BYKdb

Dataset for cluster tadcd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

221 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5S9IJB5      ------------------------------------------------------------
A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------MPGQTVGPVSIKREYRCSPQDRPDIPPIFTGFTYSQALPCFT
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      MPLYIDSQPTARLSVLSSILQALQRAQIPRMLCVSFLSRMTLSPWNIRREPVRRYFGTGY
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------MRRRGRGSQVFKKVGARNEPTGQE
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      ------------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      ------------------------------------------------------------
A0A5C5ZZN3      ------------------------------------------------------------
A0A5C5XS91      ------------------------------------------------------------
A0A5C6C4E6      ------------------------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      -------------------------------------------------------MSSDF
A0A356KTN1      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A2E3GWC6      --------------------------------------------------MPADASRSGF
F0SLB0          --------------------------------------------------MPADAGRSGF
A0A3L7NDH9      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      -------------------------------------------------------MSNPI
A0A7C4Z5R7      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      --------------------------------MSAVRTLSRLTECRGNGRVLCGALFRLF
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A286RD13      -----------------------------------------------------------M
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------MSLALPPSGSEQ
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      --------------------------------------------------MNEDQKSKQS
A0A7C5R0U3      -------------------------------------------------MND--------
A0A517TY85      --------------------------------------------------MNLPPEPTRE
A0A5B9QEI7      -------------------------------------------------MNNSPNPPEHE
F0SI78          -----------------------------------------------------------M
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7C2KUQ9      -----------------------------------------------MSLMAENEGSGES
A0A7C5BZF0      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
                                                                            

A0A5S9IJB5      ------------------------------------------------MDKQEFNIHQY-
A0A5S9IPR9      ------------------------MNKSEMNLPAFATSNPMLSSVTEEFRPEVDSEMSL-
A0A533Q9U4      ------------------------------------------MLPFKGDESEEIHILDY-
A0A533Q6B7      ---------------------------------MIPVDQRKPQSHTNRRENTEVHLLDY-
A0A1U9NNE1      --------------------------MNQIDKYYESYLGSYAQEGTKQESENTLTLFKI-
A0A2G2JCA2      ------------------------------------MNMITNSTPNYRPAKPPAEKKPFI
A0A1G2XVR0      ---------------------------MLTESEIQP---------------KQLDIRKY-
A0A1G3B0P0      ---------------------------MLTESEIQP---------------KQLDIRKY-
A0A1E3X4X0      ---------------------------MLNNK-------------------EQTHLTDY-
A0A286U4B3      ---------------------------MNNDSFLNQTQDPSNYYSGKTSSLDEIHLRDY-
A0A5C6DDS2      ---------------------------MKNDSYQNQTED--SFYNGETAFLEEINLRDY-
A0A2E3GW02      ----MKIRLSPEGEFSNVTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPPSSESGFDI-
A0A5B9QNZ7      DYFSGLNETDRGPVTTGTIVPPPAVDSPPPGRFPWQSYANESIPMSHEPTTSPEPVLDL-
A0A1Z8N7H5      ------MHLIDLLILGLALRRESRVSNEEGSLMSVETDNETYDAPLTNAAGAIHDGFQF-
A0A1G2YPI3      ------------METNNEFGQTEIVGHNMIDQQENNGHAGLANSHVGMPLPTQMMSESL-
A0A1U7CZ81      -----MDTTDSNDSLLPARLPSSSSSHLPAMSAAN--RHAYDL--TTVSSSVQISPQGV-
A0A142YNY8      -----MDTSDRHDSTLPAR-SHTPSSGVPARAATNFGGGSREL--AVGASTMQVNPTSI-
A0A1U7GLS6      -----MDTSDRPDSMLPAR-PTPPAPPVPSRGPASFGGGPRDLVPTSAAPALQVDPVSI-
A0A532UIN2      SDSISALIYAPKTFSEMTDQNRRRTRGSDVISQYENNRTFARDALQGGPRSAGITSESL-
A0A0S8KNX5      --------------------------MSDLEKYHDQVVGQQVVNFQIPPEPGRVGTSNL-
A0A3D3UVZ8      --------------------------MNELEKYHSQATGQEIVNLQIPPEQESEATSDL-
A0A517NFU9      ------------------------------MESSVSESASK----------ATVIEINL-
A0A5C5YWH4      ------------------------------MDSPTTESASK----------APVIEINL-
A0A3D2TNK4      --------------------MTDLNTSADIQSNFEASAESE----------LVPTIMRL-
A0A7C1Y4F0      ---------------------------------MDNGTIGNGSANTVLSEPDGPPQESL-
A0A6I0ENW6      --MFEINEDAPEGGQDRGSALIPAGGGVSTLARGGESGGYGLASYGPASGPAPHRGFSL-
A0A6L3A0B7      VNMFEINEDAPEGGQDRGSALIPAGGGVSTLARGGESGGYGLASYGPASGPAPHRGFSL-
A0A0J1B4A0      --------------MLFADQSIEFLKIMIRSNPSADDVNGD----------ELDIDLDL-
A0A142WSB9      --------------------------MTQPNPASANGNELAFAPPGLQASSLPGRSIDL-
M5SZR3          ---------------------------MNSNRKLVSRNANS----------QDEQLLDL-
M5TW92          ---------------------------MNSNRKLVSRNANS----------QDEQLLDL-
A0A2S8FKY2      ------------------MSNGNLVISSEKDRRRQGTNVPGTVVANRPQEEDGMQFGQV-
A0A517N8P6      -------------------------------MQPASHTQTSRSDIGMAPPMSGPSDVSV-
A0A432MJP4      ---------------------MRLPDPQGSEADSTMSDRPLASDTNPSAHLGAAELKHL-
M5UQ35          ------------------------------MTNQEDDIDGD----------DFELDLDV-
A0A0S8FY64      -------------------------------------MEDTLAAEAYPDEVREFDIRHH-
A0A1N6KFT7      --------------------------------MAIQQSITGPGSEGPPSRTLQNDLVAL-
L0DFG4          --------------------------------MANQQSITGSVSEGYPSRTLQNDLIAL-
A0A5C5XXG1      --------------------MRLVVDVVGVDDSSESPAVAESRIPPAIDTPSSEGVVES-
A0A7C7YUM8      --------------------MTASTTTEVHAESRHGYGQSPSNGAAGMFADPTVRIGEL-
A0A7C2AHI6      -------------------------------MSEHGYGGHGPEEP----REESLRLGDL-
A0A518BJJ1      ---------------------------------MFRHDQNTAGGV----RDAVPELRAI-
A0A518D182      --------------------------------MPLTHEGTDRNGS----PDPAAGLRHV-
A0A5C5WTY6      MNSSNGPSSKGMTSRLSKVEAAKAHYADESPATAPQSRRGASYYGYGYEQPKWGETINP-
A0A5C5Y033      --------------------MTGSTSVTQHQPNGRGGSTGSPRSGLGLPLRNSVEAINL-
A0A5C6G1Y2      --------------------MTGSTSVTQHQPNRRGGSTGSPRSGLGLPLRNSVEAINL-
A0A354PDV6      ------------------------MNREITSTGTDRQFNLN----------DQELSIDI-
A0A5C6FZ02      ----------------------MTENNAKPSAPAKSESRVT----------EDVVTLDV-
M5TIT3          ---------------------------------------ME----------ELSDSIDV-
A0A5M6CY44      --------------------MRQLPMPAAKSSSTRPRRPVA----------PEPDSLDL-
F2AXG2          --------------------MAESAKPTNRLPSRSPSNSTS----------DGEETLDV-
M2BB46          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDV-
L7CLQ6          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDV-
A0A0J1B719      --------------------MAESAKPTNRLPARGPSSASS----------DGEETLDV-
Q7UF18          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDV-
A0A2G1W1E0      --------------------MAESAKPTNRLPARGPSSSTS----------DGEETLDV-
K5E235          --------------------MAESAKPTNRLPARGPSSSTS----------DGEETLDV-
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      --------------------------------MTESTKSFS----------FASGEIDP-
A0A5C5X547      --MSTDVGKPLAANGRSSRGLNNPQAPYLVQNTVSTAPAEE----------GSGIQLSA-
A0A353FIP5      -------------------------------MPIPTSNAPE----------PKVDFNEA-
A0A5B1CIK7      --------------------MANTNEISASRVRQNARPSVE----------EEQDSLDV-
A0A5C5WHS2      --------------------MATSTENTSLRTQLSNRLSSD----------EDNDGLEI-
A0A5C6B6G8      ------------------MAPTNSQNPNNN-PRRRSAKTTS----------ENADSLDV-
A0A5C5ZZN3      ------------------MNKAENVEPVNRIARRPASSAME----------DPSETLDV-
A0A5C5XS91      ------------------MIMAEPNEPKNRIQALTRPKSDD----------DQADSLDV-
A0A5C6C4E6      ------------------MIMAEPNEPKNRIQSLTRPKPDD----------DQADSLDV-
A0A2E1VVJ1      -----------------------MSTVSGSPPTGPDANTGA----------KQIDVLEL-
A0A3M2AEL0      -----------------------MDTFAAPPPEHDDQ---A----------VTLSLPRL-
A0A2A2W9R6      ----------------------------MKRYQDETLEADD----------AAELSIDL-
A0A518HKC1      ----------------------------MKRYQDEALDADD----------GAELNIDL-
A0A518L3P0      ----------------------------MKRYQDEALDADD----------GPELNIDL-
A0A255R1S0      ----------------------------MSSHSDEA--QSD----------GMEFDIDV-
A0A5B9MKP1      ----------------------------MKRYEDEAFEADD----------GAELNIDL-
A0A0S8J591      -----------------------------------------MAVKRPERKMHLTDYLWV-
M5RT57          ----------------------------------------------------MGPRYLI-
A0A351FYP6      ----------------------------------------MEPTSRKENSSDKLHILDY-
A0A2E7ESJ6      -----MRHQTELHQPNQSSTDSP------------------AHWGATSMDTVSSQGVDV-
A0A2D5AWU0      ----------------------------------MSEIRIPQIEQSSSGGGESVDAGRL-
A0A1G2YQB7      --------------------------MNSLTKFTENQIIMQKSNMIEPDNESETA--NL-
A0A353P687      --------------------------MNTLTKYSDNHNLAQSGGMVYPTNEDGDPALNI-
A0A356EME5      --------MSRRPDLSHSSLTERSAERAGPPAVSTSGMRPLNAPGVRKRTAGSSQEMSP-
L0DC26          ----------------MMLNSNPGPGADSVNLPAVVPPHRAEVLSVTPAHFESSASLDP-
A0A3L7P4E4      --------------------------------------MSEFVPPSNPNVEPEEAGFDL-
A0A3L7PEB5      --------------------------------------MSEFV-TNSPNAEAEEAGFDF-
A0A1U9NL64      ---------------------------MNESFKTPQVNSSHEEANGDFEGREEGFQRSL-
A0A2N1UCJ3      ---------------------------------MTDKKTNIENEAGSVEQMMSGTHRTF-
A0A7C4EK84      -----------------------------MSSQTERHRRPETVPLQPRDGQEDSAHQNL-
A0A7C3F0T2      -----------------------MGEPANAGSAIGRFEGPLPVQGISADHGRPS----L-
A0A2E0X4J3      ---------------------------MSPNSLVETDPFAPPVESRPGPPSAAGSEVNL-
A0A5C5YU10      --------------------------MNPLVTTPHGALDSEPIGQMQSSAAAPPQSTDL-
A0A517MPZ6      --------------------------MSSLVEYEDDYSLDADPQPNAGKGDDSALQTNL-
A0A5C6CNV7      --------------------------MSSLIEYDSNTQL--EPSGMAHDHAAGAGQTNL-
A0A518K5H4      -------------------MASSPANPYAPTPVAMSHVSPLATAAMSVDQEDDSDGVNV-
A0A5C6AA28      ----------------MALPPSAPASTYAMTPSSAS----LPAPGMIIDQDEDAGGVNV-
A0A2E9VK20      -----------MKPSSDKNSRNV------------------DTVHGHPLVKADEPAIDL-
A0A3D4PJK1      -----------MKPSSDKNSRNV------------------DTVHGHPLVKADEPAIDL-
A0A532UT69      -----------MTSDMTDKNTDL------------------KMVGVARSIANTPPTSGFM
A0A355AI52      -------------------------------------MLDHEKQELDSTAQSMRQAVRF-
A0A354PCQ3      --------------------------------------------MPSSSAAQFDPWILW-
A0A0S8GZ23      -------MDKLEKYQPQEITPNI------------------DYLEADSAPKDSSILHLF-
A0A1I3DDV4      -------MSDMPQKPDSQMPVKP------------------MMDTRPMLDPNATGSFDV-
A0A2E0SMM6      ----------MNPYLDQSSTNEK------------------SGGHDNSTSAMMARVMRF-
A0A3L7SI46      VEIQDSRLGGLSDLADDKVSAKLHFISHWLFRMNTNERLTSDLDSTANGPNLLGEAVRF-
A0A356KTN1      -------MQAPQTGLESDFGRSP------------------TISDPLDAEDLRETLLGF-
A0A5B9PJZ8      ------MSGLRPVQNNNNNYGIP------------------QPQGSGSMPSSGGGLSELY
A0A2S8G191      ----MSLNNANLPQESSKRDIRVDAPVELVTGHANDFLSNNDVESEELGGGGIGVSQIL-
A0A2E7EGG1      ---------------------------------------MSASTKRRRIENLTQFEHDFS
A0A2E2N5A9      ------------MTSKPPSIEHH------------------LTAVPHGPAEAELDLRKL-
A0A7C8AGA2      --------MDELQKYQSQPLSQE------------------VVQFEGPVEEQSDSTMNI-
A0A7C2FXP7      -------MNDQRRFDAVNQRQYL------------------ASFERPAVDHANQNTSVM-
A0A2E3GWC6      ERNIAMRQNETMNQPTVESKNNP------------------APFPSHQMMQTPEPTVDL-
F0SLB0          ERHIAMRQNETMNQPTVESKNNP------------------APFPSHQIMQTPEPTVDL-
A0A3L7NDH9      ------------------------------MQENMSYSGSADGPHVDAMAQIVQNSMRF-
A0A1N6DAJ8      -----------MMSNSNSGPRSDSANLPAVVPPYRTAEVFSIAPAPVGTAAGLDPIALL-
A0A532UD06      ------------------------------MDHEALANGSQDLMSEQGHSQPQEGLFQI-
A0A660URN1      -----------------MRTDNISNPGAQMDKDSPVDNGAYNIAPAAGADHLQSSLLQI-
A0A517ZCB5      -------------------------------MNKLVLEGAGDATGRGESLDFVRGVVRF-
A0A225EH48      ------------MQRSSASEAQMPIPLTPAQPSGQQYASGFQPSVPGQTLAPTAAARAWP
A0A518INW8      ---------------------------------------MQTNHPMNEMTLPAEGITDSQ
A0A518JPH9      ---------------------------------------MQTNHSTKEIAFPADGMLDSP
A0A5C5VEK8      -------MTSLVSSQQGQFDPVP------------------NDQFGPGPSSQAPQSTDL-
A0A532UTJ0      -------MNEIKKLNEPVAGQEL------------------VNLQIPPEQSSEPTSDLV-
A0A432MFP3      -----------MDTSETTRPQYELARLSDLPPALRAPLPPASRPASDGGGLPINPRLVL-
A0A2E2CCW9      -------MNTDFQPLDQQSDFAI------------------DGMEENAEINSSGPGVDI-
A0A3C0AGX3      -------MNTDFQPLDQQSDFAI------------------DGMEENAEINSSGPGVDI-
A0A518AAQ5      -------MNTEFQPLEPHSDLDF------------------DGMEESN-MNSSGPGVDI-
A0A517QBG9      -------MNTEFQPLDPHSDLDF------------------DGMEESN-MNSSGPGVDI-
A0A518FTU3      -------MNTEFQPLDPHTDLDF------------------DGMEESN-MNSSGPGVDI-
A0A517WHH5      -------MNTEFQPLEPHSDLDF------------------DGMEDST-TNASAPGVDI-
A0A5A8BGT3      -------MNTEFQPLEPHSDLDF------------------DGMEDST-TNASAPGVDI-
A0A2E7K7A9      -------MNTEFQPLEPHSDLDF------------------DGMEDST-TNASAPGVDI-
A0A517PTS5      -------MNTEFQPLEPHSDLDF------------------DGMEDST-TNTSAPGVDI-
A0A6I6AH34      -------MNTEFQPLEPHSDLDF------------------DGMEDSI-TNTSAPGVDI-
A0A517VTK3      -------MNTEFQPLENHSDFEF------------------DGMEGHTQSNTSGPGVDI-
A0A517WQT4      -------MNTEFQPLENHSDFEF------------------DGMEGNTPSNTSGPGVDI-
A0A517VID8      -------MNTDFQPLDQQSDFAL------------------DGMEENAEFDSSGPGVDI-
A0A517RK10      -------MNNEFQPLDQQSDFAI------------------DGMEEHAPINSSGPGVDI-
A0A518IH18      -------MSTEFQPLDQQSDFAI------------------DGMEEHAPTNSSGPGVDI-
A0A5C5XLF4      ------------MPSSDKNSNNA------------------DAVHGHPLIKADEPAIDL-
A0A2D5NDU9      -----------------------------------------------------MSFGQV-
A0A1P8WP26      ------------MTTSQRQVNTV------------------GAGGQDALAMTLHAIARF-
A0A3L7V1F3      ------------MSGPENQILGM------------------QEQGQNTAASTLHLMFRF-
D5SZ21          ----------------------------------------------------MQTLMRF-
A0A286RGB6      MTPEREAGMSEHQHLPAPVGQDRTGAARPSAPAPLYLDAEWQPIPAAEAGQGFGAYLHA-
A0A518CHE5      -----------MNPYLDQSNSNE------------------SSNHDNSTSAMMARVMRF-
A0A1V5N3W2      -------MDSVVKYKPQPHPQEF------------------VYTDVPPEAAPAAPLGLF-
A0A3E0MY27      DPKKPSERPLDVVSERPGEGALPVPTSGKDAVFDAIQTSTPARVRPEILTAPPKPMDLL-
A0A7C4Z5R7      -----------MNTLPARIEQNPRPGQASQTVPGNIGSGSPIQPPGSPASAPPSAWAML-
A0A2E0X9P6      -----------MSHSAKEDHDYQLPAPRPPTEWTRQAVTASRPSRRADDSEGMPPDFVR-
A0A286RLF2      ----------------------------------MNESSWIQWAVPDSASHILHAIAQF-
A0A517NSK8      ------------------MTQVD------------------PNLNNQ--TADDSEALDL-
A0A5C5Z0D6      ------------------MNDTT------------------ISSPNE--SAGDTDILDL-
M5UE94          ------------------MNDTA------------------APQPRSYPEQQETDLLDL-
A0A2E8FLY0      ---------------MSRPTDTP------------------IDTSGEPRTATLTAIARF-
A0A3D2U1E1      ------------MSTDQSHPNRP------------------LDETA-PQAATLTRIVRF-
E8R3W3          -------MNPTDPVSAPPRDSHPSSPRPGTAMTRVAVDARPAKPALPPREEALATTLELG
A0A5C5ZM48      ------------------MNKMITPPTQDLTGAAIPAPMVIDAEGDDQSHSALSGQAIV-
A0A5B9WF77      -----------MNTPDRSDANLPARLTSSPRYPAQVSAMRREMDVAGAPSVTIDTRQLF-
A0A518BBX8      ---------------MDRQEPFD------------------PNASDDSPIIAMPDLTRL-
A0A1P8WN28      ------------------------------------MDPYTLEQLDSTEPQGFHALLRF-
A0A3B9CTT0      ------------------------------------MELEQPEQSASSQGNSLQGLLRF-
A0A518ALT3      ------MSESHPNSKDSRHQLTTTHEELAISRRRNITHARQGSGSKQPTQSGITPLFVW-
A0A3M1QRP3      ------MSDKPSRAQDESHALAAGEPLTPAAPFAATDAIDVFAADSGEEREPQKLSLSP-
A0A517TMV0      --------MGTAIEEYSNRQDAL------------------AEPALGGGGDAFESLVRL-
A0A3E0MY88      ----------MSHAPDKLDLEAI------------------GTLDDPSVSHIVHHVVQF-
A0A5B9QF68      -------------MTNTDCKHNL------------------REDAFMPAVDAVSAIARF-
A0A5B9QGF0      -------------MINSDFNQNQ------------------ADADFMPSVDAVSAVARF-
A0A5C6CK24      -------------MTSTDFNQNQ------------------NDAEFMPSVDAVSAIARF-
A0A2E3RCU8      --------------MSVETDDGA------------------YELPLTNAAGAIHDVFQF-
A0A1C3E6N1      ---------------------------------------------MMPEANTMQTLMRF-
A0A518GJT2      ----------------------------------------------------MQTLMRF-
A0A2E8B0L9      MSQTPELRAVSPPHSFDELHDPQ------------------D-----GAAEAVQAVAKF-
A0A5Q4GFE7      -------------MMQHEQHSSA------------------DESMLPSSADSIHALIRF-
A0A257WS34      -------------------------------------------MQQAHHSTVLSELMRF-
A0A7C4LP10      ---------------MSIDADPT------------------APADVPHHSGALGELVRF-
A0A517MLW3      ----------------MNQIENL------------------SGPQHLTAADAIQALLRF-
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      GDGKPDGLPLPRHLATPSAKDPPPPMSSLIESDSFSVGEPTSYGAPHGRAARTGREVSP-
A0A3B8PNV4      --------------MSQSPDDRP------------------IAAPNEPQTATLAAIVRF-
A0A3D1DR40      --------------MSQSPDDRP------------------IAAPNEPQTATLAAIVRF-
A0A2E7RYU8      --------------MSPSPDDRP------------------IAAPNEPQTATLAAIVRF-
A0A3B8LXG8      --------------MSPSPDDRP------------------IAAPNEPQTATLAAIVRF-
A0A286RD13      SDLVRVLGTSPPSTLASGNSVAP------------------TPLQRETLHGPPKPSDVL-
A0A2E3GWX1      -------------MVSPEQYDLA------------------AMPLPQETVNPLTTVIRF-
F0SG60          -------------MVSPEQYDLA------------------AMPLPQETVNPLTTVIRF-
A0A2E9VST2      -------------MPAPENYDPQ------------------MNMHLQENHNPLQTILRF-
A0A356A6X2      -------------MPAPENYDPQ------------------MNIQLQDNHNALQTILRF-
A0A5C5XLM3      -------------MPAPENYDPQ------------------MNIQLQDNHNPLQTILRF-
A0A7C5FXU1      ------MSEQLPANRDERHMVAPVVYRPLDMRDWEGHFGGGWGGSPPQGGSPLGAYWHA-
A0A3M1VCL4      ------MTQDVPSLVLQQEASRA------------------ADLAAVPAINPLASLLRF-
A0A5C5V7Z9      -----------MTAADHQPGFQD------------------EGVQEGSLAESLHGLVRL-
A0A5C5YT05      -----------MTAVDQQGGFPE------------------EAAHEGSLADSLHGLVRL-
A0A518D7F9      ---------MKQSPTAALAREEE------------------WQDDSGAAGAALEGVLRF-
A0A5C5ZIP0      -----------MTQNQEHFHEPE------------------ITVSSAGPNEALQGVLRL-
A0A518KBK3      -----------MSLDTVNDRGEP------------------WGNELDAGGHALEAVVRL-
A0A5C6AKF9      -----------MSLESANEHGEP------------------WRDDNDASEHALEALVRL-
A0A6M5Z0K7      PRGTLSPAAQADRLLPALGVGGP------------------PVAEPPALKQTITPGALL-
A0A350CI62      -------------MTDQDRILAG------------------SQDGTNAAATTLHLLFRF-
A0A4P5WQK6      -------------MTDQDRILAG------------------SQDGANAAATTLHLLFRF-
A0A3C1X4W5      -------------MTEQDRILTG------------------SQDGQNAAATTLHLIFRF-
A0A3D3W3A7      -------------MTEQDRILTG------------------SQDGQNAAATTLHLIFRF-
A0A518DRX3      --------------MTTELSLVS------------------PDAEGSSPRDIMQAALRF-
A0A518DZF9      --------------MTTELSLVS------------------PDAEGSSPRDIMQAALRF-
A0A518AKT8      ----------MLKTPESNNLSSM------------------EQSDDISTSDMIHAGLRI-
A0A5C5ZR72      QLTHRTAGSEGARGGSAHARHAL------------------KPSRAEAAQPQIGPMFFW-
A0A7C5R0U3      --------------------SGH------------------GRDEGARSPHGVAELVFLA
A0A517TY85      PTNLVVRPTQSRAPALANMTPAG------------------G-SDAAAAMQGITPALVL-
