDLEGVGAGGKAVV-----------------------
A0A7C4LRZ6      -----------------------NKGKSSASASLSPIALPGSKMAGRRQSAVAGGNSRPT
A0A351MR11      -----------------------TDAADQGAEKPAPKKDPVV------------------
A0A388PR45      -----------------------VGESGAGPKA---------------------------
A0A388QR61      -----------------------ASDAGGPPSP---------------------------
A0A4P5YHI0      -----------------------ASDAGGPPSP---------------------------
A0A2A2RS01      -----------------------IDSEGSDSSG---------------------------
A0A2A2Y1A7      -----------------------IDSEGSDSSG---------------------------
A0A388PDH9      -----------------------IDAQDSDSSS---------------------------
A0A2G4H1E7      -----------------------VDERGASSSPGPPKS----------------------
A0A2G4GZA6      -----------------------VDETRSQAGADSTKS----------------------
A0A388P514      -----------------------VDEPRGQSDAGSAKS----------------------
A0A2A2YG59      -----------------------VDEPRGQSGAGSEKS----------------------
A0A2G4F7D5      -----------------------VDEPRGQSGAGSEKS----------------------
A0A2V2SDN0      -----------------------RWQPNVTTAA---------------------------
A0A1V6GL40      -----------------------RPYPSGGTKTAESARTGQA------------------
A0A2V5X6Z6      -----------------------RWEPQKSGRV-ALAGNLSPNTTDR-------------
A0A2V5VGZ7      -----------------------HWEPKETRCATALAGHSAPDATDG-------------
A0A2V5U130      -----------------------RWEPKETRRATALAGHSAPDATGG-------------
A0A2V6C237      -----------------------HWEPKETRCATALAGHSAPDATDG-------------
A0A3R8L982      -----------------------GPRAA--------------------------------
A0A6N6QBS9      -----------------------YHRPLTPDEGSYGSGDGTSGPGGAVAAETVDPVAGKN
A0A2E7HPU9      -----------------------GYGGYGGYGGYGGYGQYGGGYGSGSYGSYGSYGADEE
D5EML0          -----------------------RRSRSA-------------------------------
A0A7C4PPJ4      -----------------------RSRDRSASKTTGIPDVKPGKVMPPPRKTEVSR-----
A0A3C1C1M3      -----------------------KHYGA---------------------YAQAVPPSLTP
A0A2S7U4L6      -----------------------APGQNKSAAA----------------EATAKSSSDSP
A0A2E9EYJ1      -----------------------APRNLDPDMESGSIGSPKPG------SKLASXDQNNL
A0A258AXR6      -----------------------SPTNSPNGGTGGKSRRRKIKAETTATALGSSQSVSRL
A0A3D3NZQ6      -----------------------SPDNRP-AAEGGKPKKRRK-------AAGETAPARTP
A0A1T4WVZ9      -----------------------SPNNTA-APAGTRPEKRKKQIPPSRPGQATVASSSAP
A0A4R7SSI6      -----------------------SPNNTA-APAGHKPEKRKKQVAPGQVAKAVSAPSNGS
A0A4P6PD26      -----------------------HSSQSEVLDESGS------------------------
A0A1Z8SVB5      -----------------------SPDXA--------------------------------
A0A2V5W3Y0      -----------------------NTPLAVEEPDDVAAAHRHHQPRQIQSS----------
                                                                            

A0A432FAS4      ------------------------------------------------------------
A0A660Q3A0      ------------------------------------------------------------
A0A4Q3AQI1      ------------------------------------------------------------
A0A6N2CMN7      ------------------------------------------------------------
A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A7C5CZ90      TKY---------------------------------------------------------
A0A257LYL4      ELY---------------------------------------------------------
A0A4Q2XXY1      DDY---------------------------------------------------------
A0A2V5U7A0      EIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARNRFPKNRLHELFDRICEEILDD
A0A3D4CZT6      GLTY--------------------------------------------------------
A0A4V1S9Q4      --LY--------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      AKADIGGEDEKPKY----------------------------------------------
A0A522ACN3      -----AKVEIKPKY----------------------------------------------
A0A353DCA1      ----SERSSSEDLY----------------------------------------------
A0A3C1AXQ2      GAAASSNAPRGDLF----------------------------------------------
A0A3D0IZR7      PLDTPEASAPKVTFIRPPRGQDRF------------------------------------
A0A520LRZ3      ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A5E6MKA7      ------------------------------------------------------------
A0A6B3L936      ------------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A2N8IV96      DLY---------------------------------------------------------
R7E1V8          DLY---------------------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      KRPRRRNRRRPSRR----------------------------------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A4P5QQV6      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      ------------------------------------------------------------
