BYKdb

Dataset for cluster tadcd of phylum unclassified-candidate-division-zixibacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S7WF54      MRQAPSDEHYQIPPPGYYGSPFQEEREVNLRDYWKVIRKRQWTIIAFFLIVVVTTAVGTF
A0A353BHI8      ----------------MDQTAENKAKETNLYEIIDLLWRRKTLISVCLLGVLVPIAVATF
A0A419FEM7      -------------------MTEQHEGSVKLGDYLRIILRGRWIILLCFLVVLGTTTFFTY
A0A0S8KBS7      -------------------MAELDARPVALNEYLRTLYRGRWIIVLAFFTTVIAAAIFSF
A0A7C5B5T4      ----------------------MNTPQPTLQHYLAILLRRRWLIISCFFLILAGTVLITL
T0LIM2          ----------------------MEKKEKTWQEYLFILFRRRWVWLMAFFSVIAVTVLLTF
                                                    : . .      ::  :   .. : 

A0A0S7WF54      TMSPIYRGTATIQINKENPQIVDFKEIFAVNTMDRDYYQTQYKLLESRNLARRVIDLLGL
A0A353BHI8      TMHPVYEAQTTIIFE-QSREPIPAFD-LSENITRKTYIVNQIEEIKSRSLSEEVARRLDS
A0A419FEM7      RMEPVYQASTSIMIEDKGRLEQSVFG-FSNLLASQTTIANQVEVIKSRTLAERVIHALEA
A0A0S8KBS7      VAQPVYEAKTTLMIEKDGGMQESLFG-VSGFIERETAINNQVEILKSRSLAEKVLKRLLD
A0A7C5B5T4      TTAPVYESSTKIMLDEERGIKKEVFE-ISSFVKQETMLKNQVEILRSRNLTEKVLEALLD
T0LIM2          TAKPVYEAKTSILIDVEERMQKAIFDMMSPLGQREAKIKNQVEILKSRTLALGVLEFVSH
                   *:* . :.: :: .          .:          .* : : **.*:  *   :  

A0A0S7WF54      AEHPEFLSKPQSPLQRWRSRITNSLAALFSSSDGDSSENDRESLLISGFLNRVKIEPMRN
A0A353BHI8      TLARD----------------------LAPETAKTEPIGSQLGYIAGKIKSNISVEPVRE
A0A419FEM7      SQYRDNL--------------------KIMADYDRHDRPVNFNGKVKLLRESITVEPVKE
A0A0S8KBS7      APEKN----------------------R-FALFKAISQGASDDDAVQALRDNLTIVPLRD
A0A7C5B5T4      SDYRS----------------------EILAWIKTKQIPHDKEELLEQLAKRTKISPVRE
T0LIM2          SEFSP----------------------FFEKLASDLQNHKKLEQKLAYLKKNLKIQPVRG
                :                                               : .  .: *:. 

A0A0S7WF54      TRLVRIHFDSHYPELSSLVPNTLATQYIQQNLETRFVATEQAKEWLTGQLEVLKAKVERA
A0A353BHI8      SDVLLVKFQGPSPRLAAEAANLVTAVLMDRNASVKREQASSTRKFIEDQMPTVEANLNKA
A0A419FEM7      TDIIVLKVTANSAFESAYLANEIARQFFGQNLEYSKGEVGEVRRFLESQLDSVRMKLSES
A0A0S8KBS7      TDIIEIKYQAGTPWEASYIANAYAAQYYQRDLEVSRGEITEVRKFLEEQLNTIQGDLQLS
A0A7C5B5T4      TDIIEIKAQASHPHLAAFMANTIADKYYQQSLSASKGEITEVREFLENQLESVQKELKLS
T0LIM2          TDVIELKTTASDPVMASFLANAFADQYFQQSLKFTKGEISEVRQFLEVQLDNIQKELKIS
                : :: ::  .  .  ::  .*  :     .. .       ... ::  *:  :  .:. :

A0A0S7WF54      DEALQAFASKHGIVSLEEKENITMQRLTELNEALTKAESDRIAK----EALYKQASEQDY
A0A353BHI8      EEALKGFKTQNQVVTLSNEASEILSRITAVDVDYNRAVTDNQTLQRRLEAIYEQLRAQGG
A0A419FEM7      EEQLKLYKESHKLVALDEETEKLVEQTATFRAHLNEAEAELQENVLALQDLRNKFAESKS
A0A0S8KBS7      EEQLRRFKENEKVVALSEETEALVQQLAEFEGLYNEAETSRDAAQKRLDYMKRELAKTKS
A0A7C5B5T4      EEALKNYQKLEEVAALSEETKELVKQLATFEGMYKEAQTEYEVYLRRLESLKSQLSESKK
T0LIM2          EEALKAYKEKEKVTALPDETSELVKKLVEFDGLYNEAKTDLESAVKRMEYMQSQLDTRRS
                :* *. :     :.:* :: .  :.. . .    . * :.        : :  :      