A0A5B9QEI7      STGSGLPARIPVAHALRRPMPAA------------------ARQNSTPNEQGITPAFVW-
F0SI78          TTLEAKHTPRWSARATEPKPTQN------------------GSDWQFDSPTSSESGFDI-
A0A517MDV3      --------------------------------------------MSGDNTVSPQPNLDF-
A0A518IQ30      ----------MQRESAPRLSETE------------------QGSDEFQAADAIHAALRF-
A0A517LWP4      ----------MQRESAPRLSETE------------------HGSDEFQAADAIHAALRF-
A0A518JNW8      ----------MQRESAPRLSETE------------------HGNDEFQAADAIHAALRF-
A0A2E7ENQ5      -----------------MNERRA------------------LPPTAGSQTHLVHTAMRL-
A0A7C2KUQ9      GGLLPVARRGEPVEAHRGLLTGP------------------IAAPAPLVGVPAGRTVTL-
A0A7C5BZF0      ------------------------------------------MGDSVSAAQMVHSLARF-
A0A1G3AQE9      ---------------MQEPAVVR------------------DELESESTAHMVHRLVQF-
A0A3L7UQT9      ---------------MNSDVQQP------------------APAPILNTANVVAGMIRF-
A0A4P5YBU2      ---------------MNSDVQQP------------------APAPILNTANVVAGMIRF-
A0A7C7V5U8      ---------------MQEPTVVY------------------HEPEKQSTTHMVHVLMQF-
                                                                            

A0A5S9IJB5      ----IEI--ITSRWYII-----FLSI-TL---FVGMAFYYAKTTKRI-YQSTGTIAILPK
A0A5S9IPR9      ----LSYWAILRKHLIL-----VAFCGVV---GAITAVFYTSRLPNM-YRAGASVAVIKP
A0A533Q9U4      ----VKI--IRKRMWMV-----IIFF-VV---IVAIVTIKTFKTTPV-YQATARVVLEQN
A0A533Q6B7      ----LKI--IQKRMWIC-----VIVF-IA---IVAVVVVYTLRTQPL-YQTTASIMLEQK
A0A1U9NNE1      ----IKA--LLRRWYIV-----LLTVVVL---CAIGIPAIFYMFKPS-YETVGAIRVSPI
A0A2G2JCA2      SPQLVLH--ALRRWWMI-----VIPIGMVL--GSAGAAGLWSRYEPV-YKASAWLQIEEV
A0A1G2XVR0      ----LTT--VLRRKWII-----IAFL-VI---SGTYSTYKELTKIPY-YTASTQVIITQN
A0A1G3B0P0      ----LTT--VLRRKWII-----IAFL-VI---SGTYSTYKELTKIPY-YTASTQVIITQN
A0A1E3X4X0      ----IKI--IQKRQWVV-----ILVF-VV---LVATVTISTIRMTPV-YQAKARVLIEKE
A0A286U4B3      ----FRV--VMHRKWVI-----VAIF-TI---TVLLVTLYTFKQKPI-FQAVTTIRIFKE
A0A5C6DDS2      ----FRV--VMHRKWVI-----MAIF-SI---TVLLVTLYTFKQKPV-FQAVTTIRIYKD
A0A2E3GW02      ----RSI--VWERKWLL-----IFFA-AL---GAAIGYLEFTKQPPV-YRSSASILVDRY
A0A5B9QNZ7      ----WGV--LRRRWIIV-----FLGL-AL---GISLAVFYAVVAPKI-YSSQVEVLVMRK
A0A1Z8N7H5      ----LKV--VWYRKNSM-----IMVG-FI---LAIIAGWYAATATRY-YQSSASILIVRN
A0A1G2YPI3      ----VLI--LWRSRWIV-----LLTT-VA---VLAAALIYVTKVTPV-YTSTSRIYVEQS
A0A1U7CZ81      ----LRG--LARNWWRI-----LLLWAVV---SAPLDYLIYSQIQPT-YEAVSTIRAEPT
A0A142YNY8      ----LRG--LLRNWWKI-----LGLWLIA---SLPLVYGIYTQVKPT-YIAYSVIRIEPT
A0A1U7GLS6      ----LRG--LLRNWWKI-----LGLWLIL---SAPLAYLVYSQVKPK-YMAYSRIMVQLT
A0A532UIN2      ----VQI--MWRGRWLI-----LLAT-IL---AVAAAVVYLVKATPI-YSSTSRIYVEQS
A0A0S8KNX5      ----LAG--IFRRWYIV-----LLILFVM---CAAGLPAIWFLIDPV-YEVTGAVTIAPI
A0A3D3UVZ8      ----VAG--ILRRWYIV-----LLILILI---CGSGLPAVWFMVKPI-YDVTGAVRVAPI
A0A517NFU9      ----LGM--LRRRWPHI-----AFGI-FV---GLSLAGFYYFSTDRM-YESKIEILVGQR
A0A5C5YWH4      ----LGM--LRRRWPLI-----VFGI-LV---GVSLAAFYYAATTRM-YESKIEILVGQR
A0A3D2TNK4      ----LRM--LMIRKKTI-----IISL-YL---FAVCGVIYYYFAVRL-YESSAKILIDEK
A0A7C1Y4F0      ----LFI--VLRHRWTI-----LITT-LV---ALVAAFAYILKATPI-YESESRLYVEQS
A0A6I0ENW6      ----RSM--LRYKWMVL-----GITLAGA---AVSVPPVWMLIKPKY-YANTLIQLKPTM
A0A6L3A0B7      ----RSM--LRYKWMVL-----GITLAGA---AVSVPPVWMLIKPKY-YANTLIQLKPTM
A0A0J1B4A0      ----LGI--VRRRYHLI-----ALGI-FV---GVTLATIYFVNQVPI-YESKLAVLVGQR
A0A142WSB9      ----VRF--VLSIWKWL-----ALGL-FA---GLTLGVVSYLIMGPV-YRASTRVQVSKK
M5SZR3          ----KKV--ALRHKSLI-----ALGI-AI---GLVIGALYYAQSTPV-FRSSAQVLIVRK
M5TW92          ----KKV--ALRHKALI-----ALGI-AI---GLVIGALYYAQSTPV-FRSSAQVLIVRK
A0A2S8FKY2      ----LHS--LRRQWLAS-----IVLGLLV---AVPVAIAAWVLQSPT-YTSSAYLRISSN
A0A517N8P6      ----GGV--LWRRKGVI-----LLLI-LC---GLGAGYWFFTTQDET-FRAAATIEVYSQ
A0A432MJP4      ----IRV--VRREWRWS-----AVGL-AV---CLTAAAIYLVRTPRM-YQATARVLVLET
M5UQ35          ----LGI--LRRRYHLI-----ALGV-FV---GALLACLFYVKQVPV-YQSNLAVLVGHR
A0A0S8FY64      ----FGV--IRSRFWTI-----VACA-VV---LFTVAVLYTFQATPI-YEASARLLIERR
A0A1N6KFT7      ----WDV--LKRGWKFV-----SLGL-LV---GLTLASIYLAKTKRI-YQASTSLLVIQH
L0DFG4          ----WEV--MKRGWKLV-----IFGL-LV---CLTLASIYLAKTKRA-YQASTSLLVIQH
A0A5C5XXG1      ----APW--IARRRAA-----------------------WVILSGPA-GHSS------HH
A0A7C7YUM8      ----LHI--LLRHKSLI-----AGAA-FF---VTVCTVLWVSTRQPR-YEASAVLLLEKD
A0A7C2AHI6      ----LSL--VERRMKLI-----LATA-AL---VVVGTFVYLGMRPPT-YRASATLMLLDN
A0A518BJJ1      ----LDL--IRKRWLAI-----GACA-AA---TVAAGIGWLSLQPPV-YRATATILLDQS
A0A518D182      ----LDL--ALRRRLAL-----ALFA-VA---GLGLALGWIGAQAPV-YRATATVLIDEQ
A0A5C5WTY6      ----LSI--VRRRWKWI-----AGFA-CL---GILATAIYLSQTPPT-FRSQAKILVNPN
A0A5C5Y033      ----PQL--IARQRWLI-----LFLG-SC---GLAMGVAYATHAEVL-YESQAKVLVAQR
A0A5C6G1Y2      ----PQL--IARQRWLI-----LFLG-SC---GLAMGVAYATHAEVL-YESQAKVLVAQR
A0A354PDV6      ----LQV--LSRQRWLI-----VFCS-LM---GMAAGVLYSIQSTVW-YRSTAAILVNSK
A0A5C6FZ02      ----LQI--LFRQRWLI-----AFLT-LA---GLAAGVAYALQARVW-YESTARVLINEK
M5TIT3          ----LEI--LSRQRWAI-----VFLT-LC---GFTAGVAYAMYSQEW-FESHAKILINQK
A0A5M6CY44      ----LDI--FRRQRWMI-----IFLA-VL---GLAAGILYALNATVW-FESRAKLLISER
F2AXG2          ----LQI--LSRQRWLI-----AFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQA
M2BB46          ----LQI--LSRQRWLI-----AFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQA
L7CLQ6          ----LQI--LSRQRWLI-----AFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQK
A0A0J1B719      ----LQI--LSRQRWLI-----AFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQK
Q7UF18          ----LQI--LSRQRWLI-----AFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQK
A0A2G1W1E0      ----LQI--LSRQRWLI-----AFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQK
K5E235          ----LQI--LSRQRWLI-----AFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQK
A0A5C6FFI9      ------M--LRRRWFHL-----VLGT-CL---GIAFALLYFYATKPT-YESHIEILVGQR
A0A5C5WDJ1      ----LGM--IRRRWRLL-----VFGV-FV---GIALSALYYTTATQQ-YQSSIEVLVGQR
A0A5C5X547      ----IWH--AFRRRWAL-----GLLIGIL---LTPLAIVPWLLMEPQ-STAVVQLHLHQD
A0A353FIP5      ----IGI--LWRRKVQI-----ALIT-VI---AACVAFLVAVTRTPS-FEAEGRVLLE--
A0A5B1CIK7      ----FAI--LGRQRWLI-----AALS-LA---GLAAGIAYALTAEVW-YSSQAKVLINER
A0A5C5WHS2      ----FAI--LSRQRWLI-----GLLT-LA---GLAVGLIYALNAEVW-YRSQAKVLINEK
A0A5C6B6G8      ----LET--ITRQRWLL-----AFFA-ML---GLVVGVAYSLNAQIW-YKSNAKVLIAEK
A0A5C5ZZN3      ----LEI--LSRQRWLI-----IFLC-LC---GLTAGIAYALYAPVW-YETNATVLINQK
A0A5C5XS91      ----LQI--LQRQRWII-----LFLC-IC---GLTAGVAYSLYAPVW-YQSSATVLINQK
A0A5C6C4E6      ----LQL--LHRQRWII-----IFLC-IC---GLTAGVAYAKYATVW-YQSSATVLINQK
A0A2E1VVJ1      ----LSA--ILRHKALI-----VLCT-LL---SSAAVMFYSATKEPV-FNAEGRVALD--
A0A3M2AEL0      ----LGI--FWHQRLLV-----TSLL-IL---GAVLGFFLSMLVPPR-FAAEATVLLR--
A0A2A2W9R6      ----LGI--VRRRFHLI-----MLGV-LV---SVTGATVYFVQQKPV-YESKLAVLVGQL
A0A518HKC1      ----LGI--VRRRFHLI-----MLGV-LV---GATCATIYFVKQKPV-YESSLAVLVGQL
A0A518L3P0      ----LGI--VRRRFHLI-----MLGV-LV---GATCATIYFVKQKPV-YESQLAVLVGQL
A0A255R1S0      ----VGI--LRRRYHLI-----ALGL-LV---GATLATIFYVKQKPV-YQSSLAVLVGQR
A0A5B9MKP1      ----LGI--VRRRFHLI-----MLGL-LV---GSTCATIFFVKQKPV-YQSSLAVLVGQL
A0A0S8J591      ---------LKRRVLLI-----LFFW-GL---VFASVVVATFMQQPL-YRAYARIEIERS
M5RT57          ----HSL--TTYWYLTI-----PLAI-VL---AGLSATAVLMTFTPV-YRATAVMKIASY
A0A351FYP6      ----WRI--IRVRIVTI-----LLVF-LL---TAITTTVVTFLIPKT-YMSLSRIAVEKD
A0A2E7ESJ6      ----GGI--LSRRKWLV-----ILGF-ML---GLGLGYVYMLQATPR-YESVAQILIEDK
A0A2D5AWU0      ----FQA--LWRGKWYF-----LLFP-AI---AGGGMYYFLHGQKNL-YRSTAQVQVAPR
A0A1G2YQB7      ----IA---IMRKRWKILTVTAIIIC-GI---GLPLIWLLV---KPY-YLATAAIRVAPV
A0A353P687      ----LT---AVRKRWKILLFTMIIIC-SI---GLPAVWMFI---KPF-YLATAAIRVAPV
A0A356EME5      ----RFLLNALLHWWKVAMPVGLILA-AV---AVAGVWWFF---EPV-FLSRALIQIREN
L0DC26          ----ITLLRALRRRWAL-----AFGT-GLLGAAVIATLTFYLVPPAK-YMARAMLHVNSV
A0A3L7P4E4      ----WGF--LCRRAWLG-----FFFG-TI---GATAAYYYYLRQPVV-FKATSQILITKQ
A0A3L7PEB5      ----WGF--LWRRAWLG-----FLFG-TI---GATAAYYYYLRQPVV-YKATSQVLVIKQ
A0A1U9NL64      ----FEV--AWANRWLI-----LATT-IL---SLTAAFIYLAKATPI-FTSSSRVYVEQS
A0A2N1UCJ3      ----AVT--LQRRRLSI-----LITA-VL---FVAAAILYLIKAEPL-YTSTARLYVEQT
A0A7C4EK84      ----LGV--VWRRRWTV-----LAVT-AA---SLLAAVVYLAQAEPI-YQSSARVYIEQT
A0A7C3F0T2      ----LHT--LWRRRVII-----AAAM-VI---SLALGWLQLNNTTPL-YTSTSRLYVERS
A0A2E0X4J3      ----LAI--AWRSRWLI-----LLFM-IL---GGAVSWVLLQRATPR-YTSFSKLYVERN
A0A5C5YU10      ----LAL--AWQGRWLI-----LIGV-LI---GGSAAWVHLQRVTPL-YQSTSRVYVERS
A0A517MPZ6      ----LSI--AWQARWLL-----LLTV-LL---GVGCAWLYLQRVVPR-YTSVSRIYVERS
A0A5C6CNV7      ----LEL--AWQARWLL-----LLTV-LT---GLGAAWILLQRVEPR-FTSVSRLYIERN
A0A518K5H4      ----LAV--AWQSRWLI-----LLFT-LL---GGVAAWAYLQQATPR-YTSLSRIFVEQK
A0A5C6AA28      ----AAI--AWQSRWLI-----LLFT-LL---GGLASWLYLQRVVPR-YTSLARVFVEQN
A0A2E9VK20      ----VKL--ALKNVVTL-----GIAA-AA---GIGLGIFAYKILGPK-YTASSQILVKLK
A0A3D4PJK1      ----VKL--ALKNVVTL-----GIAA-AA---GIGLGIFAYKILGPK-YTASSQILVKLK
A0A532UT69      PESLIRI--IWRSRGIV-----LLTT-FV---SLAAAAVYVTTITPV-YKSTSKIFVEQS
A0A355AI52      ----LRV--LWHRRIII-----MSTL-AL---CGMLGGLYYATAARI-YEAKAQLLIVDT
A0A354PCQ3      ----VTF--RRCWAWAL-----PIGA-LL---AGLAAFFVLRNFVPI-YRASSLLEANQD
A0A0S8GZ23      ----QPV--LRRWYWVL-----VIFI-LV---SAVGAPIIWHVKRPI-YTTSGTIHIRPL
A0A1I3DDV4      ----VEI--FRRQLPLI-----ACCT-VL---GLLMAVIYWANAEKW-YESSAKMLVTLK
A0A2E0SMM6      ----LRV--IMLRKKII-----VVCV-IL---TSIAGAYWYSTQTPM-YQSTAQLLVLSN
A0A3L7SI46      ----LQV--IRRKLPTL-----LVCT-IL---GGVIGTAWYVTATRK-YESVSEIMVLKT
A0A356KTN1      -----------KRRLPL-----VIGV-TL---FFGVAAGVRSSNLPTVYASTARLQLAKE
A0A5B9PJZ8      NFDVFDM--VRRKIWLI-----LFFT-LL---GIAAALLFFFQAPKT-YRSTAKVFVDEK
A0A2S8G191      ----HAL--RRRWLPAF-----SIGI-VL---ATAGVALAWVLDVPE-YTTRAMLRISSS
A0A2E7EGG1      LRMFTSV--LIQWWRIL-----IPVT-LF---ALLISTVFVFWSFRPQYRASAWLQINGV
A0A2E2N5A9      ----WMS--VWLRKWLI-----LGVM-LF---AALAAAWATSWMTPL-YRAGATLLVESE
A0A7C8AGA2      ----VAA--ILRRWPVL-----VATF-VI---VCVLGVPAILFLIEEKYDTEGAIRISPI
A0A7C2FXP7      ----VPI--MRRWKLVF-----FVFI-FL---CAATIPFIWSFVKPT-FEVTGAIRVAPI
A0A2E3GWC6      ----VQL--ALRNIIWL-----IIAG-AV---GLGLGIAAYKALGPS-YVAKSQILVKLK
F0SLB0          ----VQL--ALRNIIWL-----IIAG-AV---GLGLGIAAYKALGPS-YVAKSQILVKLK
A0A3L7NDH9      ----LQV--LWRRKHLL-----VASC-AA---AGLLGGLYYTTSKRT-FEAEASILIVGS
A0A1N6DAJ8      ----KAL--RRRWPLAV-----GAGL-LG---GVVLAVVTYFVVPPAKYTARSMLHVNST
A0A532UD06      ----ALI--VLQHRWTI-----LLTT-VG---FLVVGFAYIMKATPI-YTSASRLYVEQS
A0A660URN1      ----A-----LRHRWVI-----LAAV-LV---SLIAAFGYILKATPI-YTSASKLYVEQS
A0A517ZCB5      ----GRV--VRNRLHIV-----LGIL-VS---VSILGGISYVLSPPV-YESAAELLVLQT
A0A225EH48      TLPELVN--ALKRRLVL-----ATFL-GM---LVGMAAAAAVWLALP-SGKHTAMALIQL
A0A518INW8      PGDMTRI--LRRRWPLL-----MFGL-VV---GLGIAFAYHQNAKDV-FESSMEILVSQR
A0A518JPH9      PSDVTRI--LRRRWPLL-----LFGL-VV---GLGIAYAYHKNTKVV-YQSSMDILVSQR
A0A5C5VEK8      ----LAL--AWRGRWLI-----LLGV-LI---GGTASWVYLQRVTPL-FLSQSRIYVERS
A0A532UTJ0      ----AGI--FRRWYIVL-----LVFL-LI---CGAGLPATLFLVKPI-YSVTGAIKVAPI
A0A432MFP3      ----RGL--ARHWWQAL-----ALWV-VG---SAALAALVYLKFQPT-YRSFSLLQIERN
A0A2E2CCW9      ----VRL--LLRNKYLL-----VLGL-AA---GLLLGQAAYMKLGPI-FSADTKIQVSQK
A0A3C0AGX3      ----VRL--LLRNKYLL-----VLGL-AA---GLLLGQAAYMKLGPI-FSADTKIQVSQK
A0A518AAQ5      ----VRL--LFRNKYLI-----VGGL-VA---GLLLGQAAYMKLGPV-FSANTKIQVSQK
A0A517QBG9      ----VRL--LFRNKYLI-----VGGL-IA---GLLLGQAAYMKLGPI-FSATTKIQVSQK
A0A518FTU3      ----VRL--LFRNKYLI-----VGGL-IA---GLLLGQAAYMKLGPI-FSATTKIQVSQK
A0A517WHH5      ----VRL--LFRNKYLI-----VGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQK
A0A5A8BGT3      ----VRL--LFRNKYLI-----VGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQK
A0A2E7K7A9      ----VRL--LFRNKYLI-----VGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQK
A0A517PTS5      ----VRL--LFRNKYLI-----VGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQK
A0A6I6AH34      ----VRL--LFRNKYLI-----VGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQK
A0A517VTK3      ----VRL--LFRNKFLL-----ISGL-AV---GLILGQAAYMKLGPI-YSASTKVQVSQK
A0A517WQT4      ----VRL--LFRNKFLL-----ISGL-AV---GLILGQAAYMKLGPI-YSASTKVQVSQK
A0A517VID8      ----VRL--LLRNKYLL-----VIGL-VA---GLILGQAAYVKLGPI-FSATTKIQVSQK
A0A517RK10      ----VRL--LFRNKFLL-----VTGL-VA---GLLLGQVAYMKLGPI-YSASTKVQVSQK
A0A518IH18      ----VRL--LFRNKFLL-----ITGL-IA---GLMLGQVAYIKLGPI-FSASTKIQVSQK
A0A5C5XLF4      ----VKL--ALKNVVIL-----GIAA-VA---GIGLGIFAYKILGPK-YTASSQILVKLK
A0A2D5NDU9      ----LAM--LWRGRWTI-----LATT-LV---VTLAAFIYGEVTGSR-WRAESRLFINAG
A0A1P8WP26      ----LRT--VRHRSGIL-----LLCL-VV---SGALGTLYYVTAPRI-YQSKASLFVVQI
A0A3L7V1F3      ----LRT--VRLRSGIL-----VATL-VI---SSIAGATYFITAQRI-YQSNASLYIVRK
D5SZ21          ----WRS--VQYRKGLI-----ILAV-LA---ASALGAAYYIVSTRY-YESKAELLILQT
A0A286RGB6      ------F--RRRWLAVA-----FLGM-LC---GAAAAAAAWFLFIPQ-YTATALIRVSSS
A0A518CHE5      ----LRV--IMLRKKII-----VVCV-IL---SSVAGAYRYSTQIPM-FQSTAQLLILSN
A0A1V5N3W2      ----RAL--RRRWYIVF-----LVFV-LL---AGAGLPAVWFLVKPK-YQAAAAIRVAPI
A0A3E0MY27      ----RAL--QRRWLLAF-----VLGC-ML---GIPAAVITWFVVPIE-YTAEAFLQFNDE
A0A7C4Z5R7      ----NAL--RRRWWLAL-----LLAI-PA---SAAAAAAVWFVYPPS-YTAQTLLHLSAI
A0A2E0X9P6      ----RVL--RNSWKWAI-----PLGL-LL---AAAAGCAVMYLHVPK-YQASALIQIESK
A0A286RLF2      ----LVA--VRRRWQIM-----LGAF-LA---VALLGALYYATAPRI-YSAKAELLILQT
A0A517NSK8      ----IGV--LRRRIGFI-----VLGV-TL---GLIAAGLYLLLTTPT-YRAEMEILVGQK
A0A5C5Z0D6      ----LGM--LRRRKGFI-----ALGL-FL---GVAAAVLYFFLTPPT-YRAKMEILVGQK
M5UE94          ----LGI--LRRRKGLI-----ALGL-FI---GVAAAVLYYVLTPPT-FRAEMEILVGQK
A0A2E8FLY0      ----LQV--VRIRKGIL-----FSTL-FI---STILGGLYFATATRL-YESKARLYVLQM
A0A3D2U1E1      ----LHV--VRVRKGLL-----FASV-FV---AVLLAGLYYATAPRL-YESSSRLYVLQM
E8R3W3          DLLRALR--RRWLMAAI-----VAPL-TA---VLAMVVAYPLVIKER-YSSEATLQLALF
A0A5C5ZM48      ----GAV--RRWWVVAT-----PVGL-FL---SVAAVVAICLMSQPV-YRASAWLKIKAE
A0A5B9WF77      ----RGL--ARNWWRIL-----LVWL-VV---SAPLVYVIYTLVEPT-YQASSLVLVESN
A0A518BBX8      ----VQI--VWERRWTF-----LVGP-VV---FLALATLYYVQATPR-FESEAKVLVINK
A0A1P8WN28      ----LRV--VNRHRMIL-----VGLV-AA---AAFLAVVRHKQIPKQ-YESTARLMVRQV
A0A3B9CTT0      ----LRV--VNRHKLII-----VGFV-AA---ACFLAVVKHNRQPQI-YEAGTKMLVRQT
A0A518ALT3      ----RVF--RNWWKFLV-----PCSL-LL---AVAAAALVLWLHVPQ-YEARALIKIESN
A0A3M1QRP3      ----ARI--LRFKWTIL-----VVFA-AV---CASALAGVWIFVEPQ-YRSIAQIEVRPQ
A0A517TMV0      ----VRI--VRYRHQAV-----LWIV-AG---CLALGLTYYAMAPRY-YRSEARLQVIDQ
A0A3E0MY88      ----LRV--VRSRINIL-----IIAI-VV---SSLLGGLYYATATRY-FQANASVLIIRN
A0A5B9QF68      ----LSL--VRRRKQVV-----ITSV-VI---SGLLGMTYYLLATRK-YASTAELLIIQQ
A0A5B9QGF0      ----VGI--VRRRKQVV-----IASV-VI---SGLLGMTYFMLATRK-YASTAELLIIQQ
A0A5C6CK24      ----VGI--VRRRKQVV-----ITAI-II---HVLLGTTYYMLATRK-YASTAELLIIQQ
A0A2E3RCU8      ----LKI--VWYRRNSM-----LVVG-IV---CAIVAAWYAATATRY-YQSSTSVLIVQN
A0A1C3E6N1      ----WRS--VQYRKGLI-----ILAV-LA---ASALGAAYYIVSTRY-YESKAELLILQT
A0A518GJT2      ----WRS--VQYRKGLI-----ILAV-LA---AIALGAAYYIVSTRY-YESKAELLILQT
A0A2E8B0L9      ----LRV--VYYRRSYV-----ITCV-VV---SALLGGLYYYRASRV-YAATASLLITQT
A0A5Q4GFE7      ----LQV--VYHRKIYV-----VSAV-VV---ASLLGGLYYTTATPI-YQATSQLLILST
A0A257WS34      ----LHI--VRLQMWTL-----ILTV-AV---TGILGGIYYMTADRV-YDSSADVLVLQT
A0A7C4LP10      ----LQV--VRLRKWTL-----VACL-LV---AGAGGAVYYATATRI-YESSAEVLVLQT
A0A517MLW3      ----GNG--MMRRQRMV-----ASVF-LL---VGLFAGIYYVTADRV-YQASAQLLVEEP
A0A5B9QVD0      ---------MYRRQRLV-----VGVF-AV---VGMLAGLFYVTADRV-YQADAQLLVEEP
A0A3A0DET7      ----LAL--AWRNRWLL-----LLTT-LV---GGGAAWATVQRVTPR-YTSVSRLYVERA
A0A3B8PNV4      ----LQV--VRIRRGIL-----FCTL-FI---SIVLGGLYFATATRL-YESKARLYVLQM
A0A3D1DR40      ----LQV--VRIRRGIL-----FCTL-FI---SIVLGGLYFATATRL-YESKARLYVLQM
A0A2E7RYU8      ----LQV--VRIRRGIL-----FCTL-FI---STVLGGLYFATATRL-YESKARLYVLQM
A0A3B8LXG8      ----LQV--VRIRRGIL-----FCTL-FI---STVLGGLYFATATRL-YESKARLYVLQM
A0A286RD13      ----HAV--RRRWWLIL-----IMGV-LA---SAGVMVFAWRTIPVE-YTATAWLQVSLE
A0A2E3GWX1      ----LQS--MLRRKWIV-----MGWL-TI---TVGLGITYFVLAPRL-YESSAELLILHT
F0SG60          ----LQS--MLRRKWIV-----MGWL-TI---TVGLGITYFVLAPRL-YESSAELLILHT
A0A2E9VST2      ----VQS--LIRRKWTV-----MAWL-TL---TISLGMTYFALATRK-YESSAELLVLHT
A0A356A6X2      ----LQS--LLRRKWTV-----MAWL-TF---TVSLGMTYFALAPRK-YESSAELLVLHT
A0A5C5XLM3      ----LQS--LLRRKWTV-----MAWL-TF---TVSLGMTYFALAPRK-YESSAELLVLHT
A0A7C5FXU1      ----FRR--Y-WALATI-----LGLL-VG---AAAGLSVWFLIPQKY-TATALLRVAANP
A0A3M1VCL4      ----AHA--VRMRKAIL-----LGTL-LI---AAVFGALYYLTATRY-YASNARLLVLQT
A0A5C5V7Z9      ----LRL--MQRNQSTI-----AWCV-AG---CVALAMAYYVAAPRI-YRSTAKLLLIEQ
A0A5C5YT05      ----LRL--MQRNQATL-----AWCV-AG---CTVIAMAYYVAAPRF-YSSTAKLLLIEQ
A0A518D7F9      ----LRV--VQRRQKLV-----ALIV-AG---HLAVGAAYYFTATRY-YESTAKLLVIEQ
A0A5C5ZIP0      ----VRL--AEQRHQTL-----LWIV-AG---CLGIGALYYGFAPRY-YRSEAKLMVIQQ
A0A518KBK3      ----TRV--VQYRRNTV-----LWTL-AG---CLAIGAVYYVTAKRY-YRSTAKLLVVDQ
A0A5C6AKF9      ----ARV--IRYRQQTV-----LWTL-AA---CLVVGAAYYATAPRY-YRSTAKLLVVDQ
A0A6M5Z0K7      ----AAL--RRRWQTAL-----GVAL-VL---GAGFAAAVWVLRPDK-YTSVALLQVSSA
A0A350CI62      ----LRT--VRFRKGIL-----VASL-VM---STILGMTYYITAERI-YESTASLYVVRK
A0A4P5WQK6      ----LRT--VRFRKGIL-----VASL-VM---STILGMTYYITAERI-YESTASLYVVRK
A0A3C1X4W5      ----LRT--VRLRKGIL-----VAAL-VM---STILGMTYYITAERI-YESTASLYVVRK
A0A3D3W3A7      ----LRT--VRLRKGIL-----VAAL-VM---STILGMTYYITAERI-YESTASLYVVRK
A0A518DRX3      ----LQV--LRRRKGYV-----LAML-AG---AAVLGAAYYVAAPRM-YEAKASLLITQT
A0A518DZF9      ----LQV--LRRRKGYV-----LAML-AG---AAVLGAAYYVAAPRM-YEAKASLLITQT
A0A518AKT8      ------------WRTL------SYRR-YY---VIASLVVCCVLGFAY-YLAAPRYYQSTA
A0A5C5ZR72      ----WVF--TMSWRTVV-----PIGL-LL---AIPVAAVIYLTYTPM-YEATGLIRIEDS
A0A7C5R0U3      AATVRLV--RRRWPVL-----------------AAAVVIALLVAIVQ-FSTAPRIYESRA
A0A517TY85      ----KVL--RGRWPVVI-----PLGL-VL---AAAAAAIVLLLYVPK-YRASALIKIEAQ
A0A5B9QEI7      ----RVF--TGWWKWVV-----PLGL-IL---AAGAGAIVLMFYVPK-YEASALVKIEAE
F0SI78          ----RSI--VWERKWLL-----IFFA-AL---GAAIGYLEFTKQPPV-YRSSASILVDRY
A0A517MDV3      ----WGI--LRRRWLIL-----FLGL-AF---GISLAVFYAFVAPKV-YASRVEVLVMRK
A0A518IQ30      ----LRM--LRRKKQYV-----AFSL-LV---TSALGAFYYLTADKV-YEARAQLLVTQT
A0A517LWP4      ----LRM--LRRKKQYI-----AFSL-LV---TCALGAFYYLTADKV-YEAKAQLLVTQT
A0A518JNW8      ----LRM--LRRKKQYI-----AFSL-LV---TCALGAFYYLTADKV-YEAKAQLLVTQT
A0A2E7ENQ5      ----FRI--IRHRRIQV-----VSCL-VA---TALLGALYYCTAAPL-YSARVSLMMM--
A0A7C2KUQ9      ----SMM--LRHKWLAL-----GLFV-GL---AVVLGGGVWWTTVPL-YKATA---VIEV
A0A7C5BZF0      ----WLA--IRYRRNLL-----LGAI-AA---SVAIGILYLLFATRY-YGATAQVLVVEA
A0A1G3AQE9      ----AVT--VRHRKNVV-----ILAL-AV---AAFLGALSYMTATRY-YSASAGVWVL--
A0A3L7UQT9      ----LHA--VRVRRGTL-----LAAL-LI---SASLGAAYYLTATRM-YDAHAQVRIVQS
A0A4P5YBU2      ----LHA--VRVRRGTL-----LAAL-LI---SASLGAAYYLTATRM-YDAHAQVRIVQS
A0A7C7V5U8      ----ALA--VRYRKHVL-----LVTL-LV---AALLGGLYYATATRY-YAARASLLVQHS
                                                                            

A0A5S9IJB5      --NLNLARDR-------------------------IDLSMFRNMQNY--LQTQ-------