A0A290QD69      ------------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A7C8D3W3      KSRRAAKRRAKFIEISLGSEEHFQSAPLPSPTVFEEREPEMSSKQA--------------
A0A178IFJ2      ------------------------------------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A1T4WWY4      ------------------------------------------------------------
A0A3D3LEQ6      ------------------------------------------------------------
A0A3D3NW23      ------------------------------------------------------------
A0A2A2R174      ------------------------------------------------------------
A0A1H2DTI1      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A1V5L462      ------------------------------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      ------------------------------------------------------------
B5JIS2          VAETAKSKLKSTPLKLNNKNSGSKSLIGKLMSEQEKKE----------------------
A0A6N6ZC77      ------------------------------------------------------------
A0A7C5H7K5      ------------------------------------------------------------
A0A538NJ59      ------------------------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A2V2SMX4      ------------------------------------------------------------
A0A522AC27      ------------------------------------------------------------
A0A6M1RFD0      ------------------------------------------------------------
A0A7C3HXH0      ------------------------------------------------------------
A0A1H2GQN6      DEF---------------------------------------------------------
A0A512M3Y3      ------------------------------------------------------------
A0A4P5R5J1      ------------------------------------------------------------
A0A4P5YK43      PKSAQDFKLRRATQRKANLTLPGATAARPARDVTVTRT----------------------
A0A2A2RPW6      ------------------------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      Y-----------------------------------------------------------
A0A354FSA6      Y-----------------------------------------------------------
A0A3B9GA54      Y-----------------------------------------------------------
A0A520LEH8      Y-----------------------------------------------------------
A0A6B2M0T8      ------------------------------------------------------------
A0A2D7B7R6      ------------------------------------------------------------
A0A2E5K4P7      ------------------------------------------------------------
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6NZZ3      ------------------------------------------------------------
A0A2V6EBU2      ------------------------------------------------------------
A0A2V6EY06      ------------------------------------------------------------
A0A2V6ME53      ------------------------------------------------------------
A0A538NUU0      ------------------------------------------------------------
A0A2V6NIJ1      ------------------------------------------------------------
A0A2V6C292      ------------------------------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      ------------------------------------------------------------
A0A2V5XFN9      ------------------------------------------------------------
A0A2V6EZC8      ------------------------------------------------------------
A0A2V6I7Z5      ------------------------------------------------------------
A0A3B9LCP2      ------------------------------------------------------------
A0A3C0R669      ------------------------------------------------------------
A0A2V6EID2      ------------------------------------------------------------
A0A2V6MHB0      ------------------------------------------------------------
A0A2W5YWL9      ------------------------------------------------------------
A0A2V5NH62      ------------------------------------------------------------
A0A2W6A620      ------------------------------------------------------------
A0A2V5PIJ4      ------------------------------------------------------------
A0A2V6K2G8      ------------------------------------------------------------
A0A2V5W206      ------------------------------------------------------------
A0A2V6MW77      ------------------------------------------------------------
A0A6N4WVA3      ------------------------------------------------------------
A0A0R2XPB1      ------------------------------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ------------------------------------------------------------