A0A0S7WF54      DSLPPIL--ENTLIQDLKQAYIQLDAQYMRL-GETFKPEYPEMVRLKNQMDTIQRRLDAE
A0A353BHI8      DTVGAFT--SGSLADGLRQSLIELQMEVTQLSVKGYGQDHPQIVRLNSQIGSTKEKLNRE
A0A419FEM7      TLVEDVSRISSPLITELQTRIAEKQALIANLIAKSSPGYEIVVKDVEREIDEAKKALIEE
A0A0S8KBS7      TMVEDIIQVSSPLIQDLRAEIANLEAIRAGFIARGYTEDFDKMVEIRSQIEKTKAKMKEE
A0A7C5B5T4      HLVDNVASISTPMIASLRQKLTELETLRAGYLAQGFSPEHPKLKEVGQRLTEIKQKLAEE
T0LIM2          KLVQDITTVSSPLIIQLRNEIANLEAVKASYIAQGFSVNHPKIVEINQRIEDTKKSLITE
                  :  .   . .:   *.    : :                 :  :   :   :  :  *

A0A0S7WF54      AGRIIAG--------------------IRSDYQASLRRESLLRETFQRQKAKAMQMKQRA
A0A353BHI8      LQAITSGK--SVTPMPQMASLMAQIPPLQIELATTQARERALKRILDQYEASMGRLPYKE
A0A419FEM7      AHKIANSGISSIDPLKTSQELFDQILRADINIKSLTARTEALGTVVNSYESQLEALPEKN
A0A0S8KBS7      ATKVVSRDLAPENPLLYSQDLIDRILSLQIEVSSLNAKARALDDVVQLYEEKLQALPEKS
A0A7C5B5T4      AGRVLSSEYLPEDPLAYSQELVTQILQLEIELESRKARQQILAKIVSEYNAKMNSLPDKS
T0LIM2          SSKIVSSELLSGDPLALSTDLVNKILLIEIEIHSLSAKAKALGTVVQTYAAQLNSLPEKS
                   :                          :  :   .   *   ..    .   :  . 

A0A0S7WF54      IQYNILKREADTNRDLYNALLQRMKEAGVSAAITASNIQIVDGAELPTEPFKPNKRLNLL
A0A353BHI8      LQLARLERAKEVGENLYKLLMEKNEEAKITEAGKLGNLRVIDPALPPGSPIKPRKALNLA
A0A419FEM7      LELVRLMRDAELNEKIFLMRSEKYEESRIAEAGKTANVRIIDPAVPPPKPIRPNRQLNVF
A0A0S8KBS7      LQLARLERTAKVNENVYLMMREKWEEARITEAGQIGMVQVIDSAKEPKWPIRPRKKLNLL
A0A7C5B5T4      LMLARLERGAKVNENIFLMLKEKYEEAKIQEAGQIGMLRIVDPAYPAPEPIKPKKKLNLL
T0LIM2          LQLARLERQAKVSENIFMMLKEKYEEARIKEAGQIGSVRIIDQAYPPLSPIKPKKKLNLI
                :    * *  . . .::    :. :*: :  *   . :.::* *  .  *:.*.. **: 

A0A0S7WF54      LATVVGLFLGFGLAFFFEYLDNTVKTPEDVEQLIQLPSFGMIPEIAYERRRRL-------
A0A353BHI8      IGLIVGLTLGLVLAFFLESLDNSVKTPEELEHNFGLPVLGLIPVIQSQESGRKRKRNGM-
A0A419FEM7      LAIFFGLGLGVAISFAIELLDGSVRTVEDLEK-LKVSVLGAIPTIDPEEIARRMKRHGHK
A0A0S8KBS7      LGMIIGLGLGIGATLLMDYLDDSLKDIEEVERHTGLRVLGSIPQIKVNEKKKTLRKTAGS
A0A7C5B5T4      GGAFLGIFLGWGLALLKEKMDTSVKTMEELEQ-IGHTVLANIPVIRGKNGSRSRKSEETL
T0LIM2          LGALLGILFATTMILSVEAFDTTVKTVPEIER-AGIPVLGTIPLIKENNKVWSGNGKHRS
                 . ..*: :.    :  : :* ::.   ::*.      :. ** *  :   .        