A0A5S9IPR9      TKNTQGLPVNQTYY--------------------------------SKRLSTQ-------
A0A533Q9U4      KLNVGFQQVISESQ---------------------------FTPLDF--YTNQ-------
A0A533Q6B7      EFNVGIQQILSEDK------------------------------NIYNFYTDQ-------
A0A1U9NNE1      --LPNVLFDDA------------------------ETQDVMPNYQGF--MNTQ-------
A0A2G2JCA2      --SPYLAFQDRSDS--------------------------------RKFVANQ-------
A0A1G2XVR0      --TPKGLTFQA--------------------------FSFEGNNSSS--FTTN-------
A0A1G3B0P0      --TPKGLTFQA--------------------------FSFEGNNSSS--FTTN-------
A0A1E3X4X0      --ERVNVTGKDIQEV--------------------VTYDPYATRGEF--YKNQ-------
A0A286U4B3      --APKVLSFEEV-------------------------MSTEGGRTDF--YKTE-------
A0A5C6DDS2      --APKVLSFEDV-------------------------VNTGGGLADF--YKTE-------
A0A2E3GW02      --QPRMPIEGIDPL---------------------------SGQTDP--LSTH-------
A0A5B9QNZ7      --DPGLPMMAQNQ----------------------QGAPQQEIGDSL--LATH-------
A0A1Z8N7H5      --GMSQEDS--------------------------ALGIN-RNSQHL--MPTH-------
A0A1G2YPI3      --GPKIFAE--------------------------TQEGVMTQSKNY--LYTQ-------
A0A1U7CZ81      --QLSLYGQQ-------------------------NSNAQAQPIERF--IGTQ-------
A0A142YNY8      --QPELFGSS-------------------------SRGDGSSSIERI--IETA-------
A0A1U7GLS6      --QPDLFGGI-------------------------APGQANERTV-A--IETE-------
A0A532UIN2      --GPKIFSE--------------------------TETSVMTQSKNY--LYTQ-------
A0A0S8KNX5      --MADILTDV-------------------------PDSGEISNYSSF--MNTQ-------
A0A3D3UVZ8      --LADILSGE-------------------------QDRGEISNYESF--MNTQ-------
A0A517NFU9      --SSEVTNNGTIT---------------------GANASGDNIQEDQ--LATH-------
A0A5C5YWH4      --SSEVTSSGTLS---------------------GAAASGDSIQDDQ--LATH-------
A0A3D2TNK4      --NQDRVATVGDQ----------------------------SIVSNI--LDTH-------
A0A7C1Y4F0      --GPRIINE--------------------------YEGVM-ARSGNY--LYTQ-------
A0A6I0ENW6      --QRQIYKIE-------------------------ETGVM-PLYQQF--VNTN-------
A0A6L3A0B7      --QRQIYKIE-------------------------ETGVM-PLYQQF--VNTN-------
A0A0J1B4A0      --SGEVANTGVNN----------------------GAKDMASMQEDV--LSTH-------
A0A142WSB9      --ASLPINSQE------------------------------ARRYSD--RSQH-------
M5SZR3          --TPNTE----------------------------IKGQN-AFYNDY--MSTH-------
M5TW92          --TPNTE----------------------------IKGQN-AFYNDY--MSTH-------
A0A2S8FKY2      --DQPLAFK--------------------------------TIEQTN--RNDY-RTFKNT
A0A517N8P6      --NVPTNTGSASEIVVETAPNLAFIQAEMTSQDVLSDAIA--IGQLT--AFDETPADVSS
A0A432MJP4      --GRQPLKVTEA-----------------------DAGGG-EGGVDR--FPTY-------
M5UQ35          --SADLNRASSSS---------------------LLEGAT-TIEDVI--LSTH-------
A0A0S8FY64      --APQVSPFEDMQ--------------------------E-RRDKEY--FATQ-------
A0A1N6KFT7      --GGRPLNVSAYT---------------------DPNRIS-EGSEDP--VPTH-------
L0DFG4          --GGRPLNVTAYT---------------------DPNRIN-EGSEDP--VPTH-------
A0A5C5XXG1      --EGCQGCKRSTCQSKRFHVDDKSYRPVRLAKPVEPRQVL-TPPPPG--RRDK-------
A0A7C7YUM8      --ESTGGVLSEIA--------------------------S-LTSDPA--AEAE-------
A0A7C2AHI6      --GGESGLLANLS--------------------------L-LESTPA--AARE-------
A0A518BJJ1      --QPTGGVLGELA--------------------------A-LSSAPA--AASE-------
A0A518D182      --DGASATLSELS--------------------------L-FGSAPR--ASAE-------
A0A5C5WTY6      --RVEVGDS--------------------------DTSND-VVDEDV--LANH-------
A0A5C5Y033      --SAGLNNS--------------------------GTGTD-VVDEDV--LANH-------
A0A5C6G1Y2      --SAGLNNS--------------------------GTGTD-VVDEDV--LANH-------
A0A354PDV6      --NAGL--E--------------------------SNATN-VVEEDI--LANH-------
A0A5C6FZ02      --SSGL-AS--------------------------SSSNE-MVEEDI--LANH-------
M5TIT3          --SAGLEGD--------------------------STGQA-IVDEDI--LANH-------
A0A5M6CY44      --TAGLGGT--------------------------GTGTG-MVEEDT--LANH-------
F2AXG2          --SAGLGGD--------------------------STGTD-MVDEDI--LANH-------
M2BB46          --SAGLGGD--------------------------STGAD-MVDEDI--LANH-------
L7CLQ6          --SAGLGGD--------------------------TTGTD-MVDEDI--LANH-------
A0A0J1B719      --SAGLGGN--------------------------STGTD-MVDEDI--LANH-------
Q7UF18          --SAGLGGN--------------------------STGTD-MVDEDI--LANH-------
A0A2G1W1E0      --SAGLGGN--------------------------STGTD-MVDEDI--LANH-------
K5E235          --SAGLGGN--------------------------STGTD-MVDEDI--LANH-------
A0A5C6FFI9      --SSELTTSGTMS---------------------NSQASGDTIQEDL--LATH-------
A0A5C5WDJ1      --SSEMTSRGTIN---------------------GNSGSGESIRDDQ--LATH-------
A0A5C5X547      --DPMLI-FNTAD---------------------QVQTSA-ITYKLF--QSTQ-------
A0A353FIP5      --------EG-------------------------SAVGG-ILGDLS--MLSS-APPATA
A0A5B1CIK7      --SAGLG-SE-------------------------GNATN-VVDEDI--LANH-------
A0A5C5WHS2      --SAGLG-AG-------------------------SAATD-IIDEDI--LANH-------
A0A5C6B6G8      --TAGLGEGS-------------------------ATGQG-MVEEDT--LANH-------
A0A5C5ZZN3      --SAGLG-GD-------------------------STGQS-IVDEDI--LANH-------
A0A5C5XS91      --SAGLD-SD-------------------------GTGQE-MVEEDI--LANH-------
A0A5C6C4E6      --SAGLD-KD-------------------------GTGQE-MVEEDI--LANH-------
A0A2E1VVJ1      --------SG-------------------------GFQSG-FLSEVA--VLSPVQPPESK
A0A3M2AEL0      --------PE-------------------------GSEQS-LLREFT--LFEQ-SPATLA
A0A2A2W9R6      --SSEMASTGVRG---------------------TSDGAV-TMQDEI--LSTH-------
A0A518HKC1      --SSEMASTGVRG---------------------TSDGAV-TMQDEV--LSTH-------
A0A518L3P0      --SSEMASTGVRS---------------------TSDGAV-TMQDEI--LSTH-------
A0A255R1S0      --SSQLATTGVRE---------------------ASDNAV-TIQDKI--LSTH-------
A0A5B9MKP1      --STKVAATGVRD---------------------ASDGAV-TMQEEI--LSTH-------
A0A0S8J591      VDTPDVIEAGARRM---------------------ATEEF---------YNSQ-------
M5RT57          --APFIAYTTPEPQ---------------------MNPED------F--TETQ-------
A0A351FYP6      --TSDIAPLLGMQA---------------------TQSSFDPY---F--ISTE-------
A0A2E7ESJ6      --QPPTIPLTGVES---------------------QYITTSA-------EAKH-------
A0A2D5AWU0      --EVDPLNGNAGST---------------------GKART------L--LKQQ-------
A0A1G2YQB7      --ISSILFGGEEAI---------------------PMYRS------Y--MYTQ-------
A0A353P687      --ISSILFGGEEGI---------------------PMYRN------Y--MYTQ-------
A0A356EME5      --PPALVFAIEDKS---------------------SGY-----------VETQ-------
L0DC26          --KPRILLQTGEVQ---------------------SDYGS------Y--QRTQ-------
A0A3L7P4E4      --QAEMPVNTVNGL---------------------APNGR------SDPLASD-------
A0A3L7PEB5      --QADMPVNSVNGF---------------------DPSGQ------SDPLASD-------
A0A1U9NL64      --GPKILDETQGVM---------------------TQSKN------Y--LYTQ-------
A0A2N1UCJ3      --GPKLIADYEGTM---------------------TQSKN------Y--LYTQ-------
A0A7C4EK84      --GPRILSDSPWDR---------------------TSF-N------Y--LNTQ-------
A0A7C3F0T2      --TPKIIPGTEELT---------------------FGPWN------Y--LNTQ-------
A0A2E0X4J3      --MPQIIDSGMGLS---------------------QSK-G------F--LYTQ-------
A0A5C5YU10      --LPKLLSSDMQLG---------------------HSN-S------Y--LFTQ-------
A0A517MPZ6      --LPQIFASDAQRG---------------------TSS-S------Y--LYTQ-------
A0A5C6CNV7      --MPRILEQEVQLG---------------------NSA-S------Y--LYTQ-------
A0A518K5H4      --LPSVLAGESLGA---------------------FST-K------H--LYTQ-------
A0A5C6AA28      --LPRALNGDALGT---------------------FSN-K------Y--LFTQ-------
A0A2E9VK20      --SPIEIREEGNRI---------------------IAG--------E--RSAH-------
A0A3D4PJK1      --SPIEIREEGNRI---------------------IAG--------E--RSAH-------
A0A532UT69      --GPKIITETEQGV---------------------LTQSKN-----Y--LYNQ-------
A0A355AI52      --SRENNPTSMTGS---------------------HNDVA------A--MATY-------
A0A354PCQ3      --YVVFQGVMPVVK---------------------N----------L--AQTE-------
A0A0S8GZ23      --VADLLTGAHESG---------------------GISNYDI----Y--VNTQ-------
A0A1I3DDV4      --DMRASDKGESSW---------------------AADGVQDE---I--LANH-------
A0A2E0SMM6      --GGFDTDDVSGQA---------------------LLKN-------Q--MPTY-------
A0A3L7SI46      --DGNVLDTTNQSN---------------------QRSIQD-----I--MPTY-------
A0A356KTN1      --APDPTRARYEMY---------------------SSDYVATE---Y--LNTQ-------
A0A5B9PJZ8      --SAPSISEEDGYA---------------------QD---------T--VEKY-------
A0A2S8G191      --QGSLLKQDGEKT---------------------GDFDV------Y--KLTH-------
A0A2E7EGG1      --QPYVAFPDREVR---------------------DRDSNRK----F--VHTQ-------
A0A2E2N5A9      --RAKLLAIEQANQ---------------------NETLNND----F--LQTE-------
A0A7C8AGA2      --VSPILFETEDRL---------------------PNYQN------F--MNTQ-------
A0A7C2FXP7      --LTNIMSGEHDRG---------------------EISNYHS----F--MNTQ-------
A0A2E3GWC6      --TSVPLGDDDNRP---------------------TAG--------E--RSAH-------
F0SLB0          --TSVPLGDDDNRP---------------------TAG--------E--RSAH-------
A0A3L7NDH9      --QGDSLDTSLTGG---------------------RNDPT------A--MATY-------
A0A1N6DAJ8      --QPRILLKVGENE---------------------SDYVA------Y--QRTQ-------
A0A532UD06      --GPKIINEYEGVM---------------------TQSHN------Y--LYTQ-------
A0A660URN1      --GPKIITEYKGVM---------------------TQSKN------Y--LYTQ-------
A0A517ZCB5      --GSSVLDSERNPQ---------------------GTLSD------Q--MPNF-------
A0A225EH48      --KPIVSAGKQSMG---------------------EDFES------F--KQTQ-------
A0A518INW8      --ATELMTSSGPDG---------------------RSFDANVVQADL--LATH-------
A0A518JPH9      --ASELMTSNSPNG---------------------RSFDASVVRADL--LATH-------
A0A5C5VEK8      --LPNLLGAEYQVG---------------------RSNS-------Y--LFTQ-------
A0A532UTJ0      --IADIMTDEGDHG---------------------GISNYES----F--MNTQ-------
A0A432MFP3      --QANPYGSLEDPR---------------------SIE--------Y--LQTQ-------
A0A2E2CCW9      --NPVPIKEGEIQT---------------------FG---------E--LTAH-------
A0A3C0AGX3      --NPVPIKEGEIQT---------------------FG---------E--LTAH-------
A0A518AAQ5      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A517QBG9      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A518FTU3      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A517WHH5      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A5A8BGT3      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A2E7K7A9      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A517PTS5      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A6I6AH34      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A517VTK3      --NPVPIKEGEIQT---------------------FG---------E--LTAH-------
A0A517WQT4      --NPVPIKEGEIQT---------------------FG---------E--LTAH-------
A0A517VID8      --NPVPIKEGEIQT---------------------FG---------E--LTAH-------
A0A517RK10      --NPVPIKEGEVQT---------------------FG---------E--LTAH-------
A0A518IH18      --NAVPIKEGEAQT---------------------FG---------E--LTAH-------
A0A5C5XLF4      --NPVEIREGGNRV---------------------IVG--------E--RSAH-------
A0A2D5NDU9      --VNAKAGPEVMAL---------------------GFGATN-----Y--AQTQ-------
A0A1P8WP26      --GSGVTQDSVQGA---------------------SDPSR------S--MPTF-------
A0A3L7V1F3      --GGNVTEETPNSG---------------------SSANS------D--MPTF-------
D5SZ21          --GSKVLDGAPEGA---------------------AMKD-------L--MPTY-------
A0A286RGB6      --VQSVLFPTQQGA---------------------GPSFDI-----Y--KATQ-------
A0A518CHE5      --GGFQTDDVSGQS---------------------LLKN-------Q--MPTY-------
A0A1V5N3W2      --IPSILFSDKDSE---------------------GVIPMYES---F--MNTQ-------
A0A3E0MY27      --EVIIDAQSRSDG---------------------RRIDD------P--LQTH-------
A0A7C4Z5R7      --PPRGVLTESTPA---------------------SDIAA------F--QRTT-------
A0A2E0X9P6      --VPFVAFEQPSTV---------------------RDEAR------Y--FNTQ-------
A0A286RLF2      --GDNALSPTIEAQ---------------------GSRENS-----L--IPTF-------
A0A517NSK8      --SADMVNGASSNT---------------------SVEGANTDGD-V--LSTH-------
A0A5C5Z0D6      --SGDLVKGATSDS---------------------SVEGAEAAED-V--LSTH-------
M5UE94          --SGDLVRGANSSS---------------------SVEGVDTKED-V--LSTH-------
A0A2E8FLY0      --GSNVLKTEQENQ---------------------GGVQE------N--MATN-------
A0A3D2U1E1      --GSNVLQESMESQ---------------------GGVRE------N--MANY-------
E8R3W3          --GRSIVFNNGVSM---------------------GDAHA------Y--MRTQ-------
A0A5C5ZM48      --SPYVVFKDEETA---------------------LDAKR------F--VETQ-------
A0A5B9WF77      --QNDPFSAFSNPA---------------------LSGQAPT----Y--LKTQ-------
A0A518BBX8      --KPTLMTDRAGLP---------------------VSHFED-----Y--VETH-------
A0A1P8WN28      --SADPKSQSNSAT---------------------EG---------L--LASY-------
A0A3B9CTT0      --GSD-MANFGAPL---------------------EA---------A--MAGY-------
A0A518ALT3      --IPYIAFDSNNSN---------------------SRDSDR-----Y--VQTQ-------
A0A3M1QRP3      --RDMIAFKTDNDG---------------------ITHFYQQ----F--LTTQ-------
A0A517TMV0      --SGEDLASISEQS---------------------GTDS-------L--MATQ-------
A0A3E0MY88      --GGSEGSSSMGID---------------------GENRR------Y--MPTH-------
A0A5B9QF68      --KQDQLATVGDHE---------------------SSED-------T--MATH-------
A0A5B9QGF0      --KQDHLATVGDHE---------------------SSED-------T--MATN-------
A0A5C6CK24      --KQDHLATVGDHE---------------------SSED-------T--MATN-------
A0A2E3RCU8      --GSADHGNVLGVN---------------------RNDQQ------L--MPTH-------
A0A1C3E6N1      --GSKVLDG-APEG---------------------AAMKD------L--MPTY-------
A0A518GJT2      --GSKVLDGAAPEG---------------------AAMKD------L--MPTY-------
A0A2E8B0L9      --GTDILNSTMMPN---------------------AQQDA------L--IPTY-------
A0A5Q4GFE7      --GPDILSPTLTAE---------------------SSRQA------L--IPTY-------
A0A257WS34      --NGNALDGKDNNQ---------------------QSIQN------L--MPTY-------
A0A7C4LP10      --GGNVLDQRDATP---------------------KTIQD------Q--MPTY-------
A0A517MLW3      --SIGVFPGASPTA---------------------QSN--------K--LPTQ-------
A0A5B9QVD0      --GLGMLPGSGVMA---------------------QPN--------K--LPTQ-------
A0A3A0DET7      --LPRVLESEAPVV---------------------QSAT-------Y--LYTQ-------
A0A3B8PNV4      --GSNVLQNDQENQ---------------------GGVQE------N--MATN-------
A0A3D1DR40      --GSNVLQNDQENQ---------------------GGVQE------N--MATN-------
A0A2E7RYU8      --GSNVLQNDQENQ---------------------GGVQE------N--MATN-------
A0A3B8LXG8      --GSNVLQNDQENQ---------------------GGVQE------N--MATN-------
A0A286RD13      --RPRVLFDTKDDD---------------------PLLRN---------RQTQ-------
A0A2E3GWX1      --GEGNMDETQQSQ---------------------RTLQD------H--LPTY-------
F0SG60          --GEGNMDETQQSQ---------------------RTLQD------H--LPTY-------
A0A2E9VST2      --GEGNVDQTQQSQ---------------------RTLQD------Y--LPTY-------
A0A356A6X2      --GDGNVDQTQQSQ---------------------RTLQD------Y--LPTY-------
A0A5C5XLM3      --GDGNVDQTQQSQ---------------------RTLQD------Y--LPTY-------
A0A7C5FXU1      --EAILFSNAFQSA---------------------TFD-I------Y--RSTQ-------
A0A3M1VCL4      --NASVLQEQQSTP---------------------RAVLD------Q--LPTL-------
A0A5C5V7Z9      --DSDKVSGVADAG---------------------RAD-D------V--MATH-------
A0A5C5YT05      --DPDSVSSVAEGG---------------------RAD-D------L--MATH-------
A0A518D7F9      --NPDQLSSMGDQA---------------------GSD-N------V--TANH-------
A0A5C5ZIP0      --VADELSSMSDQI---------------------GSD-N------L--MTTH-------
A0A518KBK3      --SAGELTTMNDQA---------------------GAD-N------L--MATH-------
A0A5C6AKF9      --SGGEMVSLNEQA---------------------GAD-N------L--MATH-------
A0A6M5Z0K7      --ELKVIQEGSRSN---------------------DGGI-------Y--MRTQ-------
A0A350CI62      --GSGVTSDATSNS---------------------ANPVT------E--MPTY-------
A0A4P5WQK6      --GSGVTSDATSNS---------------------ANPVT------E--MPTY-------
A0A3C1X4W5      --GSGVTADATSTS---------------------ANPVT------E--MPTY-------
A0A3D3W3A7      --GSGVTADATSTS---------------------ANPVT------E--MPTY-------
A0A518DRX3      --GPDVMSGSTPAA---------------------SGGDS------L--IPTY-------
A0A518DZF9      --GPDVMSSGTASA---------------------ASGDS------L--IPTY-------
A0A518AKT8      --KLLINERKADEL---------------------TSVGDQIANDDL--MANQ-------
A0A5C5ZR72      --PQYVAFRSGSVD---------------------AGGRKFIQ--------TQ-------
A0A7C5R0U3      --TVLVSPRTADAS---------------------EQGGRSLRLADV--MPTY-------
A0A517TY85      --PTFIAFAQDKVS---------------------ATDDRYVQ--------TQ-------
A0A5B9QEI7      --TPFIAFQQGALN---------------------KDSERYVQ--------TQ-------
F0SI78          --QPRMPIEGIDPL---------------------SGQTD------P--LSTH-------
A0A517MDV3      --DPGLPQMSDSQT---------------------GAAPQQEVGDAL--LATH-------
A0A518IQ30      --SPDMLNAGVSSS---------------------VTNDT------L--VATH-------
A0A517LWP4      --SPDMLNAGVSSN---------------------LNNDA------L--VATH-------
A0A518JNW8      --SPDMLNAGVSSN---------------------LNNDA------L--VATH-------
A0A2E7ENQ5      -------YHGGEDS---------------------LTGSDTYRRG-M--LPTY-------
A0A7C2KUQ9      --SPIIQRILYRTD---------------------DNGPIQWYTE-Y--LNMQ-------
A0A7C5BZF0      --D----DERGTPN---------------------FASEDRWQRT-L--MPTH-------
A0A1G3AQE9      -------ELGSSSA---------------------GSVEDNLHQT-Q--LPTQ-------
A0A3L7UQT9      --ERNHDSLTSSPQ---------------------SSQANSDVFQ-M--MATY-------
A0A4P5YBU2      --ERDHNSLTSSPQ---------------------SSQANSDVFQ-M--MATY-------
A0A7C7V5U8      --GSDITETSLRPE---------------------GNRNQG-----L--MPTF-------
                                                                            

A0A5S9IJB5      -YDLIVS----------------------TPLL-----------QKTFDHFNFA------
A0A5S9IPR9      -VAILQS----------------------RAMA-----------KKVIERLPEAICLSFF
A0A533Q9U4      -CEIIKS----------------------RSIA-----------KKVIDTLNLKNDPVFN
A0A533Q6B7      -CEIIKS----------------------RLIA-----------KKVIDILDLKNHPGFN
A0A1U9NNE1      -AELMSS----------------------NEIL-----------NRVAEDMAKRGIRICE
A0A2G2JCA2      -VALMRS----------------------HIVL-----------GSVVSNKDVS------
A0A1G2XVR0      -ERILRS----------------------RSLA-----------QKVLSTMDYKDSPEFN
A0A1G3B0P0      -ERILRS----------------------RSLA-----------QKVLSTMDYKDSPEFN
A0A1E3X4X0      -HEILKS----------------------RSLA-----------KRVIEELKLGNGPEL-
A0A286U4B3      -CEVLKS----------------------LTLA-----------KRVVDSLRLDLDPEF-
A0A5C6DDS2      -CEVLQS----------------------RTLA-----------KRVINRLRLDLHPEF-
A0A2E3GW02      -IALFNT----------------------PVIL-----------KKAVE-----------
A0A5B9QNZ7      -MEIIRS----------------------PRVI-----------GDAVD-----------
A0A1Z8N7H5      -QQLIVS----------------------QPVL-----------ENAIQ-----------
A0A1G2YPI3      -AELLKS----------------------TPIL-----------TAVLD-----------
A0A1U7CZ81      -IAFITT----------------------NTVL-----------KPAIG-----------
A0A142YNY8      -RAALIS----------------------DRVL-----------NGAII-----------
A0A1U7GLS6      -MGRIRT----------------------DRVI-----------NDALG-----------
A0A532UIN2      -SELLKS----------------------TPIV-----------AAVLD-----------
