BYKdb

Dataset for cluster orphancd of phylum unclassified-candidate-division-zixibacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1CJ11      ---------------MGRRTPGALIDIFTLESPFA---TDIRRVLHQITRAGKEQE--VK
A0A1F4YLC6      -------MKKSLIPLKVTQEDFDRGKSYEKDGKELLFLEQFKALRAKFEYQVDIHK--YK
A0A660Q066      -----------------MRDYVPVIDCFSQESPVA---TELRRLLSSMKKLEGQSE--LK
A0A2M7WK57      ---------------MKKQNKKSIIEYYDRESPEA---TEIRRLYSHIARVPATDGEWIR
A0A1W9S6P8      ------------------MKIESIASFYDMESPEA---TEFRRLYSNIKK-SNNDQ--LK
A0A660PI23      ------------------MKIESIASFYDMESPEA---TEFRRLYSNIKK-SNNDQ--LK
A0A496PTD7      ----------------MALRPVSILDFYSPELPFA---TEFRRLLQRIDNSSKKLD--RK
A0A660PQY1      ----------------MAKKTLSIDQFYSPDAPFA---NEFRRLLVKIKKEGANQE--VK
A0A6I7LZR0      MRFLISRKKAIEEDLLDTKNGLNXIXYYDAESPEA---SEFRRLLHNINGNLSEGG--RK
A0A660PRX7      --------------MTGKSNLISILDIFNPESPES---TEFRRILHNLDKSKKGGD--KQ
A0A2N1P8H2      --------------MTSKSTNLSIIEYFDPESAES---TEFRRVLYNLNGIQSGGN--KK
A0A660Q2E5      ------------MIVVKKDKNLSLIDYFDPESPES---TEFRRVLYNLNGIPGGGA--KK
A0A7C0W9K1      --------------MVKKDKNLSLIDYFDPESPES---TEFRRVLYNLNGIPGGGA--KK
A0A523WSI3      ------MTEKKRKEVKAKGQKLWIKELARGETAAT---VESRRLFFNLNNLRHQSS--SK
A0A1F4X8I1      ----------MKKNSNHPRYPKTILELYDKESPAA---TEFRRLYSNLRHMDGFAD--LK
A0A7C5F759      ----------MGRNPEPHRFQKTILELYEKESPAA---TEFRRLYSNLRHLNGFGE--IK
                                              :        : . :   :           .

A0A3M1CJ11      TVLFTSATTGEGKSTLTALSAITAAR-KGKRVLIVDSDLRRPVQHTLFQLPREQGVVEGI
A0A1F4YLC6      VVAVTSAIAEEGKTLTSANLATNLASVGRKKVLLVDTDMRKSDIARMFDASPKPGLKEFL
A0A660Q066      SILVTSATESEGKSTICSLLSITSAR-RGYKTLLVDCDLRRPMIHAMFALERRHGIVEVL
A0A2M7WK57      SLAVTSSTLGEGKSTLASMLAISIADHARKNVLLVDSDFRRPKIHEMFNLELGRGFSDIL
A0A1W9S6P8      SVLVTSSTIEEGKSLISSFLAITMAEAKEGKVLLLDADLRRPMINVLFKLPLEKGLSDIL
A0A660PI23      SVLVTSSTIEEGKSLISSFLAITMAEAKEGKVLLLDADLRRPMINVLFKLPLEKGLSDIL
A0A496PTD7      AILITSAVLAEGKSTICSFLALSAARQKKMKTLLIDADLRRPSIHKFFAMQRENGLVEVL
A0A660PQY1      SILFTSAMLSEGKSTICSLLGLTSARQNGLKTLIVDSDLRRPSIHKFFHLERTKGLTDIL
A0A6I7LZR0      SLLVTSAMTSEGKSIISTFIALTSARHKNKKTLLIDFDLRRPRIHRLFNLPREKGVSEIL
A0A660PRX7      VILITSATLSEGKSLTSSFLAMTSATYKNNKTLLIDFDLRRPTIHKLFGVNRRGGISEIM
A0A2N1P8H2      AVLITSAMLSEGKSIISAYLAMTSARFKNRKTLLVDFDLRRPMVHKLFDVPLENGISDIL
A0A660Q2E5      AVLVTSAMLSEGKSVISSYLALTSAYFKSRKTLLMDFDLRRPMIHNLFSVPLANGISDIL
A0A7C0W9K1      AVLVTSAMLSEGKSVISSYLALTSAYFKSRKTLLMDFDLRRPMIHKLFSVPLANGISDIL
A0A523WSI3      EVLVTSATVGEGKSTVAALLALAAVENTEEEVLLVDADLRRPIIHSLFGLKRDGGFKELL
A0A1F4X8I1      SILVTSATSEEGKTLVAGFLAITIAHYHDCKTLLIDSDLRRPVVHQLFDLESKKGLAEVL
A0A7C5F759      SLLVTSATSEEGKSLVASFLAITISHYHDCKTLLLDTDMRRPVVHQLFNLEQQPGLAEVL
                 : .**:   ***:      .          .*::* *:*..    :*      *. : :