A0A2G4GZN8      ------------------------------------------------------------
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      ------------------------------------------------------------
A0A2D7F4D9      ------------------------------------------------------------
A0A3R7RBR8      ------------------------------------------------------------
A0A2E0NH28      ------------------------------------------------------------
A0A368BGT4      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A350AS32      ------------------------------------------------------------
A0A6N6PLV8      ------------------------------------------------------------
A0A290QE54      ------------------------------------------------------------
A0A1H1SWX2      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A4Q1C9I5      ------------------------------------------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A1G3ZL71      ------------------------------------------------------------
A0A556QP09      ------------------------------------------------------------
A0A2T6DX88      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A3E1E5C8      ------------------------------------------------------------
B1ZZ74          ------------------------------------------------------------
A0A2E6NAH3      ------------------------------------------------------------
A0A2A5VZA5      ------------------------------------------------------------
A0A424R295      ------------------------------------------------------------
B4CZV9          ------------------------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------------------------------------
A0A3B9FM17      ------------------------------------------------------------
A0A2D7WMI4      ------------------------------------------------------------
A0A2D6VHX5      ------------------------------------------------------------
A0A2D8I214      ------------------------------------------------------------
A0A1Z8VL41      ------------------------------------------------------------
A0A2E6TNA4      ------------------------------------------------------------
A0A1Z8RG47      ------------------------------------------------------------
A0A1Z8RJJ5      ------------------------------------------------------------
A0A2D7V631      ------------------------------------------------------------
A0A354RA24      ------------------------------------------------------------
A0A2E9RV62      ------------------------------------------------------------
A0A2E4AY96      ------------------------------------------------------------
A0A3B9B9P4      ------------------------------------------------------------
A0A2D5Y6N6      ------------------------------------------------------------
A0A2E7HSS8      ------------------------------------------------------------
A0A2D8VCK3      ------------------------------------------------------------
A0A350QVY4      ------------------------------------------------------------
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ------------------------------------------------------------
R7E4L8          ---TDG------------------------------------------------------
A0A4Q3BVY2      ------------------------------------------------------------
A0A4P6PCA7      ------------------------------------------------------------
A0A2T6DSN5      ------------------------------------------------------------
A0A317ZIW7      ------------------------------------------------------------
A0A7C4PPT4      ------------------------------------------------------------
A0A7C4QZX4      ------------------------------------------------------------
A0A3D4HHL8      ------------------------------------------------------------
A0A366HV03      ------------------------------------------------------------
A0A6G6K911      ------------------------------------------------------------
A0A5R8KAF2      ------------------------------------------------------------
A0A7C4LRZ6      GGAG--------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A388PR45      ------------------------------------------------------------
A0A388QR61      ------------------------------------------------------------
A0A4P5YHI0      ------------------------------------------------------------
A0A2A2RS01      ------------------------------------------------------------
A0A2A2Y1A7      ------------------------------------------------------------
A0A388PDH9      ------------------------------------------------------------
A0A2G4H1E7      ------------------------------------------------------------