A0A0S8KNX5      -AEMITS----------------------SRVV-----------RRVAD-----------
A0A3D3UVZ8      -AEKITS----------------------NSVV-----------QRVAD-----------
A0A517NFU9      -LRLFVG----------------------RRML-----------AEAIQ-----------
A0A5C5YWH4      -MRLFVS----------------------RRLL-----------SDAIK-----------
A0A3D2TNK4      -SDLVTS----------------------PVVI-----------EQAIE-----------
A0A7C1Y4F0      -GELLRS----------------------TPVI-----------GPVVD-----------
A0A6I0ENW6      -VMLIRG----------------------AGVL-----------NPVLN-----------
A0A6L3A0B7      -VMLIRG----------------------AGVL-----------NPVLN-----------
A0A0J1B4A0      -MELFAS----------------------PKIL-----------ENAIQ-----------
A0A142WSB9      -VHFLTS----------------------DAIA-----------AIAIE-----------
M5SZR3          -QALIKS----------------------SVII-----------SRASQ-----------
M5TW92          -QALIKS----------------------SVII-----------SRASQ-----------
A0A2S8FKY2      QRQLMVT----------------------PFVL-----------NSALS-----------
A0A517N8P6      LINMIRA----------------------NLVL-----------SPPFE-----------
A0A432MJP4      -AAILSS----------------------PHIV-----------GRAIE-----------
M5UQ35          -MELFRS----------------------RKVI-----------ERAIS-----------
A0A0S8FY64      -VSLITS----------------------RAVL-----------DKALED----------
A0A1N6KFT7      -MVLIRS----------------------PLVI-----------QAAVDS----------
L0DFG4          -MVLIRS----------------------PLVI-----------QTAVES----------
A0A5C5XXG1      -LAAVKG----------------------RSVY-----------SL--------PPLGPD
A0A7C7YUM8      -IALIQS----------------------RSLA-----------EVTVGPQAPWPADIAL
A0A7C2AHI6      -MALLSS----------------------RSLI-----------ETTAGS----PASPRS
A0A518BJJ1      -IALLRS----------------------RSLA-----------EKTIQS----PP----
A0A518D182      -IALLSS----------------------RALA-----------EQVVAT----PA----
A0A5C5WTY6      -VELIRS----------------------RRTI-----------ESALN-----------
A0A5C5Y033      -MGLIRS----------------------RKIV-----------SEALA-----------
A0A5C6G1Y2      -MGLIRS----------------------RKIV-----------SEALA-----------
A0A354PDV6      -MQMLRS----------------------RKIV-----------EGALT-----------
A0A5C6FZ02      -IELLLS----------------------RKIV-----------GEAMAA----------
M5TIT3          -IELIQS----------------------RMIV-----------GEALE-----------
A0A5M6CY44      -IELISS----------------------RMIV-----------DEALK-----------
F2AXG2          -MELLLS----------------------RKIV-----------GEALDP----------
M2BB46          -MELLLS----------------------RKIV-----------GEALDP----------
L7CLQ6          -MELIQS----------------------RMIV-----------GEALE-----------
A0A0J1B719      -MELIQS----------------------RMIV-----------GEALE-----------
Q7UF18          -MELIQS----------------------RMIV-----------GEALE-----------
A0A2G1W1E0      -MELIQS----------------------RMIV-----------GEALE-----------
K5E235          -MELIQS----------------------RMIV-----------GEALE-----------
A0A5C6FFI9      -VQLLTS----------------------RLLI-----------SDAIA-----------
A0A5C5WDJ1      -MRLFIA----------------------RKVL-----------TQAIE-----------
A0A5C5X547      -AQLIRS----------------------DLNI-----------SQVLE-----------
A0A353FIP5      ELEVLQS----------------------RMIVDPVV-------APQSE-----------
A0A5B1CIK7      -IELLQS----------------------RLIV-----------GEALE-----------
A0A5C5WHS2      -MELLQS----------------------RLIV-----------GEALE-----------
A0A5C6B6G8      -MELIAS----------------------RMIV-----------GDALQ-----------
A0A5C5ZZN3      -IELIQS----------------------RMIV-----------GEALE-----------
A0A5C5XS91      -IQLIKS----------------------RMIV-----------GEALE-----------
A0A5C6C4E6      -IQLIKS----------------------RMII-----------GEALQ-----------
A0A2E1VVJ1      EAEILGS----------------------RKLVRMVAAHPLSTDGPEFA-----------
A0A3M2AEL0      EMEVLGS----------------------RAVAQAVA---LPKGESDLA-----------
A0A2A2W9R6      -IELFGS----------------------PKVL-----------QQAID-----------
A0A518HKC1      -IELFSS----------------------PKVL-----------QQAID-----------
A0A518L3P0      -IELFGS----------------------PKVL-----------QQAID-----------
A0A255R1S0      -IALMTS----------------------PKVL-----------GQAAD-----------
A0A5B9MKP1      -VELFGS----------------------PKIL-----------KQAIE-----------
A0A0S8J591      -VENLRS----------------------RRIA-----------RKLYNDMGMYNWEYFR
M5RT57          -IELIRS----------------------SLVA-----------EQV-----------LD
A0A351FYP6      -FEKIQS----------------------QKVL-----------DEV-----------VK
A0A2E7ESJ6      -AIVIVS----------------------PRIL-----------TQA-----------FD
A0A2D5AWU0      -QILVKS----------------------PAIL-----------KPL-----------SE
A0A1G2YQB7      -ADLIIS----------------------DRVL-----------QRV-----------VD
A0A353P687      -ADLITS----------------------DRVL-----------QRV-----------VD
A0A356EME5      -KEMIRS----------------------ARVL-----------RPV-----------VE
L0DC26          -LALLES----------------------RLVL-----------SAA-----------LK
A0A3L7P4E4      -IQTIMS----------------------ELTV-----------RPA-----------IS
A0A3L7PEB5      -VRLILS----------------------EVTV-----------GPA-----------IT
A0A1U9NL64      -AELMKS----------------------TPII-----------KEA-----------IE
A0A2N1UCJ3      -SEIIKS----------------------TPII-----------AKV-----------VQ
A0A7C4EK84      -AELMRS----------------------TPIL-----------AGA-----------LE
A0A7C3F0T2      -CALFKS----------------------TPIA-----------ASA-----------LD
A0A2E0X4J3      -AEMLRS----------------------TPVL-----------AAA-----------LE
A0A5C5YU10      -KELIKS----------------------TGVL-----------ASV-----------AD
A0A517MPZ6      -AELITS----------------------TPVL-----------AAA-----------AN
A0A5C6CNV7      -AELIRS----------------------TPVL-----------AAA-----------AE
A0A518K5H4      -AQLICS----------------------PSVL-----------NAA-----------IE
A0A5C6AA28      -AELIRS----------------------SSVL-----------SAA-----------VE
A0A2E9VK20      -VEIIRS----------------------PKVV-----------ERA-----------VR
A0A3D4PJK1      -VEIIRS----------------------PKVV-----------ERA-----------VR
A0A532UT69      -AALLKS----------------------TPIL-----------TAV-----------LN
A0A355AI52      -EKLVSS----------------------PLVL-----------QSA-------STLLEA
A0A354PCQ3      -KALFLN----------------------PIVL-----------GPV-----------LA
A0A0S8GZ23      -AQIIRD----------------------NRVL-----------QNV-------ADVLDD
A0A1I3DDV4      -MEIVSS----------------------RRII-----------GNA-------LQRVNA
A0A2E0SMM6      -TRLLSS----------------------DHVL-----------QSA-------AMQLPP
A0A3L7SI46      -QKVLTS----------------------DRVL-----------EGA-------ITRLPN
A0A356KTN1      -MRILES----------------------HSLA-----------VDA-------VKANPK
A0A5B9PJZ8      -IEILRS----------------------TATL-----------KNA-----------IR
A0A2S8G191      -RQLLRG----------------------PFVI-----------NAA-----------LR
A0A2E7EGG1      -VELLRS----------------------PLIL-----------GRV-------LSQPEI
A0A2E2N5A9      -IELLKSRGLAERVVRQLDLVNHPEFAAQPLSV-----------GQGVGTWFARLGAFVR
A0A7C8AGA2      -AELIRS----------------------NNIL-----------NDV-----------AD
A0A7C2FXP7      -AVMITS----------------------GKVV-----------ERV-------ADDLST
A0A2E3GWC6      -VEIIRS----------------------PRVI-----------ERA-----------VH
F0SLB0          -VEIIRS----------------------PRVI-----------ERA-----------VH
A0A3L7NDH9      -EKLIAS----------------------PLVL-----------ESA-------AKLLDG
A0A1N6DAJ8      -LALLKS----------------------RLVL-----------STA-----------LK
A0A532UD06      -SELIRS----------------------IPII-----------SDA-----------VN
A0A660URN1      -GELIKS----------------------TPIV-----------ANV-----------AD
A0A517ZCB5      -ERVLRS----------------------DEVV-----------KRT-------LKQLPP
A0A225EH48      -MRLLKT----------------------RMLL-----------DRV-----------VS
A0A518INW8      -IALLES----------------------PMIL-----------NDAIESGKLSDLDSFV
A0A518JPH9      -IALLKS----------------------PMIL-----------NDAIEVGNLSDLDSFV
A0A5C5VEK8      -AELIRS----------------------TGVL-----------AAV-----------AE
A0A532UTJ0      -AEKVTS----------------------SSVV-----------QRV-------ANALVD
A0A432MFP3      -IQLITS----------------------PRVL-----------SVA-----------KL
A0A2E2CCW9      -IDVIKS----------------------PRIV-----------GEA-----------VK
A0A3C0AGX3      -IDVIKS----------------------PRIV-----------GEA-----------VK
A0A518AAQ5      -IDVIKS----------------------PRIV-----------GQA-----------VK
A0A517QBG9      -IDVIKS----------------------PRIV-----------GQA-----------VK
A0A518FTU3      -IDVIKS----------------------PRIV-----------GQA-----------VK
A0A517WHH5      -IDVIKS----------------------PRIV-----------GQA-----------VK
A0A5A8BGT3      -IDVIKS----------------------PRIV-----------GQA-----------VK
A0A2E7K7A9      -IDVIKS----------------------PRIV-----------GQA-----------VK
A0A517PTS5      -IDVIKS----------------------PRIV-----------GQA-----------VK
A0A6I6AH34      -IDVIKS----------------------PRIV-----------GQA-----------VK
A0A517VTK3      -IDVIKS----------------------PRIV-----------GEA-----------VK
A0A517WQT4      -IDVIKS----------------------PRIV-----------GEA-----------VK
A0A517VID8      -IDVIKS----------------------PRIV-----------GEA-----------VK
A0A517RK10      -IDVIKS----------------------PRIV-----------GEA-----------VK
A0A518IH18      -IDVIKS----------------------PRIV-----------GEA-----------VK
A0A5C5XLF4      -VEIIRS----------------------PKVV-----------ERA-------VRDSHL
A0A2D5NDU9      -AEVIVS----------------------GEIL-----------RSA-------LTRFHE
A0A1P8WP26      -RRLMAD----------------------DEVM-----------RRA-------LERLPE
A0A3L7V1F3      -IELMSR----------------------DEVI-----------VRA-------LKTLPK
D5SZ21          -ERIMQG----------------------DIVL-----------ADA-------AQKLPV
A0A286RGB6      -LEYLRS----------------------RFVL-----------VAA--------LRQPE
A0A518CHE5      -TRLLSS----------------------DRVL-----------ETA-------ASHLPP
A0A1V5N3W2      -ADIIVS----------------------DQVI-----------QRVADELADKKLALFE
A0A3E0MY27      -IQLIKS----------------------PFVI-----------NTA-------LSEPGI
A0A7C4Z5R7      -LASIKT----------------------RSVL-----------TAA-------IHKLEA
A0A2E0X9P6      -IELLRG----------------------TVV----------------------LIPLLG
A0A286RLF2      -VNLITS----------------------AKVL-----------EGA-------IQKLSR
A0A517NSK8      -IQLMTS----------------------RRIL-----------KKAIA-----DHELTD
A0A5C5Z0D6      -IELMTS----------------------RRIL-----------QTAID-----KHGLED
M5UE94          -IQLFSS----------------------RRIL-----------KSAIE-----KHDLDE
A0A2E8FLY0      -QGVLTS----------------------DVVL-----------EEA-------LQKLPE
A0A3D2U1E1      -QGVLTS----------------------DLVL-----------EEV-------LQKLPA
E8R3W3          -SQLLRS----------------------PIVV-----------EDALK-----DEKYKG
A0A5C5ZM48      -VELIRS----------------------PMVV-----------APLLGDPA--IAQLEI
A0A5B9WF77      -LVSVTS----------------------DPVL-----------AGA----------FVV
A0A518BBX8      -QVLIES----------------------PLIV-----------ERA-------IRTNPE
A0A1P8WN28      -RQLLLS----------------------DRVL-----------TDT-------VKELKS
A0A3B9CTT0      -KHLMLS----------------------DKSL-----------TQT-------AENLDP
A0A518ALT3      -IETMKS----------------------PIVL-----------GPL-------LSRPSV
A0A3M1QRP3      -IHKITS----------------------ARVI-----------ERVLE-----RDDVRQ
A0A517TMV0      -REVVRS----------------------SEVI-----------RRA-------IERLSP
A0A3E0MY88      -EQLLKS----------------------AVVL-----------SG--------VRQLVE
A0A5B9QF68      -QKLIAS----------------------PIVL-----------QNA-------IKRLPP
A0A5B9QGF0      -RKLISS----------------------PIVL-----------QNA-------IKQLAP
A0A5C6CK24      -QKLIAS----------------------PIVL-----------QNA-------IKQLSP
A0A2E3RCU8      -QQLIVS----------------------QPVL-----------ENA-------IQHIPS
A0A1C3E6N1      -ERIMQG----------------------DIVL-----------ADA-------AQKLPV
A0A518GJT2      -ERIMQG----------------------DIVL-----------ADA-------AQKLPV
A0A2E8B0L9      -ERLFSS----------------------AVVL-----------DGAIQ-----RLLKSP
A0A5Q4GFE7      -ERLFTT----------------------QEVL-----------EGAIE-----SLLQGP
A0A257WS34      -QKVLLS----------------------DAVI-----------EGA-------IKGLPS
A0A7C4LP10      -QRLMLS----------------------DKVL-----------EAA-------IKSLPA
A0A517MLW3      -EKIIRS----------------------DRVL-----------KQALD-----QLRQMD
A0A5B9QVD0      -EKILRS----------------------DRVV-----------QSTLR-----SLREQP
A0A3A0DET7      -AELIRS----------------------TPVL-----------AAA--------ADAPE
A0A3B8PNV4      -QGVLTS----------------------DVVL-----------EEA-------LQKLPA
A0A3D1DR40      -QGVLTS----------------------DVVL-----------EEA-------LQKLPA
A0A2E7RYU8      -QGVLTS----------------------DVVL-----------EEA-------LQKLPA
A0A3B8LXG8      -QGVLTS----------------------DVVL-----------EEA-------LQKLPA
A0A286RD13      -TTLVTS----------------------NRVL-----------TAA-------LQRPGI
A0A2E3GWX1      -TKVLSS----------------------EEVL-----------KGT-------LQRLPR
F0SG60          -TKVLSS----------------------EEVL-----------KGT-------LQRLPR
A0A2E9VST2      -TKVLAS----------------------DEVL-----------KGA-------LLRLPD
A0A356A6X2      -TKVLAS----------------------DEVL-----------KGA-------LVRLPD
A0A5C5XLM3      -TKVLAS----------------------DEVL-----------KGA-------LVRLPD
A0A7C5FXU1      -QQYLVS----------------------RYVL-----------MAA-------LRQ--P
A0A3M1VCL4      -QEVVVS----------------------DRVL-----------EDA-------IERLSP
A0A5C5V7Z9      -RELVKS----------------------PVVL-----------QNA-------IANLPP
A0A5C5YT05      -RELVKS----------------------PVVL-----------QNA-------ISDLPP
A0A518D7F9      -QQIVRS----------------------PVVV-----------REA-------IQALEP
A0A5C5ZIP0      -KDLVRS----------------------PVVV-----------RNA-------IEQLKP
A0A518KBK3      -RELVKS----------------------SEVV-----------TRA-------IERLAP
A0A5C6AKF9      -RELVKS----------------------SEVV-----------SRA-------IDRLGP
A0A6M5Z0K7      -LALIKS----------------------RPVL-----------QDA-------VSSAEV
A0A350CI62      -IALMSE----------------------EEVI-----------ARA-------LRIMPE
A0A4P5WQK6      -IALMSE----------------------EEVI-----------ARA-------LRIMPE
A0A3C1X4W5      -IALMSE----------------------EEVI-----------ARA-------LKILPE
A0A3D3W3A7      -IALMSE----------------------EEVI-----------ARA-------LKILPE
A0A518DRX3      -EKLFTS----------------------AVVL-----------NSAVE-----KLQDAP
A0A518DZF9      -EKLFTS----------------------AVVL-----------NSAVE-----KLQDAP
A0A518AKT8      -RDLVTS----------------------AIVV-----------SNALA--------NLD
A0A5C5ZR72      -IELMRN----------------------PVVL-----------RETLA----------D
A0A7C5R0U3      -VKLFGS----------------------RTVL-----------TRAAE------RLAGV
A0A517TY85      -IELLRG----------------------PVVL-----------GPALDWSPQTKNGQKL
A0A5B9QEI7      -IELLRG----------------------PVVL-----------TPVLG----------R
F0SI78          -IALFNT----------------------PVIL-----------KKA-------VEDFRL
A0A517MDV3      -MEIIRS----------------------PRVI-----------GDAID----NRQLEEL
A0A518IQ30      -ERLIES----------------------SVVL-----------GGALD----RIRQLDS
A0A517LWP4      -ERLIES----------------------SVVL-----------GGALD----RIRKLDS
A0A518JNW8      -ERLIES----------------------SVVL-----------GGALD----RIRKLDS
A0A2E7ENQ5      -ERLFYS----------------------SVVL-----------EQAAA----RIQELPA
A0A7C2KUQ9      -TAIIRS----------------------NTVL-----------QPV-------LEDPEI
A0A7C5BZF0      -RSILCS----------------------SAVV-----------AKA-------VGKLDA
A0A1G3AQE9      -VDIVRS----------------------DKVL-----------DAA-------VRQLRP
A0A3L7UQT9      -QRIMSG----------------------DRVL-----------SAA-------LEDLPK
A0A4P5YBU2      -QRIMSG----------------------DRVL-----------SAA-------LEDLPK
A0A7C7V5U8      -EKLVTE----------------------KKVL-----------KRA-------IQKLTR
                    .                                                       

A0A5S9IJB5      -------------------------------------------------EKEKFRNVPDP
A0A5S9IPR9      GRE----------------------------------------------RTDVTA-----
A0A533Q9U4      PPE------------------------------------KDEYPESAGNRTQDPSAETQF
A0A533Q6B7      PYK------------------------------------GIENPALAADNPSDPFTETYL
A0A1U9NNE1      PDM----------------------------------------------DPVAILKLMIN
A0A2G2JCA2      -------------------------------------------------STPELKNSVDI
A0A1G2XVR0      PVK--------------KANIFSIKELTRGNSSPTVRKPEPGKESQEPETPVKYDVDDAL
A0A1G3B0P0      PVK--------------KANIFSIKELTRGNSSPTVRKPEPGKESQEPETPVKYDVDDAL
A0A1E3X4X0      ----------------------------------------PSGSSKR-----------RL
A0A286U4B3      ----------------------------------------IGNSKALDGSVNKSVSMDRL
A0A5C6DDS2      ----------------------------------------IAKLKTKESDADKPVSVEKL
A0A2E3GW02      --------------------------------------------------DFRLGELSSI
A0A5B9QNZ7      --------------------------------------------------NRQLEALESI
A0A1Z8N7H5      ------------------------------------------YISPECLSEFQGQQRESW
A0A1G2YPI3      -----------------------------------------------TAGIQQMQTFSEV
A0A1U7CZ81      --------------------------------------------------DSTVAELPFI
A0A142YNY8      --------------------------------------------------DPQVSGLPFI
A0A1U7GLS6      --------------------------------------------------DATVSELPFI
A0A532UIN2      -----------------------------------------------VPGIAQMKTLAGV
A0A0S8KNX5      ---------------------------------------DLADRNLPFLEDEPTDPISKL
A0A3D3UVZ8      ---------------------------------------DLVGKNLFFFEAEPNDLVSNW
A0A517NFU9      --------------------------------------------------KGNLDQLASF
A0A5C5YWH4      --------------------------------------------------DGKLAELESF
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      -----------------------------------------------DPKIARLRTFADV
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      --------------------------------------------------------IAGL
A0A142WSB9      -----------------------------------------------KYGLKDIPGIANA
M5SZR3          --------------------------------------------------------LPEI
M5TW92          --------------------------------------------------------LPEI
A0A2S8FKY2      ---------------------------------------------------------RED
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      --------------------------------------------------QVGVENLPTL
M5UQ35          ------------------------------------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      LSY---------------------HFAVSPSIYGTLAILASSTGLLVDFIDLPIRPSIRM
A0A7C7YUM8      FDA---------------------TAPDFDPVASGDTTSMEGMGLETVVDAHDRRPSDGI
A0A7C2AHI6      TDG---------------------VFEVTPPDSMLQGDSMRRLGLETRVEAKDLTPFATL