A0A3M1CJ11      LEGGQLRSFV-KKTKLDKLDLLTSGRMTSAPAEVFDAARIVELLEELKFYYDLILIDCAP
A0A1F4YLC6      AGSVPLEKIILSSNSVRGLSFISGGEKGTTPPDLLAGETFRSFLQEMRSKFDVVLLDTPP
A0A660Q066      SEGVAIKSVI-KKTSLDNLDVVTSGKVTSQPTELFDSRAIEGLIRELKFYYDFIFVDTPP
A0A2M7WK57      AGDQSGETAV-KGTPFTNLKIITAGRRHSNLSKILDRVRLKEFFDKAKHHFDYIILDCPP
A0A1W9S6P8      EKKCKVGKTI-KDTSISGLKIITAGRISESPTLIFNQENIRKVTEELKFYFDFIIIDAPP
A0A660PI23      EKKCKVGKTI-KDTSISGLKIITAGRISESPTLIFNQENIRKVTEELKFYFDFIIIDAPP
A0A496PTD7      SGDLGAAEAV-KHTNLENLHIITAGRFIHEPSELFDAEAIGRIVNEMKFYYDLVLVDCAP
A0A660PQY1      VDGFDTGEAI-KKTKVEKLDVITSGTNYEHPAEIFDAESIGYMLDELKFYYDLILVDSAP
A0A6I7LZR0      EEGVPVRNLI-KPTSLDKLDILTAGKPIPNPSDLINGPAVHKIIEEMKFYYDLIVIDTSP
A0A660PRX7      LGGLAPKKAV-KPTNLDKLDLLTAGKSTGNISELIKGPNVHRIIEEMKFYYDTIIVDSPP
A0A2N1P8H2      AKGIASRNVI-KKTAIDNLDLLTAGKIMPNPSELFNGPSIHRIIEEMKFYYELILVDSPP
A0A660Q2E5      AKGVASRNMI-KKTSNDNLDLLTAGQTMPNPSELFNGPAIHRIIEEMKFYYDLILVDSPP
A0A7C0W9K1      AKGVASRNMI-KKTSNDNLDLLTAGQTMPNPSELFNGPAIHRIIEEMKFYYDLILVDSPP
A0A523WSI3      SGKIDLELAL-KDSFQPNLKIITSGSGREFVWQLLEPAKLRGLFRSLRSRFSYLIVDTPP
A0A1F4X8I1      EGKLPLKDCL-RKTGIGNLQVLTAGNGEKTPTELLDSPRLTEVLEEAKFYFDLIVVDSAP
A0A7C5F759      EGRKVLKECF-QKTPLSNLQVLTSGEPHRSATELLDSPRLTEVFEEMKFYFDLIVVDSAP
                         .   .    * .::.*        ::    .  .  . .  :. :.:* .*