A0A2G4GZA6      ------------------------------------------------------------
A0A388P514      ------------------------------------------------------------
A0A2A2YG59      ------------------------------------------------------------
A0A2G4F7D5      ------------------------------------------------------------
A0A2V2SDN0      ------------------------------------------------------------
A0A1V6GL40      ------------------------------------------------------------
A0A2V5X6Z6      ------------------------------------------------------------
A0A2V5VGZ7      ------------------------------------------------------------
A0A2V5U130      ------------------------------------------------------------
A0A2V6C237      ------------------------------------------------------------
A0A3R8L982      ------------------------------------------------------------
A0A6N6QBS9      GPGPRS------------------------------------------------------
A0A2E7HPU9      EDD---------------------------------------------------------
D5EML0          ------------------------------------------------------------
A0A7C4PPJ4      ------------------------------------------------------------
A0A3C1C1M3      TGK---------------------------------------------------------
A0A2S7U4L6      KTNDLY------------------------------------------------------
A0A2E9EYJ1      SAEDKF------------------------------------------------------
A0A258AXR6      DGDDVF------------------------------------------------------
A0A3D3NZQ6      GG-DLF------------------------------------------------------
A0A1T4WVZ9      RG-DLF------------------------------------------------------
A0A4R7SSI6      RG-DLF------------------------------------------------------
A0A4P6PD26      ------------------------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
                                                                            

A0A432FAS4      -----------------
A0A660Q3A0      -----------------
A0A4Q3AQI1      -----------------
A0A6N2CMN7      -----------------
A0A2V5UAD5      -----------------
A0A258AXL1      -----------------
A0A2E6T1E0      -----------------
A0A2D5W0Q9      -----------------
A0A1Z9KB52      -----------------
A0A7C5CZ90      -----------------
A0A257LYL4      -----------------
A0A4Q2XXY1      -----------------
A0A2V5U7A0      KLKNDFQQSMQEELRVL
A0A3D4CZT6      -----------------
A0A4V1S9Q4      -----------------
A0A355VK99      -----------------
A0A2V6N5E0      -----------------
A0A2V6NH44      -----------------
A0A432FDF6      -----------------
A0A522ACN3      -----------------
A0A353DCA1      -----------------
A0A3C1AXQ2      -----------------
A0A3D0IZR7      -----------------
A0A520LRZ3      -----------------
A0A356FSV4      -----------------
A0A3D3DET9      -----------------
A0A355SVK9      -----------------
A0A2E5D7I3      -----------------
A0A2V5NYE2      -----------------
A0A2V6FIP7      -----------------
A0A353DI77      -----------------
A0A1V6GCZ3      -----------------
A0A3C1UJT2      -----------------
A0A2S7U0Z3      -----------------
A0A5E6MKA7      -----------------
A0A6B3L936      -----------------
A0A2N8IR72      -----------------
A0A2N8IV96      -----------------
R7E1V8          -----------------
A0A2E0R252      -----------------
A0A3E1EF48      -----------------
A0A2A2PVG8      -----------------
A0A2E0R421      -----------------
A0A2E5EJ69      -----------------
A0A2G4I5Z5      -----------------
A0A4P5QQV6      -----------------
A0A2E7ALI1      -----------------
A0A178IDB9      -----------------
A0A290QD69      -----------------
A0A2E7VDS1      -----------------
A0A7C8D3W3      -----------------
A0A178IFJ2      -----------------
A0A357FSP9      -----------------
A0A1T4WWY4      -----------------
A0A3D3LEQ6      -----------------
A0A3D3NW23      -----------------
A0A2A2R174      -----------------
A0A1H2DTI1      -----------------
A0A1H1MGC9      -----------------
A0A1V5L462      -----------------
A0A3D3LGD3      -----------------
A0A350ARX4      -----------------
B5JIS2          -----------------
A0A6N6ZC77      -----------------
A0A7C5H7K5      -----------------
A0A538NJ59      -----------------
A0A2A2R3V9      -----------------
A0A3C1VFY9      -----------------
A0A2V2SMX4      -----------------
A0A522AC27      -----------------
A0A6M1RFD0      -----------------
A0A7C3HXH0      -----------------
A0A1H2GQN6      -----------------
A0A512M3Y3      -----------------
A0A4P5R5J1      -----------------
A0A4P5YK43      -----------------