A0A518BJJ1      -DG---------------------SIPTPENP-----HAQRNQGLTTVVESPDQQPVRRI
A0A518D182      -D-------------------------VLDAD-----ERARHLGLEAQVDDLARRPLAAA
A0A5C5WTY6      --------------------------------------------------QAGLIAEPSI
A0A5C5Y033      --------------------------------------------------EYGLMELPSL
A0A5C6G1Y2      --------------------------------------------------EYGLMELPSL
A0A354PDV6      --------------------------------------------------KDGLMDLASI
A0A5C6FZ02      -------------------------------------KDDD---------GNSLMTLPSV
M5TIT3          --------------------------------------------------QSNLMALPSI
A0A5M6CY44      --------------------------------------------------TNGLTEIESL
F2AXG2          -------------------------------------EDVKDEETGELIKREKLIDLPSV
M2BB46          -------------------------------------EPVKDEETDELIKREKLIDLPSV
L7CLQ6          --------------------------------------------------QTKLLDLPSI
A0A0J1B719      --------------------------------------------------QNELLDLPSI
Q7UF18          --------------------------------------------------QTELVNLPSI
A0A2G1W1E0      --------------------------------------------------QTELVDLPSI
K5E235          --------------------------------------------------QTELLDLPSI
A0A5C6FFI9      -------------------------------------TE----------------NLEKL
A0A5C5WDJ1      -------------------------------------LG----------DLTQYPSFAEI
A0A5C5X547      -------------------------------------LD-------------------SE
A0A353FIP5      -------------------------------------SSLGLNLTLRVDDLDRYSPWKLV
A0A5B1CIK7      -------------------------------------AN-------GLLEL------DSI
A0A5C5WHS2      -------------------------------------SN-------GLMNL------ESI
A0A5C6B6G8      -------------------------------------ETQVPGQDYSLMEL------PSI
A0A5C5ZZN3      -------------------------------------QN-------SLVSL------PSI
A0A5C5XS91      -------------------------------------QN-------ELSEL------PSI
A0A5C6C4E6      -------------------------------------QN-------DLATL------PSI
A0A2E1VVJ1      -------------------------------------QGLGIGLSIKVDDFDRYWPEASI
A0A3M2AEL0      -------------------------------------PEVGLGLSVTVDDVDRNWPWPAV
A0A2A2W9R6      -------------------------------------RA---------------------
A0A518HKC1      -------------------------------------RA---------------------
A0A518L3P0      -------------------------------------RA---------------------
A0A255R1S0      -------------------------------------EH---------------------
A0A5B9MKP1      -------------------------------------RE---------------------
A0A0S8J591      KLG----------------------------------------------PDRDPI-----
M5RT57          DSE--------------IAELPGLQ------------------------SIEKPI-----
A0A351FYP6      SCE--------------LREKWKKH------------------------YGGKQLTDVEA
A0A2E7ESJ6      NFN--------------LFRLPTFK------------------------DDPDPL-----
A0A2D5AWU0      SKA--------------LRGLKSFS--------------------REIIGSKPMI-----
A0A1G2YQB7      DLS--------------DKNI-IAS------DIEKPDPLKSVRNKWSAKKNSDLV-----
A0A353P687      DLS--------------DKNIKLME------EAKSRDPVTAVRNKFSKNNSSDLI-----
A0A356EME5      SPE--------------IRSLPELQ------------------------EKKDKV-----
L0DC26          QAS--------------VAKLPILT------------------------KMSDPI-----
A0A3L7P4E4      DGR--------------LRELPSLS------------------------GASNLT-----
A0A3L7PEB5      DGR--------------LKELPSLS------------------------GSPNLP-----
A0A1U9NL64      END--------------MASMRTFD------------------------EIDNPT-----
A0A2N1UCJ3      RSD--------------IKRLRTFEAKPESIAEKIKKQIGLAEPSFTTGEIDNLV-----
A0A7C4EK84      LA---------------AQKLPSLA------------------------DLNNGV-----
A0A7C3F0T2      RPG--------------IRDLRTFA------------------------GMTNPV-----
A0A2E0X4J3      APG--------------MAQLQAVR------------------------DSDSPV-----
A0A5C5YU10      SPM--------------ASGMETFR------------------------GVENRV-----
A0A517MPZ6      APE--------------SSQLETFR------------------------STDNPI-----
A0A5C6CNV7      QGE--------------NASLETFR------------------------DVDNRV-----
A0A518K5H4      APE--------------NVGIETFR------------------------NTDNPL-----
A0A5C6AA28      APE--------------NAALETFR------------------------KTDNPV-----
A0A2E9VK20      DSQ--------------LDQLATLA------------------------GSEEPA-----
A0A3D4PJK1      DSQ--------------LDQLATLA------------------------GSEEPA-----
A0A532UT69      DHN--------------ARQMQTFT------------------------GAGNPI-----
A0A355AI52      PVR----------------ELFGSQ------------------------DSEILA-----
A0A354PCQ3      DAD--------------LRRAPSLS------------------------DPEIAE-----
A0A0S8GZ23      NNT-------------------LLG------------------------TGIDRI-----
A0A1I3DDV4      EEM--------------PGIKAHTD------------------------SKTDAV-----
A0A2E0SMM6      EHQ---------------IDIGG-T------------------------PLEMQV-----
A0A3L7SI46      AHR---------------IDLKG-T------------------------PKSRWT-----
A0A356KTN1      IAR------------ELELELGREA------------------------TPEELG-----
A0A5B9PJZ8      DGK--------------FEQMETFE------------------------DVDSVI-----
A0A2S8G191      DPE--------------VAKLPVIK------------------------EKVDPV-----
A0A2E7EGG1      TAM---------------PEIRSRR------------------------DPIDWL-----
A0A2E2N5A9      TKQ---------------PDQAAQG------------------------EGTSSKAFDRA
A0A7C8AGA2      TLK--------------ESELTLFE------------------------DSVDLV-----
A0A7C2FXP7      KDLKFFAEASMSIIDKMGLTLTKTT------------------------QTVEPA-----
A0A2E3GWC6      ESH--------------LDKLPTLA------------------------GSEDPA-----
F0SLB0          ESH--------------LDKLPTLA------------------------GSEDPA-----
A0A3L7NDH9      PTR---------------VALGS-Q------------------------DPEIVA-----
A0A1N6DAJ8      DPE--------------VAKLEVIA------------------------KVVDPI-----
A0A532UD06      DTR--------------IGHLETFA------------------------GIDNLV-----
A0A660URN1      DSE--------------IGRFKTFE------------------------QIDNPA-----
A0A517ZCB5      EHR---------------SDFRG-V------------------------RPERWI-----
A0A225EH48      NPN--------------VSRLPDIK------------------------GTDDPV-----
A0A518INW8      AAR---------------------R------------------------EGISAL-----
A0A518JPH9      AAR---------------------R------------------------EGNSAL-----
A0A5C5VEK8      SPE--------------AASMETFR------------------------GVENRV-----
A0A532UTJ0      KNLSFFDTEPAGLLTKWKQKLLGTT------------------------PKPEIAARLKQ
A0A432MFP3      DPK--------------VASQSGVR------------------------EAPDAE-----
A0A2E2CCW9      EAR--------------LNQLPSLA------------------------GEKDPT-----
A0A3C0AGX3      EAR--------------LNQLPSLA------------------------GEKDPT-----
A0A518AAQ5      AAH--------------LTELPTLE------------------------GEKDPA-----
A0A517QBG9      AAH--------------LTELPTLE------------------------GEKDPA-----
A0A518FTU3      AAH--------------LTELPTLE------------------------GEKDPA-----
A0A517WHH5      AGK--------------LTELPSLE------------------------GEKDPA-----
A0A5A8BGT3      AGK--------------LTELPSLE------------------------GEKDPA-----
A0A2E7K7A9      AGK--------------LTELPSLE------------------------GEKDPA-----
A0A517PTS5      AGK--------------LTELPSLE------------------------GEKDPA-----
A0A6I6AH34      AGK--------------LTELPSLE------------------------GEKDPA-----
A0A517VTK3      EAK--------------LYNLPSLA------------------------GETDPT-----
A0A517WQT4      EAK--------------LYNLPSLA------------------------GETDPT-----
A0A517VID8      EAK--------------LNQLSSLA------------------------GEKDPT-----
A0A517RK10      EAK--------------LNELPSLA------------------------GEKDPT-----
A0A518IH18      EAK--------------LNELPSLA------------------------GEKDPT-----
A0A5C5XLF4      DQL--------------ATLAGSTE------------------------PARDII-----
A0A2D5NDU9      EFP--------------DSEINK--------------------------DETITV-----
A0A1P8WP26      RFK---------------QHFSE-L------------------------TEAEAV-----
A0A3L7V1F3      NAR---------------VDLVG-Y------------------------PEGQWV-----
D5SZ21          KYR---------------TDFRG-V------------------------APADWP-----
A0A286RGB6      VAR--------------LPSIREQI------------------------DPVQWV-----
A0A518CHE5      EHQ---------------VDVSG-N------------------------PMEMQV-----
A0A1V5N3W2      DPD--------------PIARYLTK------------------------DSKPLNPVVAI
A0A3E0MY27      ADI--------------SWLKEVKA------------------------EGEDQV-----
A0A7C4Z5R7      DGV--------------LEPGKA-A------------------------ENLAWL-----
A0A2E0X9P6      RSE--------------IGAMEEFQ------------------------NEPEPL-----
A0A286RLF2      EDL--------------AVDLNM-D------------------------KPETWV-----
A0A517NSK8      IAS--------------VSNAIDEG------------------------K--NPL-----
A0A5C5Z0D6      LAS--------------IAEVVAEG------------------------R--SSL-----
M5UE94          VKS--------------VVDAISES------------------------ENLSPL-----
A0A2E8FLY0      KHR---------------IDLKG-I------------------------PRNKWT-----
A0A3D2U1E1      KHR---------------VDLKD-V------------------------PRAKWI-----
E8R3W3          LKT--------------LEDLNE-N------------------------ERFNWL-----
A0A5C5ZM48      LRG--------------ELDPIG-------------------------------------
A0A5B9WF77      EPR--------------IAKFSMFK------------------------NSNDPA-----
A0A518BBX8      ILQ--------------LESAKPSS------------------------EDEDAVDVIIE
A0A1P8WN28      LPP----------------ELAAEP------------------------DRTVWP-----
A0A3B9CTT0      KPP----------------ELSG-V------------------------DSLRWP-----
A0A518ALT3      SEI--------------EEINSE-F------------------------DPQAYI-----
A0A3M1QRP3      TSL--------------FDEVEQ-N------------------------VLTKLLRSPSP
A0A517TMV0      EHR---------------VDLAD-T------------------------PPRKWI-----
A0A3E0MY88      PSH--------------QVDFQG-T------------------------RGPGV------
A0A5B9QF68      KHR---------------IDLVG-E------------------------PTHKWV-----
A0A5B9QGF0      QHL---------------IDLVG-K------------------------PTHEWV-----
A0A5C6CK24      QYL---------------IDLVG-E------------------------PTHKWV-----
A0A2E3RCU8      ECL---------------QEFKG--------------------------NRESWH-----
A0A1C3E6N1      KYR---------------TDFRG-V------------------------APADWP-----
A0A518GJT2      KYR---------------TDFRG-V------------------------APSDWP-----
A0A2E8B0L9      AEA--------------RIDLAG-L------------------------PRDKWI-----
A0A5Q4GFE7      AEN--------------RIDFAS-A------------------------PRHRWA-----
A0A257WS34      KHR---------------HVLRK-V------------------------PRARWA-----
A0A7C4LP10      KHR---------------IDFEG-V------------------------PKTKWT-----
A0A517MLW3      SSL--------------QIDLVG-L------------------------SDEQAL-----
A0A5B9QVD0      AAA--------------QIDIRD-K------------------------SDEAAV-----
A0A3A0DET7      NAN--------------LETFHG-V------------------------DNRV-------
A0A3B8PNV4      KHR---------------IDLKG-I------------------------PRSKWT-----
A0A3D1DR40      KHR---------------IDLKG-I------------------------PRSKWT-----
A0A2E7RYU8      KHR---------------IDLKG-I------------------------PRSKWT-----
A0A3B8LXG8      KHR---------------IDLKG-I------------------------PRSKWT-----
A0A286RD13      SQL--------------PYIRNQ-V------------------------DPIMWL-----
A0A2E3GWX1      DQQ---------------AKFLG-M------------------------SKRQAI-----
F0SG60          DQQ---------------AKFLG-M------------------------SKRQAI-----
A0A2E9VST2      TAR---------------TKFIG-M------------------------TKHQAI-----
A0A356A6X2      TAR---------------TKFIG-M------------------------TKHQAI-----
A0A5C5XLM3      TAR---------------TKFIG-M------------------------TKHQAI-----
A0A7C5FXU1      QVA--------------ELESIR-N------------------------HPDP-V-----
A0A3M1VCL4      EYR--------------MVDLQD-V------------------------PRSKWV-----
A0A5C5V7Z9      EHR---------------VDLLT-V------------------------KPSRWI-----
A0A5C5YT05      EHR---------------IDLET-I------------------------NPSHWV-----
A0A518D7F9      QHR---------------LDLLG-V------------------------PSQRWL-----
A0A5C5ZIP0      EHR---------------IDLVE-S------------------------PPHKWV-----
A0A518KBK3      EHR---------------IDFVD-Q------------------------KPNRWV-----
A0A5C6AKF9      EYR---------------IDFVD-K------------------------KANEWV-----
A0A6M5Z0K7      RSL--------------RLVAAQ-S------------------------DPVEWL-----
A0A350CI62      KYR--------------RVDLAG-Y------------------------PQSAWV-----
A0A4P5WQK6      KYR--------------RVDLAG-Y------------------------PQSAWV-----
A0A3C1X4W5      KYR--------------RVDLEG-Y------------------------PQSAWI-----
A0A3D3W3A7      KYR--------------RVDLEG-Y------------------------PQSAWI-----
A0A518DRX3      PEV--------------VLAFDA-A------------------------PSKEWA-----
A0A518DZF9      PEV--------------VLAFDA-A------------------------PSKEWA-----
A0A518AKT8      SEH--------------LIDLER-V------------------------PRSDWV-----
A0A5C5ZR72      EDV--------------GSAEHL-K------------------------EESNRV-----
A0A7C5R0U3      PDV--------------AAMWRK-V------------------------PESERL-----
A0A517TY85      PKL--------------GELAEV-K------------------------EQADPV-----
A0A5B9QEI7      PEI--------------ASIPEI-K------------------------RSPDPL-----
F0SI78          GEL--------------SSISSS-N------------------------PMA--------
A0A517MDV3      ESI--------------RSEL---------------------------------------
A0A518IQ30      -DL--------------KIDLAG-V------------------------SPEKWK-----
A0A517LWP4      -EL--------------KVDLAG-V------------------------PEEKWK-----
A0A518JNW8      -EL--------------KVDLAG-V------------------------PEEKWK-----
A0A2E7ENQ5      -PL--------------RVDVTP-K------------------------PRDEWV-----
A0A7C2KUQ9      -QA--------------TGWFNE-R------------------------PRSLFGGEQSP
A0A7C5BZF0      -VH--------------RVDLVG-K------------------------PKDQWV-----
A0A1G3AQE9      -ED--------------CIDFAG-A------------------------PKSEWS-----
A0A3L7UQT9      -EY--------------CVDFEG-F------------------------NPEVWP-----
A0A4P5YBU2      -EY--------------CVDFKG-F------------------------NPEVWP-----
A0A7C7V5U8      PED--------------RVDFAE-V------------------------PPEKWA-----
                                                                            

A0A5S9IJB5      LKVFRGL-----------------------------------------------------
A0A5S9IPR9      -GQLLRT-----------------------------------------------------
A0A533Q9U4      INRFLSP-----------------------------------------------------
A0A533Q6B7      INAFLSG-----------------------------------------------------
A0A1U9NNE1      KETILIE-----------------------------------------------------
A0A2G2JCA2      IAALGRN-----------------------------------------------------
A0A1G2XVR0      INNYLSK-----------------------------------------------------
A0A1G3B0P0      INNYLSK-----------------------------------------------------
A0A1E3X4X0      IDVYLKK-----------------------------------------------------
A0A286U4B3      ARQLLGR-----------------------------------------------------
A0A5C6DDS2      VTIFLNM-----------------------------------------------------
A0A2E3GW02      SSSNPMASISS-------------------------------------------------
A0A5B9QNZ7      RQQLDPELARL------------------------DHRRAVITYILD-------------
A0A1Z8N7H5      HRQLAGKISTRV------------------------------------------------
A0A1G2YPI3      DNHISYLKKTL-------------------------------------------------
A0A1U7CZ81      KNSTDKLTDLR-------------------------------------------------
A0A142YNY8      KGSLSPRTELK-------------------------------------------------
A0A1U7GLS6      KNSMAPQADLL-------------------------------------------------
A0A532UIN2      DNSIAYLKKEL-------------------------------------------------
A0A0S8KNX5      KRKIDGTQDKR-------------------------------------------------
A0A3D3UVZ8      KRKILGTKKID-------------------------------------------------
A0A517NFU9      QQVVANGG-------------------------------SVIDHILK-------------
A0A5C5YWH4      KNAAKEGR-------------------------------GGIDHILQ-------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      DNHVAFLRQNL-------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      NVKVGDLAE---------------------------------------------------
A0A142WSB9      RDPLKAVWEDA-------------------------------------------------
M5SZR3          SALKTKTKELH----------------------------QGLNVELD-------------
M5TW92          SALKTKTKELH----------------------------EGLNVELD-------------
A0A2S8FKY2      IMSLDIVREEE----------------------------NPLEWLQE-------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      QLAKREGKTPT-------------------------------QAAIE-------------
M5UQ35          VARLDRTVGEI-------------------------------------------------
A0A0S8FY64      -DRLTGLFQAE-------------------------------------------------
A0A1N6KFT7      ----LGSNTPT-------------------------------------------------
L0DFG4          ----LGPKKTP-------------------------------------------------
A0A5C5XXG1      TENNAKPSAPAKSESRVTEDVVTLDVLQILFRQRWLIAFLTLAGLAAGVAYALQARVWYE
A0A7C7YUM8      LRRLRGSRFLD---------------------HRLRARLEPLAGKTADESEVRELDVYFV
A0A7C2AHI6      WRKLTGTPHQP---------------------HRLFASASGPID--P-----RRLTVSFP
A0A518BJJ1      FDRMVGIRRGK---------------------GALHARARALADGAA-----EAIRVSFD
A0A518D182      VGRLTG-QIPA---------------------PRIAVRSERLDGSAP-----ERVRLRFV
A0A5C5WTY6      VAKAE---PPE----------------------------DTVTYVAS-------------
A0A5C5Y033      VAKVS---DET----------------------------DQVDYVIQ-------------
A0A5C6G1Y2      VAKVS---DET----------------------------DQVDYVIQ-------------
A0A354PDV6      QPLLTPA-KGE----------------------------DAADYVIS-------------
A0A5C6FZ02      VEHLDPEIETV----------------------------DAVDYVID-------------
M5TIT3          VERIDVDNPSS----------------------------DAVDYVIN-------------
A0A5M6CY44      QSQVS---PET----------------------------DAAEYVIE-------------
F2AXG2          LPHLD---EKT----------------------------DAIDYVID-------------
M2BB46          LPHLD---EKT----------------------------DAIDYVID-------------
L7CLQ6          LQQLS---EKT----------------------------DAIDYVID-------------
A0A0J1B719      ETHLN---EKT----------------------------DAIDYVID-------------
Q7UF18          ESHLD---EKT----------------------------DAIDYVID-------------
A0A2G1W1E0      ESHLD---EKT----------------------------DAIDYVID-------------
K5E235          ESHLD---EKT----------------------------DAIDYVID-------------
A0A5C6FFI9      PSIGAVVAGGD----------------------------NAVDYIIE-------------
A0A5C5WDJ1      RQSGGSYVDHI----------------------------LD-------------------
A0A5C5X547      ISNLPQVVAEP----------------------------DPIEWILE-------------
A0A353FIP5      RRKLAGKTLD-----------------------------GALSGELALPIARQNSAPVTV