A0A3M1CJ11      LLPVSDPMMLAPDVDGVVMVVKAGETDRELVKRGVQILKSADARIIGVVLNNMKRALPHY
A0A1F4YLC6      ILPVADTMSLRDQVDGFILIFRIGLTPYVMLQQALEEIDKN--KIIGVVLNGVEMHKYKY
A0A660Q066      VIPVSDPMLLAQELDGTLFVVRAGATAREVLKRAADIMTSNNVNLLGAVLNDVKGNLPSY
A0A2M7WK57      VIPVSDIIDLSPEIDGVMMVIKAGQTPKEVTKRAVNLLQNYGVKIVGLVLNDVERVLPYY
A0A1W9S6P8      VIPVSDPLLIASEVDGVLLVIKAGTTKKEVVKRTTNLLINSNIKILGAVINDFDSVLPFY
A0A660PI23      VIPVSDPLLIASEVDGVLLVIKAGTTKKEVVKRTTNLLINSNIKILGAVINDFDSVLPFY
A0A496PTD7      VLPVSDPMLLASKLDAIILVIKAGETQKEVVERAVDILGSNGSRILGVVLNNMNNSLPYY
A0A660PQY1      LMPVSDPLLLSDKTDKVILVVKAGSTDREVVKQAKGILNNSNDKILGVILNNLNNSLPYY
A0A6I7LZR0      VIPVSDPMLLIEEVDAALLVVKAGVTPKGVVSRACGLLAPNRKKLLGVVINNLESTLPYY
A0A660PRX7      LIPVMDTLIFVEEFDAVLLVIKAGVTQKEIVDRARNLLANHNGKLVGVIMNNLKKSLPYY
A0A2N1P8H2      LLPVMDPMLLLEELDGVILVIKAGSTQKEIVARARDLLASQKNKVAGVVINNLDQTLPYH
A0A660Q2E5      LLPVMDPMILLEELDGAILVIKAGSTQRDIVARARDLLEPQKDKIAGVVINNLDQTLPYH
A0A7C0W9K1      LLPVMDPMILLEELDGAILVIKAGSTQRDIVARARDLLEPQKDKIAGVVINNLDQTLPYH
A0A523WSI3      VIPVSDVLSLASELERVLLVVKAGETPREVVKRATDLLKEAGTQILGVVLNNARQVLPYY
A0A1F4X8I1      IIPVSDVMILMPEVEGALIVVKAGATPREVVKRAADLVQNAGGKILGIVMNNLEGVLPYY
A0A7C5F759      VIPVSDVMVLLPEVEATLMVVKAGATPREVVKRAAELVQNSGGKIVGMVLNNLEGVLPYY
                ::** * : :  . :  :::.. * *   :  .    :     .: * ::*.       :

A0A3M1CJ11      YNYEYYDGGYY-------------------------------------------------
A0A1F4YLC6      YQRYYGDYYHKKPE----------------------------------------------
A0A660Q066      YDSSNYNYDYKPSAEDRKIDRKENQSYSLP----------KPVQKKKNNQGSNSTPISGK
A0A2M7WK57      YDYSYYHYRPTKPETKE-----------------------KPIAKAREVKV---------
A0A1W9S6P8      YSSKYYGYKYYHKKAGGKGE----------------------------------------
A0A660PI23      YSSKYYGYKYYHKKAGGKGE----------------------------------------
A0A496PTD7      YDYKYYNYNSSTDKSRHKRKARQISSNSQHSHRKNSAKNPEPKNNIAERSS---------
A0A660PQY1      YDYQYYGYDYSPSKGTADSQVKL--NPDKINKRKNRKFNKKPDSNQTKNIS---------
A0A6I7LZR0      YNYNYYGYHY------------------------------KPSKH---------------
A0A660PRX7      YDYSYYDYNY------------------------------KSSEE---------------
A0A2N1P8H2      YNYDYYGYHY------------------------------RPVTKK--------------
A0A660Q2E5      YNYDYYGYNY------------------------------KPIQKK--------------
A0A7C0W9K1      YNYDYYGYNY------------------------------KPIQKK--------------
A0A523WSI3      YNYSYYHYHY-----REPTLQKA-----------------SPLELSSR------------
A0A1F4X8I1      YNYNYYGYEYGYGGKRDSRTGKL-----------------TPSRQKPRSES---------
A0A7C5F759      YNYNYYGYHYGYSGKKSSAD--------------------KPDRKTEKRIQ---------
                *.                                                          

A0A3M1CJ11      ----
A0A1F4YLC6      ----
A0A660Q066      QLDR
A0A2M7WK57      ----
A0A1W9S6P8      ----
A0A660PI23      ----
A0A496PTD7      ----
A0A660PQY1      ----
A0A6I7LZR0      ----
A0A660PRX7      ----
A0A2N1P8H2      ----
A0A660Q2E5      ----
A0A7C0W9K1      ----
A0A523WSI3      ----
A0A1F4X8I1      ----
A0A7C5F759      ----
                    

© 1998-2021Legal notice