A0A2A2RPW6      -----------------
B1ZT68          -----------------
W0J7C2          -----------------
B4D1I7          -----------------
A0A353F286      -----------------
A0A354FSA6      -----------------
A0A3B9GA54      -----------------
A0A520LEH8      -----------------
A0A6B2M0T8      -----------------
A0A2D7B7R6      -----------------
A0A2E5K4P7      -----------------
A0A2V6F9Q9      -----------------
A0A2V6NZZ3      -----------------
A0A2V6EBU2      -----------------
A0A2V6EY06      -----------------
A0A2V6ME53      -----------------
A0A538NUU0      -----------------
A0A2V6NIJ1      -----------------
A0A2V6C292      -----------------
A0A2V6D2X0      -----------------
A0A2V5ZUK1      -----------------
A0A2V5XFN9      -----------------
A0A2V6EZC8      -----------------
A0A2V6I7Z5      -----------------
A0A3B9LCP2      -----------------
A0A3C0R669      -----------------
A0A2V6EID2      -----------------
A0A2V6MHB0      -----------------
A0A2W5YWL9      -----------------
A0A2V5NH62      -----------------
A0A2W6A620      -----------------
A0A2V5PIJ4      -----------------
A0A2V6K2G8      -----------------
A0A2V5W206      -----------------
A0A2V6MW77      -----------------
A0A6N4WVA3      -----------------
A0A0R2XPB1      -----------------
A0A348NQP1      -----------------
A0A357FV58      -----------------
A0A2G4GZN8      -----------------
A0A348NPT1      -----------------
A0A2E1KV60      -----------------
A0A2D7F4D9      -----------------
A0A3R7RBR8      -----------------
A0A2E0NH28      -----------------
A0A368BGT4      -----------------
A0A317ZP96      -----------------
A0A350AS32      -----------------
A0A6N6PLV8      -----------------
A0A290QE54      -----------------
A0A1H1SWX2      -----------------
A0A1D8AZK8      -----------------
A0A4Q1C9I5      -----------------
A0A2E0V4K6      -----------------
A0A1G3ZL71      -----------------
A0A556QP09      -----------------
A0A2T6DX88      -----------------
A0A2T6CWI7      -----------------
A0A3E1E5C8      -----------------
B1ZZ74          -----------------
A0A2E6NAH3      -----------------
A0A2A5VZA5      -----------------
A0A424R295      -----------------
B4CZV9          -----------------
A0A0E3YV65      -----------------
W0J900          -----------------
A0A3B9FM17      -----------------
A0A2D7WMI4      -----------------
A0A2D6VHX5      -----------------
A0A2D8I214      -----------------
A0A1Z8VL41      -----------------
A0A2E6TNA4      -----------------
A0A1Z8RG47      -----------------
A0A1Z8RJJ5      -----------------
A0A2D7V631      -----------------
A0A354RA24      -----------------
A0A2E9RV62      -----------------
A0A2E4AY96      -----------------
A0A3B9B9P4      -----------------
A0A2D5Y6N6      -----------------
A0A2E7HSS8      -----------------
A0A2D8VCK3      -----------------
A0A350QVY4      -----------------
A0A2E4ZYR7      -----------------
A0A2E6TCV1      -----------------
R7E4L8          -----------------
A0A4Q3BVY2      -----------------
A0A4P6PCA7      -----------------
A0A2T6DSN5      -----------------
A0A317ZIW7      -----------------
A0A7C4PPT4      -----------------
A0A7C4QZX4      -----------------
A0A3D4HHL8      -----------------
A0A366HV03      -----------------
A0A6G6K911      -----------------
A0A5R8KAF2      -----------------
A0A7C4LRZ6      -----------------
A0A351MR11      -----------------
A0A388PR45      -----------------
A0A388QR61      -----------------
A0A4P5YHI0      -----------------
A0A2A2RS01      -----------------
A0A2A2Y1A7      -----------------
A0A388PDH9      -----------------
A0A2G4H1E7      -----------------
A0A2G4GZA6      -----------------
A0A388P514      -----------------
A0A2A2YG59      -----------------
A0A2G4F7D5      -----------------
A0A2V2SDN0      -----------------
A0A1V6GL40      -----------------
A0A2V5X6Z6      -----------------
A0A2V5VGZ7      -----------------
A0A2V5U130      -----------------
A0A2V6C237      -----------------
A0A3R8L982      -----------------
A0A6N6QBS9      -----------------
A0A2E7HPU9      -----------------
D5EML0          -----------------
A0A7C4PPJ4      -----------------
A0A3C1C1M3      -----------------
A0A2S7U4L6      -----------------
A0A2E9EYJ1      -----------------
A0A258AXR6      -----------------
A0A3D3NZQ6      -----------------
A0A1T4WVZ9      -----------------
A0A4R7SSI6      -----------------
A0A4P6PD26      -----------------
A0A1Z8SVB5      -----------------
A0A2V5W3Y0      -----------------
                                 

© 1998-2021Legal notice