A0A5B1CIK7      LPHLNEKI-------------------------------DSVDYVIE-------------
A0A5C5WHS2      TPHLGDSG-------------------------------DPVEYVID-------------
A0A5C6B6G8      KAQLSDTE-------------------------------DAIDYVID-------------
A0A5C5ZZN3      VEQLDETKPQF----------------------------DAVDYVIE-------------
A0A5C5XS91      TTHLNQERPGF----------------------------DATDYVVE-------------
A0A5C6C4E6      VERLNPERTGF----------------------------DATDYVVE-------------
A0A2E1VVJ1      LRRFTGGSVPN----------------------------GSLEMELLQPYTDPWTHRIEL
A0A3M2AEL0      LRKLGRGEEPT----------------------------GSLRVEVEQLPRDLTYRAWRI
A0A2A2W9R6      --KLNRSVGQL----------------------------RG-------------------
A0A518HKC1      --NLNRSVGQL----------------------------RG-------------------
A0A518L3P0      --KLNRSVGQL----------------------------RG-------------------
A0A255R1S0      --DLGKSAGEI----------------------------AG-------------------
A0A5B9MKP1      --SLGRSVGQL----------------------------QR-------------------
A0A0S8J591      -AVVRNW-----------------------------------------------------
M5RT57          -AWLTDN-----------------------------------------------------
A0A351FYP6      RKHLEKV-----------------------------------------------------
A0A2E7ESJ6      -LKLSEN-----------------------------------------------------
A0A2D5AWU0      -TELNDR-----------------------------------------------------
A0A1G2YQB7      -LALKNAIASN-------------------------------------------------
A0A353P687      -LLLRKAIADN-------------------------------------------------
A0A356EME5      -QWLQRE-----------------------------------------------------
L0DC26          -EWLEGQ-----------------------------------------------------
A0A3L7P4E4      -QTILNG-----------------------------------------------------
A0A3L7PEB5      -MTILAG-----------------------------------------------------
A0A1U9NL64      -GYLKKQ-----------------------------------------------------
A0A2N1UCJ3      -IYLKKL-----------------------------------------------------
A0A7C4EK84      -AYLKSA-----------------------------------------------------
A0A7C3F0T2      -GYLKAI-----------------------------------------------------
A0A2E0X4J3      -GMLYEG-----------------------------------------------------
A0A5C5YU10      -GLLYSG-----------------------------------------------------
A0A517MPZ6      -GLLKKN-----------------------------------------------------
A0A5C6CNV7      -AFLRKN-----------------------------------------------------
A0A518K5H4      -ALLREE-----------------------------------------------------
A0A5C6AA28      -GLLRES-----------------------------------------------------
A0A2E9VK20      -RDIIDS-----------------------------------------------------
A0A3D4PJK1      -RDIIDS-----------------------------------------------------
A0A532UT69      -GVLRSG-----------------------------------------------------
A0A355AI52      -EIFSKS-----------------------------------------------------
A0A354PCQ3      -QNLRKN-----------------------------------------------------
A0A0S8GZ23      -SALKTA-----------------------------------------------------
A0A1I3DDV4      -DYVSEH-----------------------------------------------------
A0A2E0SMM6      -KTLRTQ-----------------------------------------------------
A0A3L7SI46      -AVLKKN-----------------------------------------------------
A0A356KTN1      -GMFQRG-----------------------------------------------------
A0A5B9PJZ8      -RYLRDG-----------------------------------------------------
A0A2S8G191      -SWLQGA-----------------------------------------------------
A0A2E7EGG1      ---STQG-----------------------------------------------------
A0A2E2N5A9      TEKLMAA-----------------------------------------------------
A0A7C8AGA2      -QALRKA-----------------------------------------------------
A0A7C2FXP7      -AVLKQA-----------------------------------------------------
A0A2E3GWC6      -RDIIDG-----------------------------------------------------
F0SLB0          -RDIIDG-----------------------------------------------------
A0A3L7NDH9      -VILKNH-----------------------------------------------------
A0A1N6DAJ8      -EWLEKE-----------------------------------------------------
A0A532UD06      -GYVKRE-----------------------------------------------------
A0A660URN1      -AFLKKN-----------------------------------------------------
A0A517ZCB5      -ESFQSH-----------------------------------------------------
A0A225EH48      -TFLEDR-----------------------------------------------------
A0A518INW8      -GLLKQD-----------------------------------------------------
A0A518JPH9      -GLLSGN-----------------------------------------------------
A0A5C5VEK8      -AMLYEA-----------------------------------------------------
A0A532UTJ0      AIVGEKS-----------------------------------------------------
A0A432MFP3      -QYLREM-----------------------------------------------------
A0A2E2CCW9      -QDIIDT-----------------------------------------------------
A0A3C0AGX3      -QDIIDT-----------------------------------------------------
A0A518AAQ5      -QEIIDS-----------------------------------------------------
A0A517QBG9      -QEIIDS-----------------------------------------------------
A0A518FTU3      -QEIIDS-----------------------------------------------------
A0A517WHH5      -QEIIDS-----------------------------------------------------
A0A5A8BGT3      -QEIIDS-----------------------------------------------------
A0A2E7K7A9      -QEIIDS-----------------------------------------------------
A0A517PTS5      -QEIIDS-----------------------------------------------------
A0A6I6AH34      -QEIIDS-----------------------------------------------------
A0A517VTK3      -EEILGS-----------------------------------------------------
A0A517WQT4      -EEILGS-----------------------------------------------------
A0A517VID8      -QDIIDT-----------------------------------------------------
A0A517RK10      -QDIIDT-----------------------------------------------------
A0A518IH18      -QDIIDT-----------------------------------------------------
A0A5C5XLF4      -----DS-----------------------------------------------------
A0A2D5NDU9      -PWLKYH-----------------------------------------------------
A0A1P8WP26      -AEMQKS-----------------------------------------------------
A0A3L7V1F3      -RTIKDN-----------------------------------------------------
D5SZ21          -GVLKKM-----------------------------------------------------
A0A286RGB6      ----SEH-----------------------------------------------------
A0A518CHE5      -KILRSQ-----------------------------------------------------
A0A1V5N3W2      RQAIRDG-----------------------------------------------------
A0A3E0MY27      -AWLNER-----------------------------------------------------
A0A7C4Z5R7      ----EKG-----------------------------------------------------
A0A2E0X9P6      -KHLQEH-----------------------------------------------------
A0A286RLF2      -EGLRRN-----------------------------------------------------
A0A517NSK8      -EYIRDH-----------------------------------------------------
A0A5C5Z0D6      -KFVMDN-----------------------------------------------------
M5UE94          -AYILDN-----------------------------------------------------
A0A2E8FLY0      -ETLRNN-----------------------------------------------------
A0A3D2U1E1      -DALRKQ-----------------------------------------------------
E8R3W3          ------S-----------------------------------------------------
A0A5C5ZM48      --MLGEL-----------------------------------------------------
A0A5B9WF77      -AELRKR-----------------------------------------------------
A0A518BBX8      EIDVKRT-----------------------------------------------------
A0A1P8WN28      -IRLREM-----------------------------------------------------
A0A3B9CTT0      -GELRKM-----------------------------------------------------
A0A518ALT3      ----REH-----------------------------------------------------
A0A3M1QRP3      GKRLMDG-----------------------------------------------------
A0A517TMV0      -SSINSR-----------------------------------------------------
A0A3E0MY88      -GVLASN-----------------------------------------------------
A0A5B9QF68      -EKLSEN-----------------------------------------------------
A0A5B9QGF0      -ETLSEN-----------------------------------------------------
A0A5C6CK24      -ETLSKN-----------------------------------------------------
A0A2E3RCU8      -RELASK-----------------------------------------------------
A0A1C3E6N1      -GVLKKM-----------------------------------------------------
A0A518GJT2      -GVLKKM-----------------------------------------------------
A0A2E8B0L9      -DALRAN-----------------------------------------------------
A0A5Q4GFE7      -NILRGN-----------------------------------------------------
A0A257WS34      -DTLRSG-----------------------------------------------------
A0A7C4LP10      -QSLRSR-----------------------------------------------------
A0A517MLW3      -TTLQGN-----------------------------------------------------
A0A5B9QVD0      -KTIRAN-----------------------------------------------------
A0A3A0DET7      -AFLRDN-----------------------------------------------------
A0A3B8PNV4      -EALRNN-----------------------------------------------------
A0A3D1DR40      -EALRNN-----------------------------------------------------
A0A2E7RYU8      -EALRNN-----------------------------------------------------
A0A3B8LXG8      -EALRNN-----------------------------------------------------
A0A286RD13      ----RRN-----------------------------------------------------
A0A2E3GWX1      -GTLREN-----------------------------------------------------
F0SG60          -GTLREN-----------------------------------------------------
A0A2E9VST2      -EKLRSN-----------------------------------------------------
A0A356A6X2      -EKLRSS-----------------------------------------------------
A0A5C5XLM3      -EKLRSS-----------------------------------------------------
A0A7C5FXU1      -SLVQEG-----------------------------------------------------
A0A3M1VCL4      -KEVRSN-----------------------------------------------------
A0A5C5V7Z9      -EALNEN-----------------------------------------------------
A0A5C5YT05      -EELGRG-----------------------------------------------------
A0A518D7F9      -EDILSR-----------------------------------------------------
A0A5C5ZIP0      -DSISDR-----------------------------------------------------
A0A518KBK3      -ETIGDS-----------------------------------------------------
A0A5C6AKF9      -ETINEQ-----------------------------------------------------
A0A6M5Z0K7      ----EKQ-----------------------------------------------------
A0A350CI62      -RMVRDN-----------------------------------------------------
A0A4P5WQK6      -RMVRDN-----------------------------------------------------
A0A3C1X4W5      -RKVRDN-----------------------------------------------------
A0A3D3W3A7      -RKVRDN-----------------------------------------------------
A0A518DRX3      -KTIEQN-----------------------------------------------------
A0A518DZF9      -KTIEQN-----------------------------------------------------
A0A518AKT8      -EDLTDR-----------------------------------------------------
A0A5C5ZR72      -KAIQKR-----------------------------------------------------
A0A7C5R0U3      -RHIQEH-----------------------------------------------------
A0A517TY85      -DYLKRN-----------------------------------------------------
A0A5B9QEI7      -KYLQKQ-----------------------------------------------------
F0SI78          -SISSGL-----------------------------------------------------
A0A517MDV3      -DPVLAK-----------------------------------------------------
A0A518IQ30      -DTLRNN-----------------------------------------------------
A0A517LWP4      -DLLRGK-----------------------------------------------------
A0A518JNW8      -DLLRGN-----------------------------------------------------
A0A2E7ENQ5      -EILRKN-----------------------------------------------------
A0A7C2KUQ9      LERLREA-----------------------------------------------------
A0A7C5BZF0      -ETIQKN-----------------------------------------------------
A0A1G3AQE9      -KKLRDK-----------------------------------------------------
A0A3L7UQT9      -TLLKNH-----------------------------------------------------
A0A4P5YBU2      -TLLKNH-----------------------------------------------------
A0A7C7V5U8      -EVLERN-----------------------------------------------------
                                                                            

A0A5S9IJB5      --------------------------------------------FTVT------------
A0A5S9IPR9      --------------------------------------------ISVA------------
A0A533Q9U4      --------------------------------------------LKVS------------
A0A533Q6B7      --------------------------------------------LNVS------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      --------------------------------------------INVR------------
A0A1G2XVR0      --------------------------------------------LTVQ------------
A0A1G3B0P0      --------------------------------------------LTVQ------------
A0A1E3X4X0      --------------------------------------------LSIT------------
A0A286U4B3      --------------------------------------------TEIL------------
A0A5C6DDS2      --------------------------------------------INIE------------
A0A2E3GW02      -------------------------------------------GLSVSRS----------
A0A5B9QNZ7      -------------------------------------------NLWVERGGQEL------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      -------------------------------------------NATV-------------
A0A1U7CZ81      ------------------------------------------QKLKVKN-----------
A0A142YNY8      ------------------------------------------ERLAIVN-----------
A0A1U7GLS6      ------------------------------------------ERLVVTN-----------
A0A532UIN2      -------------------------------------------DVSV-------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      -------------------------------------------NIEVNRGGE--------
A0A5C5YWH4      -------------------------------------------HIEVIRGGE--------
A0A3D2TNK4      -------------------------------------------YLAPEHRTDIEGMPPST
A0A7C1Y4F0      -------------------------------------------TVNI-------------
A0A6I0ENW6      -------------------------------------------DPEVLKTSWYRDPPQKL
A0A6L3A0B7      -------------------------------------------DPEVLKTSWYRDPPQKL
A0A0J1B4A0      -------------------------------------------NLSVSKGGD--------
A0A142WSB9      -------------------------------------------TAKLVSGQD--------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      -------------------------------------------ELIVGFPGD--------
A0A517N8P6      -------------------------------------------------GAE--------
A0A432MJP4      -------------------------------------------ELDVSRP----------
M5UQ35          -----------------------------------------QENLAVGRGGS--------
A0A0S8FY64      --------DMRQMARPGLWHSAFREVRAVLGYEPVRPVEAW-------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      STARVLINEKSSGLASSSSSEMVEEDILANHIELLLSRKIVGEAMAAQDDDGNS------
A0A7C7YUM8      DEATVRIAPHGGYLFAEVPGAQDGEDFVEFDYKPGVDLEVFDLRLRLQASGAFAGQTYCV
A0A7C2AHI6      SD-----PSAGTVRVRDEEGGEE----VEVPYRPDEPFAAFGLSLRLRAIGAFAGQTYEI
A0A518BJJ1      GEGQIRLTPVDVAASPDDDAREARPQRPDGRYRVG------GVELNLAVRGDVSRREFVV
A0A518D182      SPTRVELAALGDMAYAEHFGSDA----TELDYAAGEPVEWSGLRLWIDADADRSLGTYVV
A0A5C5WTY6      -------------------------------------------NLRIDRGGL--------
A0A5C5Y033      -------------------------------------------NTSIGKGGD--------
A0A5C6G1Y2      -------------------------------------------NTSIGKGGD--------
A0A354PDV6      -------------------------------------------QLEIVKGGA--------
A0A5C6FZ02      -------------------------------------------HMEVVKGGE--------
M5TIT3          -------------------------------------------HLSVSKGGD--------
A0A5M6CY44      -------------------------------------------HLEIVKGGS--------
F2AXG2          -------------------------------------------QLSIVRGGD--------
M2BB46          -------------------------------------------QLSIVKGGD--------
L7CLQ6          -------------------------------------------QLSIVKGGD--------
A0A0J1B719      -------------------------------------------QLSIVKGGD--------
Q7UF18          -------------------------------------------QLSIVKGGD--------
A0A2G1W1E0      -------------------------------------------QLSIVKGGD--------
K5E235          -------------------------------------------QLSIVKGGD--------
A0A5C6FFI9      -------------------------------------------NLDVARGGK--------
A0A5C5WDJ1      -------------------------------------------SIEVERGGD--------
A0A5C5X547      -------------------------------------------NLHVMQLPD--------
A0A353FIP5      TFHSSNSGVATSGKI-------LRQQSKAFSLANSPLVEIADTKIRLFPEGDLTGRQFRL
A0A5B1CIK7      -------------------------------------------HLSIVKGGD--------
A0A5C5WHS2      -------------------------------------------RLELVKGGD--------
A0A5C6B6G8      -------------------------------------------HLELVKGGE--------
A0A5C5ZZN3      -------------------------------------------QLSIVKGGE--------
A0A5C5XS91      -------------------------------------------HISISKGGE--------
A0A5C6C4E6      -------------------------------------------HLSISKGGE--------
A0A2E1VVJ1      EFLAEGEVLARSSRI------AEPETIRFDPNDTEPIVTMFGRRYKLMITGTLSGRKFGV
A0A3M2AEL0      HFSSPEVVEVLPDSLWAAVLPGRKQVVRLD--DGKPL-ELAGARIRLIPDGDLSGRTFRL
A0A2A2W9R6      -------------------------------------------GLSISKGGQ--------
A0A518HKC1      -------------------------------------------GLSISKGGQ--------
A0A518L3P0      -------------------------------------------GLSISKGGQ--------
A0A255R1S0      -------------------------------------------KLSVGKDGE--------
A0A5B9MKP1      -------------------------------------------GLSISTGGE--------
A0A0S8J591      --------------------------------------------IRVS-----R------
M5RT57          --------------------------------------------IRVQ-----Q------
A0A351FYP6      --------------------------------------------IDVS-----Q------
A0A2E7ESJ6      --------------------------------------------LKVE-----L------
A0A2D5AWU0      --------------------------------------------IGTV-----V------
A0A1G2YQB7      -------------------------------------------QLSVA-----P------
A0A353P687      -------------------------------------------KLTVA-----P------
A0A356EME5      --------------------------------------------LRLT-----S------
L0DC26          --------------------------------------------LQVD-----F------
A0A3L7P4E4      --------------------------------------------LNAE-----R------