A0A0S7WF54      ---DEGNSYPVELVTFAHPKSMLSEAYRNVRTSILLSFSEKPPKRIAISSPNPAEGKTTT
A0A353BHI8      ---DEVERISSTLVTRYTPRSPISEAYRGMRTNIQFSRIDTPLKTVVITSSAPSEGKSTT
A0A419FEM7      LSPEDRARLTSKLITNFSPKSPVSEAYRSLRTNILFANLDRQAKTLVVSSSATKEGKSTT
A0A0S8KBS7      SEEQEIITIASRLVTHLEPRSPVSEAYRSFRTNIQFSQFDRPMKTLLVTSAGPGEGKSTT
A0A7C5B5T4      SQEQQAKQIASSLVTHFEPKSAVSEAYRTFRTNIQFAQLDKPVKTLLVTSPGPSEGKSTT
T0LIM2          KIESEELKISSNLVTHLDPKSAVSEAYRTFRTNLQFTQADTPLKTILVTSPGPGEGKSTT
                   .:    .  *:*   *.* :***** .**.: ::  :   * : ::*. . ***:**

A0A0S7WF54      AINTAIALSQTGARVLVVDSDMRKPRVHSILGEENGAGLSNFLSGNTELKSIIKKSDIPN
A0A353BHI8      VANLAITTALMGVKTLLVDADLRRPVVHSLFGLEREPGMINVLAEKLPLEKVVKPSGIES
A0A419FEM7      VANLAITMAQMGSRVLIVDADLRRPTMHTLFKIERQIGLSNALLGNYTLDEVIKPTGIEN
A0A0S8KBS7      VANLAITMAQMGTKTLLVDADLRRPVLDSIFKCKRSLGLTDILLGNNHMDAALHELEVKN
A0A7C5B5T4      ISNLAITLAQQEIKTVLIDADLRKPVLHSVFGLSREKGLTHYLMGKAALEQVVRPTRIEN
T0LIM2          ISNLAITLSQSGFKILVVDTDLRKPVLHGIFGVPKEPGVVHYLSGKADLKSIIKPTPVEN
                  * **: :    . :::*:*:*.* :  ::   .  *:   *  :  :.  :.   : .

A0A0S7WF54      LYYIPAGPVPPNPSELLGSKLFKATMQFLGEKFDHIVFDSPPVLGFADATILSASVDGII
A0A353BHI8      LDILTCGAIPPNPSELLNTQRMRDLIALLSSRYDLVLFDSPPVLTVTDTCVLGSRVEGVV
A0A419FEM7      LDIITAGDIPPNPSELLSSNAMRKTLALLQQRYDMILLDSPPVIAVTDAAVLSTRTDAVL
A0A0S8KBS7      LSLLCCGTLPPNPAELLSSQAMRDLLEQLKKNFEVILFDSPPVVAVTDAAVLGAHTDGVV
A0A7C5B5T4      LSLISCGALPPNPAELLGSQKLKELLEKLKTKFEMVLFDSPPAMAVTDAVVLSTLLDGVV
T0LIM2          IFLIPAGIIPPNPNELIGSQKFKNMVEELKGEFDFVLFDSPPMMAVADATVLSTILDGVI
                :  : .* :**** **:.:: :.  :  *   :: :::**** : .:*: :*.:  :.::

A0A0S7WF54      LVVQGGKTPRETLQRAKDILHQVNAKILGVVVNRVDIGR--SDYGYYYYRYHYYYGKEGK
A0A353BHI8      LVVNSHATDRRALNRAKILLGNVKANVLGAVLNRIEISTLVGSYDYYYYHYYYYFDDEGK
A0A419FEM7      LVVSSGYVTRKEVDRAIQLLGNVRANLIGVLLNGLDVKRIYGSYYYYYHYYQYYYYYGTK
A0A0S8KBS7      LVISSGETTRKAENRAKTLLNNVRAQILGAVLNNVRAEGRYGSYYHYYYYHY--YESGKK
A0A7C5B5T4      LVVSSGQTNRNSLRYGTSALKNVGANLLGVVLNKIKMESLYGSYHYYHYYHYRAYESEKK
T0LIM2          LVISAGQSHFANMEKVASSLKGLKANLLGGVLNKLKFEKIYGGYPYYYYYHHY-YEDGEK
                **:..              *  : *:::* ::* :      ..* :*:: :   :    *

A0A0S7WF54      RKKLPYTSDRESNSQQI--------
A0A353BHI8      KKMHRRRKLWDKFKRGRHRA-----
A0A419FEM7      KQRRTSREADLALEDNGPREHQQTG
A0A0S8KBS7      GKKKKKLKRAPH-------------
A0A7C5B5T4      SEVTA--------------------
T0LIM2          KATPS--------------------
                                         

© 1998-2021Legal notice