A0A3L7PEB5      --------------------------------------------LSAT-----R------
A0A1U9NL64      --------------------------------------------LQVS-----V------
A0A2N1UCJ3      --------------------------------------------LDVQ-----V------
A0A7C4EK84      --------------------------------------------LQVE-----V------
A0A7C3F0T2      --------------------------------------------LRVG-----L------
A0A2E0X4J3      --------------------------------------------LAIQ-----V------
A0A5C5YU10      --------------------------------------------LNVD-----V------
A0A517MPZ6      --------------------------------------------LSVQ-----V------
A0A5C6CNV7      --------------------------------------------IDVQ-----V------
A0A518K5H4      --------------------------------------------IEVV-----V------
A0A5C6AA28      --------------------------------------------LEVA-----V------
A0A2E9VK20      --------------------------------------------LKVSRTAGED------
A0A3D4PJK1      --------------------------------------------LKVSRTAGED------
A0A532UT69      --------------------------------------------LDVS-----V------
A0A355AI52      --------------------------------------------LSVR-----G------
A0A354PCQ3      --------------------------------------------LSIS-----G------
A0A0S8GZ23      --------------------------------------------LADGTITIKH------
A0A1I3DDV4      --------------------------------------------ISLTKGGQGS------
A0A2E0SMM6      --------------------------------------------LSTS-----V------
A0A3L7SI46      --------------------------------------------LTVS-----S------
A0A356KTN1      --------------------------------------------VRVE-----A------
A0A5B9PJZ8      --------------------------------------------KALIAKSADV------
A0A2S8G191      --------------------------------------------LSVN-----F------
A0A2E7EGG1      --------------------------------------------LLIA-----P------
A0A2E2N5A9      --------------------------------------------ISVN-----P------
A0A7C8AGA2      --------------------------------------------VVKGDIKIEP------
A0A7C2FXP7      --------------------------------------------IANETIIAHS------
A0A2E3GWC6      --------------------------------------------LKVERTAGED------
F0SLB0          --------------------------------------------LKVERTAGED------
A0A3L7NDH9      --------------------------------------------LKIK-----G------
A0A1N6DAJ8      --------------------------------------------LQVD-----F------
A0A532UD06      --------------------------------------------LKVA-----V------
A0A660URN1      --------------------------------------------INVA-----V------
A0A517ZCB5      --------------------------------------------LEVS-----A------
A0A225EH48      --------------------------------------------IKLR------------
A0A518INW8      --------------------------------------------LNISRGGSGD------
A0A518JPH9      --------------------------------------------LNIQRGGAGG------
A0A5C5VEK8      --------------------------------------------LSVG-----V------
A0A532UTJ0      --------------------------------------------IVVA-----A------
A0A432MFP3      --------------------------------------------IKVA-----A------
A0A2E2CCW9      --------------------------------------------LKVKRISGND------
A0A3C0AGX3      --------------------------------------------LKVKRISGND------
A0A518AAQ5      --------------------------------------------LKVKRLSGTD------
A0A517QBG9      --------------------------------------------LKVKRLSGTD------
A0A518FTU3      --------------------------------------------LKVKRLSGTD------
A0A517WHH5      --------------------------------------------LKVKRLSGTD------
A0A5A8BGT3      --------------------------------------------LKVKRLSGTD------
A0A2E7K7A9      --------------------------------------------LKVKRLSGTD------
A0A517PTS5      --------------------------------------------LKVKRLSGTD------
A0A6I6AH34      --------------------------------------------LKVKRLSGTD------
A0A517VTK3      --------------------------------------------LKVKRISGND------
A0A517WQT4      --------------------------------------------LKVKRISGND------
A0A517VID8      --------------------------------------------LKVKRISGND------
A0A517RK10      --------------------------------------------LKVKRISGND------
A0A518IH18      --------------------------------------------LKVKRISGND------
A0A5C5XLF4      --------------------------------------------LKVTRTAGED------
A0A2D5NDU9      --------------------------------------------LRAE-----V------
A0A1P8WP26      --------------------------------------------LSVS-----S------
A0A3L7V1F3      --------------------------------------------LSVS-----C------
D5SZ21          --------------------------------------------VTVR-----S------
A0A286RGB6      --------------------------------------------LSVR-----F------
A0A518CHE5      --------------------------------------------LSTS-----V------
A0A1V5N3W2      --------------------------------------------IIAVV----P------
A0A3E0MY27      --------------------------------------------IDVV-----N------
A0A7C4Z5R7      --------------------------------------------LLGD-----F------
A0A2E0X9P6      --------------------------------------------LAVA-----Q------
A0A286RLF2      --------------------------------------------LAAS-----A------
A0A517NSK8      --------------------------------------------LHVTKGGLGV------
A0A5C5Z0D6      --------------------------------------------LSVSKGGEGV------
M5UE94          --------------------------------------------LEVTKGGDGV------
A0A2E8FLY0      --------------------------------------------LAVT-----T------
A0A3D2U1E1      --------------------------------------------LGVS-----A------
E8R3W3          --------------------------------------------ANIQ-----S------
A0A5C5ZM48      --------------------------------------------VHVF-----Q------
A0A5B9WF77      --------------------------------------------LEVQ-----I------
A0A518BBX8      --------------------------------------------TGRL-----S------
A0A1P8WN28      --------------------------------------------LVVT-----F------
A0A3B9CTT0      --------------------------------------------LTVK-----F------
A0A518ALT3      --------------------------------------------LSVR-----Q------
A0A3M1QRP3      --------------------------------------------LDVN-----V------
A0A517TMV0      --------------------------------------------LSAS-----T------
A0A3E0MY88      --------------------------------------------ISVS-----T------
A0A5B9QF68      --------------------------------------------LSAR-----V------
A0A5B9QGF0      --------------------------------------------LSAQ-----V------
A0A5C6CK24      --------------------------------------------LSAR-----V------
A0A2E3RCU8      --------------------------------------------ISTH-----V------
A0A1C3E6N1      --------------------------------------------VTVR-----S------
A0A518GJT2      --------------------------------------------VTVR-----S------
A0A2E8B0L9      --------------------------------------------LSAS-----G------
A0A5Q4GFE7      --------------------------------------------LSAQ-----A------
A0A257WS34      --------------------------------------------LSVS-----A------
A0A7C4LP10      --------------------------------------------MSVS-----S------
A0A517MLW3      --------------------------------------------LTVQ-----L------
A0A5B9QVD0      --------------------------------------------LSVN-----L------
A0A3A0DET7      --------------------------------------------INVG-----V------
A0A3B8PNV4      --------------------------------------------LAVT-----A------
A0A3D1DR40      --------------------------------------------LAVT-----A------
A0A2E7RYU8      --------------------------------------------LAVT-----A------
A0A3B8LXG8      --------------------------------------------LAVT-----A------
A0A286RD13      --------------------------------------------LRVR-----F------
A0A2E3GWX1      --------------------------------------------LSVS-----T------
F0SG60          --------------------------------------------LSVS-----T------
A0A2E9VST2      --------------------------------------------LTVN-----S------
A0A356A6X2      --------------------------------------------LTVN-----T------
A0A5C5XLM3      --------------------------------------------LTVN-----T------
A0A7C5FXU1      --------------------------------------------LRVR-----F------
A0A3M1VCL4      --------------------------------------------TYVS-----T------
A0A5C5V7Z9      --------------------------------------------LSAT-----T------
A0A5C5YT05      --------------------------------------------LSAS-----T------
A0A518D7F9      --------------------------------------------LSAS-----S------
A0A5C5ZIP0      --------------------------------------------LSAS-----A------
A0A518KBK3      --------------------------------------------LTAS-----T------
A0A5C6AKF9      --------------------------------------------LTAS-----T------
A0A6M5Z0K7      --------------------------------------------LVVE-----Q------
A0A350CI62      --------------------------------------------LQAS-----S------
A0A4P5WQK6      --------------------------------------------LQAS-----S------
A0A3C1X4W5      --------------------------------------------LQAS-----S------
A0A3D3W3A7      --------------------------------------------LQAS-----S------
A0A518DRX3      --------------------------------------------LRAS-----S------
A0A518DZF9      --------------------------------------------LRAS-----S------
A0A518AKT8      --------------------------------------------LSAS-----I------
A0A5C5ZR72      --------------------------------------------LKVK-----Q------
A0A7C5R0U3      --------------------------------------------LTAR-----G------
A0A517TY85      --------------------------------------------LSVS-----Q------
A0A5B9QEI7      --------------------------------------------LTVR-----Q------
F0SI78          --------------------------------------------SVSR-----S------
A0A517MDV3      --------------------------------------------FDHR-----R------
A0A518IQ30      --------------------------------------------LSAS-----A------
A0A517LWP4      --------------------------------------------LSAS-----A------
A0A518JNW8      --------------------------------------------LSAS-----A------
A0A2E7ENQ5      --------------------------------------------LTAR-----A------
A0A7C2KUQ9      --------------------------------------------LTVT-----V------
A0A7C5BZF0      --------------------------------------------LTVR-----A------
A0A1G3AQE9      --------------------------------------------LSVN-----A------
A0A3L7UQT9      --------------------------------------------VSVT-----N------
A0A4P5YBU2      --------------------------------------------VSVT-----N------
A0A7C7V5U8      --------------------------------------------LSAR-----T------
                                                                            

A0A5S9IJB5      --------------------------------------PLRKSFIVR-------------
A0A5S9IPR9      --------------------------------------VGDGTDILY-------------
A0A533Q9U4      --------------------------------------LMRNSGVVS-------------
A0A533Q6B7      --------------------------------------LMRNSGVVC-------------
A0A1U9NNE1      --------------------------------------PGEKTELIN-------------
A0A2G2JCA2      --------------------------------------AVSGSEMYS-------------
A0A1G2XVR0      --------------------------------------MTGNSDIIS-------------
A0A1G3B0P0      --------------------------------------MTGNSDIIS-------------
A0A1E3X4X0      --------------------------------------PVRNTGVVN-------------
A0A286U4B3      --------------------------------------SVRNSQLVK-------------
A0A5C6DDS2      --------------------------------------LVRNSQLVK-------------
A0A2E3GW02      --------------------------------------AKA-EDILL-------------
A0A5B9QNZ7      --------------------------------------AYA-PLTFV-------------
A0A1Z8N7H5      --------------------------------------VKS-TTVLN-------------
A0A1G2YPI3      --------------------------------------GKK-DDIIS-------------
A0A1U7CZ81      --------------------------------------KDG-TVHIQ-------------
A0A142YNY8      --------------------------------------PRN-TEFVH-------------
A0A1U7GLS6      --------------------------------------QKN-TNYVV-------------
A0A532UIN2      --------------------------------------GKK-DDIIS-------------
A0A0S8KNX5      -------------------TPEEILKQAITNGVIVAAADRL-SELIR-------------
A0A3D3UVZ8      -------------------PAMKLKLAIVEDETITVAADRR-SELIN-------------
A0A517NFU9      -------------------GS-----------------ARD-AMVLR-------------
A0A5C5YWH4      -------------------GS-----------------SRD-AMVLR-------------
A0A3D2TNK4      WVRIIGSRLHTRV-------------------------TRK-KSFIE-------------
A0A7C1Y4F0      --------------------------------------GRK-DDVIT-------------
A0A6I0ENW6      LSSAVKPAYERLLEDLNVVN------------------VKG-TELIE-------------
A0A6L3A0B7      LSSAVKPAYERLLEDLNVVN------------------VKG-TELIE-------------
A0A0J1B4A0      -------------------GL-----------------AKS-ASVLK-------------
A0A142WSB9      --------------------------------------QSF-DAIIE-------------
M5SZR3          --------------------------------------ENA-DNILH-------------
M5TW92          --------------------------------------ENA-DNILH-------------
A0A2S8FKY2      ------------------------------------------AEILQ-------------
A0A517N8P6      --------------------------------------SPD-RTIVE-------------
A0A432MJP4      --------------------------------------DRA-ASVLR-------------
M5UQ35          -------------------GD-----------------AEA-ANMLT-------------
A0A0S8FY64      ----------ELLREIVGVRP-----------------VKD-TNLVD-------------
A0A1N6KFT7      SLAQSSDPVGFARGNLKVSRP-----------------DRL-TKIIV-------------
L0DFG4          SLALATNPLEAVRGSLKVTRP-----------------DRL-TKIIV-------------
A0A5C5XXG1      -LMTLPSVVEHLDPEIETVDAVDYVIDHMEVVKGGEGGAKT-ARTLR-------------
A0A7C7YUM8      GLRSTEEAVLHLMKTTRAAEA-----------------GRK-TNVVK-------------
A0A7C2AHI6      ERFTLPELVDEIEDGLSVHET-----------------ARN-SGVIS-------------
A0A518BJJ1      RRVSEASAVKRLLSDTRVVES-----------------QRN-SGVIA-------------
A0A518D182      HVRTPDDAARDLMNNTRVMET-----------------QRN-SGVLE-------------
A0A5C5WTY6      -------------------GA-----------------AKK-ARSLT-------------
A0A5C5Y033      -------------------GS-----------------ARS-AAIMN-------------
A0A5C6G1Y2      -------------------GS-----------------ARS-AAIMN-------------
A0A354PDV6      -------------------GA-----------------AKS-ARSLS-------------
A0A5C6FZ02      -------------------GG-----------------AKT-ARTLR-------------
M5TIT3          -------------------GS-----------------AKN-ARSLS-------------
A0A5M6CY44      -------------------GG-----------------AKT-ARTLN-------------
F2AXG2          -------------------GS-----------------AKT-ARTLN-------------
M2BB46          -------------------GS-----------------AKT-ARTLN-------------
L7CLQ6          -------------------GS-----------------AKT-ARSLN-------------
A0A0J1B719      -------------------GS-----------------AKT-ARSLN-------------
Q7UF18          -------------------GS-----------------AKT-ARSLN-------------
A0A2G1W1E0      -------------------GS-----------------AKT-ARSLN-------------
K5E235          -------------------GS-----------------AKT-ARSLN-------------
A0A5C6FFI9      -------------------GA-----------------SKN-AMVLS-------------
A0A5C5WDJ1      -------------------GN-----------------AQN-AMVLR-------------
A0A5C5X547      ------------------------------------------TELLN-------------
A0A353FIP5      NVATRREAVERVLKELAVSET-----------------ARG-SGVLQ-------------
A0A5B1CIK7      -------------------GS-----------------AKT-ARSLK-------------
A0A5C5WHS2      -------------------GS-----------------AKT-ARSLN-------------
A0A5C6B6G8      -------------------GS-----------------AKT-ARSLN-------------
A0A5C5ZZN3      -------------------GS-----------------AKT-ARSLS-------------
A0A5C5XS91      -------------------GS-----------------AKA-ARSLR-------------
A0A5C6C4E6      -------------------GS-----------------AKA-ARSLR-------------
A0A2E1VVJ1      TLRNLDATVGDLLSRLRIRET-----------------SRG-SGVLQ-------------
A0A3M2AEL0      TLRSVRRAIRDTQESCRVVET-----------------HKG-SNVLR-------------
A0A2A2W9R6      -------------------GA-----------------GAS-ASILR-------------
A0A518HKC1      -------------------GA-----------------GAS-ASILR-------------
A0A518L3P0      -------------------GA-----------------GAS-ASILR-------------
A0A255R1S0      ------------------------------------------ASILR-------------
A0A5B9MKP1      -------------------GA-----------------GSA-ASLLK-------------
A0A0S8J591      --------------------------------------VPK-THHVE-------------
M5RT57          --------------------------------------VGS-SELYN-------------
A0A351FYP6      --------------------------------------YRN-TSIIE-------------
A0A2E7ESJ6      --------------------------------------VEDGTNVLN-------------
A0A2D5AWU0      --------------------------------------DPN-TDRLS-------------
A0A1G2YQB7      --------------------------------------EDN-TELIK-------------
A0A353P687      --------------------------------------EDK-TELIK-------------
A0A356EME5      --------------------------------------VGK-SEFLQ-------------
L0DC26          --------------------------------------APG-SEILR-------------
A0A3L7P4E4      --------------------------------------TVEDGQVLD-------------
A0A3L7PEB5      --------------------------------------TVE-GQILD-------------
A0A1U9NL64      --------------------------------------GKK-DDILS-------------
A0A2N1UCJ3      --------------------------------------GIK-DDIIA-------------
A0A7C4EK84      --------------------------------------GKN-DDLVT-------------
A0A7C3F0T2      --------------------------------------GKD-DDIIS-------------
A0A2E0X4J3      --------------------------------------GAD-NEIIT-------------
A0A5C5YU10      --------------------------------------GRD-DEIIN-------------
A0A517MPZ6      --------------------------------------GKN-DDIIN-------------
A0A5C6CNV7      --------------------------------------GQN-DDIIN-------------
A0A518K5H4      --------------------------------------GER-DDIIN-------------
A0A5C6AA28      --------------------------------------GER-DDIIN-------------
A0A2E9VK20      --------------------------------------HHQ-LNILN-------------
A0A3D4PJK1      --------------------------------------HHQ-LNILN-------------
A0A532UT69      --------------------------------------GKR-DDIIS-------------
A0A355AI52      --------------------------------------LRQ-TNLLE-------------
A0A354PCQ3      --------------------------------------GGT-ASRLV-------------
A0A0S8GZ23      --------------------------------------LTR-TEFLG-------------
A0A1I3DDV4      --------------------------------------ARD-ARSLN-------------
A0A2E0SMM6      --------------------------------------SPQ-TSLID-------------
A0A3L7SI46      --------------------------------------TRL-TNMIQ-------------
A0A356KTN1      --------------------------------------LES-TYLVD-------------
A0A5B9PJZ8      --------------------------------------KSN-SGVIK-------------
A0A2S8G191      --------------------------------------PDN-AEIME-------------
A0A2E7EGG1      --------------------------------------KGS-SELLE-------------
A0A2E2N5A9      --------------------------------------RGK-SQVVA-------------
A0A7C8AGA2      --------------------------------------VSN-TELIR-------------
A0A7C2FXP7      --------------------------------------SQD-TELIM-------------
A0A2E3GWC6      --------------------------------------HHK-LNILN-------------
F0SLB0          --------------------------------------HHK-LNILN-------------
A0A3L7NDH9      --------------------------------------VRS-TNLID-------------
A0A1N6DAJ8      --------------------------------------ASG-SEILR-------------
A0A532UD06      --------------------------------------GRK-DDIIT-------------
A0A660URN1      --------------------------------------GKK-DDIIK-------------
A0A517ZCB5      --------------------------------------ERK-TNVMN-------------
A0A225EH48      --------------------------------------WGS-PEILE-------------
A0A518INW8      --------------------------------------AEG-ASVLQ-------------
A0A518JPH9      --------------------------------------SQG-ASVLQ-------------
A0A5C5VEK8      --------------------------------------GQD-DEIIN-------------
A0A532UTJ0      --------------------------------------DRR-SELIH-------------
A0A432MFP3      --------------------------------------RPN-TSLIE-------------
A0A2E2CCW9      --------------------------------------RAF-LNILT-------------
A0A3C0AGX3      --------------------------------------RAF-LNILT-------------
A0A518AAQ5      --------------------------------------RTY-LNILN-------------
A0A517QBG9      --------------------------------------RTY-LNILN-------------
A0A518FTU3      --------------------------------------RTY-LNILN-------------
A0A517WHH5      --------------------------------------RTY-LNILN-------------
A0A5A8BGT3      --------------------------------------RTY-LNILN-------------
A0A2E7K7A9      --------------------------------------RTY-LNILN-------------
A0A517PTS5      --------------------------------------RTY-LNILN-------------
A0A6I6AH34      --------------------------------------RTY-LNILN-------------
A0A517VTK3      --------------------------------------RAY-LNILN-------------
A0A517WQT4      --------------------------------------RAY-LNILN-------------
A0A517VID8      --------------------------------------RAF-LNILT-------------
A0A517RK10      --------------------------------------RAY-LNILS-------------
A0A518IH18      --------------------------------------RAY-LNILS-------------
A0A5C5XLF4      --------------------------------------HHQ-LNILN-------------
A0A2D5NDU9      --------------------------------------GSD-NDVIT-------------
A0A1P8WP26      --------------------------------------DFG-TNVLD-------------
A0A3L7V1F3      --------------------------------------AFS-TTVLD-------------
D5SZ21          --------------------------------------ARQ-TNVLE-------------
A0A286RGB6      --------------------------------------PGN-SEFMN-------------
A0A518CHE5      --------------------------------------SPQ-TNLID-------------
A0A1V5N3W2      --------------------------------------GRK-TELIK-------------
A0A3E0MY27      --------------------------------------PRM-TAVLR-------------
A0A7C4Z5R7      --------------------------------------TQG-PEVLR-------------
A0A2E0X9P6      --------------------------------------IGE-SELYS-------------
A0A286RLF2      --------------------------------------VYR-TNIIT-------------
A0A517NSK8      --------------------------------------AKD-AHTLQ-------------
A0A5C5Z0D6      --------------------------------------ARD-AHILQ-------------
M5UE94          --------------------------------------AKD-AHTLK-------------
A0A2E8FLY0      --------------------------------------PRR-TNLID-------------
A0A3D2U1E1      --------------------------------------PRR-TNLID-------------
E8R3W3          --------------------------------------SFA-GDLMM-------------
A0A5C5ZM48      --------------------------------------RGD-SELFR-------------
A0A5B9WF77      --------------------------------------LPD-TNFIK-------------
A0A518BBX8      --------------------------------------SSP-DNVLE-------------
A0A1P8WN28      --------------------------------------ETD-EYVLE-------------
A0A3B9CTT0      --------------------------------------NSA-SQDLT-------------
A0A518ALT3      --------------------------------------VGK-SELYE-------------
A0A3M1QRP3      --------------------------------------AHN-SSILE-------------
A0A517TMV0      --------------------------------------VRK-TNIIR-------------
A0A3E0MY88      --------------------------------------AKG-TNIIH-------------
A0A5B9QF68      --------------------------------------TRK-TNFIN-------------
A0A5B9QGF0      --------------------------------------TRR-TNFID-------------
A0A5C6CK24      --------------------------------------TRK-TNFID-------------
A0A2E3RCU8      --------------------------------------VRS-TTVLN-------------
A0A1C3E6N1      --------------------------------------ARQ-TNVLE-------------
A0A518GJT2      --------------------------------------ARQ-TNVLE-------------
A0A2E8B0L9      --------------------------------------LRR-TNIVE-------------
A0A5Q4GFE7      --------------------------------------IRR-TNVIE-------------
A0A257WS34      --------------------------------------ARQ-TNVMT-------------
A0A7C4LP10      --------------------------------------ARL-TNIIT-------------
A0A517MLW3      --------------------------------------VRN-TNVIE-------------
A0A5B9QVD0      --------------------------------------LRN-TNVVE-------------
A0A3A0DET7      --------------------------------------GSQ-DDIIN-------------
A0A3B8PNV4      --------------------------------------PRR-TNLID-------------
A0A3D1DR40      --------------------------------------PRR-TNLID-------------
A0A2E7RYU8      --------------------------------------PRR-TNLID-------------
A0A3B8LXG8      --------------------------------------PRR-TNLID-------------
A0A286RD13      --------------------------------------ADQ-AEILE-------------
A0A2E3GWX1      --------------------------------------TRQ-TNLLS-------------
F0SG60          --------------------------------------TRQ-TNLLS-------------
A0A2E9VST2      --------------------------------------TRQ-TNLLQ-------------
A0A356A6X2      --------------------------------------ARQ-TNLLE-------------
A0A5C5XLM3      --------------------------------------ARQ-TNLLE-------------
A0A7C5FXU1      --------------------------------------PGN-SELME-------------
A0A3M1VCL4      --------------------------------------IKQ-TSLID-------------
A0A5C5V7Z9      --------------------------------------VRR-TKFIQ-------------
A0A5C5YT05      --------------------------------------VRR-TKFIQ-------------
A0A518D7F9      --------------------------------------VRK-TNVIE-------------
A0A5C5ZIP0      --------------------------------------TRK-TNFVS-------------
A0A518KBK3      --------------------------------------VRK-TNFIN-------------
A0A5C6AKF9      --------------------------------------VRK-TNFIN-------------
A0A6M5Z0K7      --------------------------------------VPS-TELVR-------------
A0A350CI62      --------------------------------------AYN-TNVMD-------------
A0A4P5WQK6      --------------------------------------AYN-TNVMD-------------
A0A3C1X4W5      --------------------------------------AYN-TNVMD-------------
A0A3D3W3A7      --------------------------------------AYN-TNVMD-------------
A0A518DRX3      --------------------------------------KRG-TNLIE-------------
A0A518DZF9      --------------------------------------KRG-TNLIE-------------
A0A518AKT8      --------------------------------------SRK-GSFVE-------------
A0A5C5ZR72      --------------------------------------VGG-SELYE-------------
A0A7C5R0U3      --------------------------------------VRR-THLIE-------------
A0A517TY85      --------------------------------------VGK-SELFE-------------
A0A5B9QEI7      --------------------------------------IGK-SELYE-------------
F0SI78          --------------------------------------AKA-EDILL-------------
A0A517MDV3      --------------------------------------AVV-NYIIEQLWIERGGQELAY
A0A518IQ30      --------------------------------------ARR-TSIIE-------------
A0A517LWP4      --------------------------------------ARR-TSIIE-------------
A0A518JNW8      --------------------------------------ARR-TSIIE-------------
A0A2E7ENQ5      --------------------------------------VRS-TNFIE-------------
A0A7C2KUQ9      --------------------------------------RPR-TSLID-------------
A0A7C5BZF0      --------------------------------------VQH-TNVLE-------------
A0A1G3AQE9      --------------------------------------LRN-KNIIT-------------
A0A3L7UQT9      --------------------------------------ERG-TTLID-------------
A0A4P5YBU2      --------------------------------------ERG-TTLID-------------
A0A7C7V5U8      --------------------------------------YQN-TNVIK-------------
                                                                            

A0A5S9IJB5      ------VSFKWTDP-RLPPRVVDFLQKAYIQQDRERRVGLSGTGIDILYRK---------
A0A5S9IPR9      ------ITCRGKNA-ENVAYIANLYVDVFVDENEREIKNAQDKLLNWLKQV---------
A0A533Q9U4      ------ISYDGHNP-QLITRIANMIVKTYIEQDWEKRYNVAKDALDWLNKQ---------
A0A533Q6B7      ------ITYTGDDP-YLITTITNAIVKTYIEQDWERRYSVAKEALEWLNKQ---------
A0A1U9NNE1      ------IKMKTNNT-AFSEELVDSFIRVYMTMQAYEENQGEDNKLALLENK---------
A0A2G2JCA2      ------VEFQSTDP-VKASLIVNEVAKSYYNLHNQTEAVKDKRVLDLLETE---------
A0A1G2XVR0      ------ISFTGTHP-ETLAKMCNMHAKKFLETHLELRFAASQDAVKWLQDQ---------
A0A1G3B0P0      ------ISFTGTHP-ETLAKMCNMHAKKFLETHLELRFAASQDAVKWLQDQ---------
A0A1E3X4X0      ------VSFSGNYP-DIITDILNAHVKFYKDQELERRFLASQDAVEWIDGR---------
A0A286U4B3      ------IKVSTGYP-ELCKKIADTIADEYIKKNLEDKVLTTSGATDEIVEQ---------
A0A5C6DDS2      ------LKAETGSP-GLCVSIVDTLADEYIKKNLEDKVLTTTGATGEIGKQ---------
A0A2E3GW02      ------FTFTCGHP-KDAQKVLEAVIASYFAFLDESQRTASNRTVELIKEA---------
A0A5B9QNZ7      ------AEFRHGQA-ADCATVLTAITESYQDFMAETLQDANSEATGLIQQA---------
A0A1Z8N7H5      ------ISYTSTKP-QNAVAIVTAVIKSYLQFVDETHKGTAAKIINVMTQE---------
A0A1G2YPI3      ------ISYDSPYP-NEAAQLVNTVIDSYITYHATQKRSTSSEILKILRAD---------
A0A1U7CZ81      ------VSFDSTDA-HEAAAIVNAVVASYLRSYKDVQQSRDESHLKRLTVY---------
A0A142YNY8      ------VSLESTNP-EEAAAIVNAVVASYLQAQNELTEGADGLMKKSLEDY---------
A0A1U7GLS6      ------VSLELNDP-EEAALIVNAVVAAYLRNYKDYKAGADKILRANLKTY---------
A0A532UIN2      ------LSFNSPYP-AEAAQLINEAVDSYITYHATRKRSTSAEVLKILQSE---------
A0A0S8KNX5      ------ITVLHPDR-EQARQIVDAFINAYTAVEVSASVEDEDKKLTILENE---------
A0A3D3UVZ8      ------ITMRSANE-EEAKQIVDAFIKAYMEIEVVSADEDENRQLAILENR---------
A0A517NFU9      ------ASYRDTNP-EDAAIVLSAIYDSYRDYVESHGHNSTEQAVELMEKA---------
A0A5C5YWH4      ------AAYRDSSP-EDAALVLSTIYDSYRDYVESHGHDSTEQAVELIQQA---------
A0A3D2TNK4      ------VTYRSKDP-KTAAAVVRAIIRAYLAFVEKHHKGTAGEIIADLTNE---------
A0A7C1Y4F0      ------VSLESPYP-VEAAQIVNELVRSYIAYHAERKRDTASEVLKILQKE---------
A0A6I0ENW6      ------IGFYATDP-KDAELIVKTIQQVYLDQTKGTADQRTRDLQQRLQEE---------
A0A6L3A0B7      ------IGFYATDP-KDAELIVKTIQQVYLDQTKGTADQRTRDLQQRLQEE---------
A0A0J1B4A0      ------ATYQDPDP-EVAAAALQAIFDSYQDYIDEQTSSVGNEAAELIARA---------
A0A142WSB9      ------VAYESADK-AVAKTVVEAIVKAYEDWLGQTKDKNSADLYAALQGS---------
M5SZR3          ------VSFEGEVP-EECPVIIRGILNTYQDYLEETYDTMSTDTVQLISEA---------
M5TW92          ------VSFEGEVP-EECPVIIRGILNTYQDYLEETYDTMSTDTVQLISEA---------
A0A2S8FKY2      ------VSMMSKDP-TSAPKIVNAVVSAYKDEVIETERLARVTRLENLERV---------
A0A517N8P6      ------VSFESGDP-TVATAIVNAVVDAYDKSINGRHQGNIENVVGFFRDS---------
A0A432MJP4      ------IDYRARTK-EEAVLLTDALIRSFEAFLEESYQSNNTKVVTLITEA---------
M5UQ35          ------ATFQDEDP-EMAAKILQAVYESYFSYIDNQSRAIGSEAADLIANA---------
A0A0S8FY64      ------ILVRAPDA-NVASLVANLVAQAYVDYSVAARQQSAGEAFEMLQRQ---------
A0A1N6KFT7      ------LQYQSAST-QESLQMIHAIVASYKKLLETNYQKNNQEVITLVSRA---------
L0DFG4          ------VQYQSASP-QESLDMIRAVVASYKKLLETNYQKNNQEVITLVSRA---------
A0A5C5XXG1      ------ISLNHTEP-EDAQRLLTAVLQTYSRYLDQQISDMMDLATAKINEA---------
A0A7C7YUM8      ------VTVDDSCP-YRAAETANALAKNYIRRSVQIGRLKAERTLGFIERQ---------
A0A7C2AHI6      ------LTIADHDP-NRAAELANALCQNYIQRSIRIGRYRASQTVTFVSEQ---------
A0A518BJJ1      ------LTVDDSDP-ERAAAVANALCHNYFDLNVERGRKRASQTVGFIQSQ---------
A0A518D182      ------LTVSDSDP-LRAAAKANALCLNYFDLKVERSRRRASQSIGFIEDQ---------
A0A5C5WTY6      ------VTFDHSDP-VVAQQVLQAVIDQYLQTLSQKVDEILERSHRVVLDT---------
A0A5C5Y033      ------ITLQHNSP-EDVQKILAAIMRRYERFIVSQVESVMGEAGRMIQDA---------
A0A5C6G1Y2      ------ITLQHNSP-EDVQKILAAIMRRYERFIVSQVESVMGEAGRMIQDA---------
A0A354PDV6      ------LAFAHTDP-EESRKILESVLVEYQNYIAGQLESVMSKANEYITHA---------
A0A5C6FZ02      ------ISLNHTEP-EDAQRLLTAVLQTYSRYLDQQISDMMDLATAKINEA---------
M5TIT3          ------VSFEHTNP-EDAQVLLTAVMKRYEQFIIAQVEQLMGKANEMIHEA---------
A0A5M6CY44      ------ISFSHPDP-EDARLILTAVMKQYEKFIVAQVEQVMGRANELVQKA---------
F2AXG2          ------ITFTHTDP-DDAKRILTAVMSRYQQFLIDQIDQVMSHADKMVQEA---------
M2BB46          ------ITFTHTDP-DDAKRILTAVMSRYQQFLIDQIDQVMGHANDMVTEA---------
L7CLQ6          ------ITFTHTEP-DDAKLILTAVMKRYEQFIKDQIEQVMGQANNLVEQA---------
A0A0J1B719      ------ITFTHTDP-DDAKLILTAVMKRYEQFIIDQVEQVMGRANEMVNKA---------
Q7UF18          ------ITFTHTEP-DDAKRILTAVMKRYEQFIIDQVEQVMGRANEMVNKA---------
A0A2G1W1E0      ------ITFTHTEP-DDAKLILTAVMKRYEQFIIDQVEQVMGRANEMVNKA---------
K5E235          ------ITFTHTEP-DDAKRILTAVMKRYEQFIIDQVEQVMGRANQMVNKA---------
A0A5C6FFI9      ------ATFRDPNP-DDAATILAAIYGSYERYVESHTQDTSREAAELIDAA---------
A0A5C5WDJ1      ------VTYRANDP-EEAAMVLSSIYNSYKTYIDSQDQDKSKLAVELIDAA---------
A0A5C5X547      ------VSFRDPDP-QAAMAIANAVVKNYYDKYVKADEQKDNKRLADLQLL---------
A0A353FIP5      ------ITYKDTDP-DRAAQVVNNLISSYAERSRERLALPAEKTVTYIEGQ---------
A0A5B1CIK7      ------VLFDHTDA-EDTQLVLTAILKRYEEFIISQVEQVVGQANQMVNQA---------
A0A5C5WHS2      ------IALTHTDP-EDTQLILTAVLKRYEQFIINQVEQVMGRANEMVNKA---------
A0A5C6B6G8      ------VSFKHTEP-DDAQLVLTAVMKRYEQFIIDQVEQVMGRANELVQTA---------
A0A5C5ZZN3      ------VTFTHTEP-DDAQIILTAVMKRYEQFIIAQVEQLMGRANEMVNEA---------
A0A5C5XS91      ------VTMTHTDP-DDAQLILTAVMKRYEQFIIAQVEQLMGRANEMVNEA---------
A0A5C6C4E6      ------VTLTHTDA-DDAQLILTAVMKRYEQFIIAQVEQLMGRANEMVNEA---------
A0A2E1VVJ1      ------ITYSDTSP-SRAQRFVNRLAEMYVAYKHDRLAAQAGATEAFVSKE---------
A0A3M2AEL0      ------LSYFDTDP-ERAAQVANALLRAYIEHNKSRLSRQASSTVQFIKDE---------
A0A2A2W9R6      ------ATYRDSDP-ETAAKVLQAIFDSYQLYIDGQSRDVGAEAVELIAKA---------
A0A518HKC1      ------ATYRDGDP-ETAAKVLQAVFDSYQLYVDGQSHDVGAEAVELIAKA---------
A0A518L3P0      ------ATYRDGDP-EVAAKVLQAIFDSYQLYIDGQSHDVGAEAVELIAKA---------
A0A255R1S0      ------ATYQDGNP-EVAAKVLEAVFETYFDYVETRSQSVGSEAAELIANA---------
A0A5B9MKP1      ------ATYKDEDP-EVAARVLQAIFDTYQNYVEGHSENVGAEAAELIAKA---------
A0A0S8J591      ------IWVLWPDP-KMAARMVNAVTDAYTDILKEWRSSAFDASVRALLNR---------
M5RT57          ------ISLATSDP-ESSAKLVNAILDTYFAVRAKDNEDQTARVLELLGQE---------
A0A351FYP6      ------LRAYDRDK-NLAQQIAQALAKEYENYRSSLQEERVKAGIDKLRER---------
A0A2E7ESJ6      ------IRFIGPYP-EDTQKVVNAVLHTYQQFLQEAYEDSGTETRDLIVKA---------
A0A2D5AWU0      ------IAYLSPFP-DEAAKIARATVEEYIAYHKRKKRESAEESAAIIRGE---------
A0A1G2YQB7      ------IAVKSSNP-TSASKIANAFVQAYMTIVASEEVKDGDHKLTVLENE---------
A0A353P687      ------ISVKSSNP-SNASKIANSFVQAYMTIVATEELKDGDHKLTVLEDE---------
A0A356EME5      ------VDFQGPDP-KNAAKIVNAVVKRYFDLLAEVTDERVAKVIALLDRE---------
L0DC26          ------ISMTGEKP-EIPMLLVNAVTQAYMDEIVDVEMKQSRQRYDLLKST---------
A0A3L7P4E4      ------ISFKGTDP-DDCAKVVNAVVASYDKNLRETYTDQGMVVSNLLKDA---------
A0A3L7PEB5      ------ISFKGSDP-VDCAKVVNAVVASYDKSLRESYADKGTVVAKLLTNA---------
A0A1U9NL64      ------VSFDSPYP-AEAAHVVNEIIDSYITYHSQRKRSTSAEVLKILQKE---------
A0A2N1UCJ3      ------VSCLSPYR-EEAAQIVNAVIEAYVDYQTSQKKSSVSEVLKILQKE---------
A0A7C4EK84      ------VSLESPDP-RQAAVLVNSVVESYVEYQSRQQRWTAAELLKILNRE---------
A0A7C3F0T2      ------VSLESPYP-EEAAQIVNAVVDAYVTYQGASRRSTAAEVLRILQRE---------
A0A2E0X4J3      ------VSLELPDP-EEAAQLVNAVVDAYVSKYAGDYQDSALELLNILREE---------
A0A5C5YU10      ------VSLTLPNP-VEAAQLVNEIVAAYITQYAEKHNTETFKILEILNGE---------
A0A517MPZ6      ------VMIELPSA-EDAAQIVNSVVDAYISKYAEERRTDTVEVLNILRNE---------
A0A5C6CNV7      ------VSAELANS-ADAAQLVNSVVEAYISKYAEERRTDTVEVLTILRNE---------
A0A518K5H4      ------ISIELENP-TDAAQIVNSVVDAYITKYAEERRSDVVDVVNILRSE---------
A0A5C6AA28      ------IAIELENP-TDAAVIVNSVVDAYITQYAEERRTNVVDVVNILRSE---------
A0A2E9VK20      ------LQYTTSKS-KDATAILNGVIKAYDDYLKDDARKNHAELQTLLEQI---------
A0A3D4PJK1      ------LQYTTSKS-KDATAILNGVIKAYDDYLKDDARKNHAELQTLLEQI---------
A0A532UT69      ------VSFSSPYP-DEAVEIVNAAVDSYKAHYVSRKRNTSAEVLKIIQSE---------
A0A355AI52      ------LNFRSSHQ-DATAVVVAAIIQAYAKFMDESHRGTANSIVDLLQNE---------
A0A354PCQ3      ------VSYQDSDR-EAAATVCNAIVQSYLRQRDAFDSIRVNNLERWLEPE---------
A0A0S8GZ23      ------VSMTSRKP-RQAEQIVNAFMKEYMKVVDNIDLGMEDQDLANLRKL---------
A0A1I3DDV4      ------IAFRHTNP-DEALLILQALVAEYESFLDEQVSRIMSEANRLITQA---------
A0A2E0SMM6      ------VRFISKSP-ETAAYTTNQIIACYIKFMQETHQYGTQNLLTLLQQD---------
A0A3L7SI46      ------VRYVSKNA-KTAKLVVDAIVAAYLEYMNEIHKGNSKESMVLLNRE---------
A0A356KTN1      ------VSYESTDP-KRCDRYANAVAEAYREQLQTLWGEKTQIAEKKVSEQ---------
A0A5B9PJZ8      ------ISFDGGNQ-KEAEQILDAVVKAFGSYIDSDAEEIGGQTTQLWKTL---------
A0A2S8G191      ------VKLSGESP-QSISKIVNAVVQAYMDEVVDAEANMRRSRLSSLERA---------
A0A2E7EGG1      ------VAFEGVNP-ENSALLVNAIIDAYFTMRQEKRGQRAQSVISLLEDE---------
A0A2E2N5A9      ------VEVLLADS-YVAMKAANALVEGYIASKFEAGVATSATATAWMDSR---------
A0A7C8AGA2      ------IKMTTDHQ-KQAERIVDAFIQAYMARVVRDEIRGEDQKLNTLAEE---------
A0A7C2FXP7      ------ITIEWHDV-KEAQQIVDSFINSYMAVEVSTSIQGEDRTISVLEEE---------
A0A2E3GWC6      ------LQYTSTSE-EDAKQILNAVVKAYDEYLQDDAQKSHRELTQLLNQI---------
F0SLB0          ------LQYTSTSE-EDAKQILNAVVKAYDEYLQDDAQKSHRELTQLLNQI---------
A0A3L7NDH9      ------LKYRAQDP-RAAAMAVGAIIKAYSLFMQETHRGSAGTLVEVLTKE---------
A0A1N6DAJ8      ------ISINGEKP-QVPMLLVNAITQAYIDEIVDVETKQRRQRYDLLKET---------
A0A532UD06      ------VSFDSPYP-QEAAQLVNAMVDSYVRYHSARQKSTVSEVLRIIEKE---------
A0A660URN1      ------VSFDSPYP-AEAAQIVNAVVNSYVDYHSSRKRSTVSEVLKILQKE---------
A0A517ZCB5      ------IRYRSGDA-DTAYVVVSTLIGAYLEYMDHVMENTARDLLGILSQR---------
A0A225EH48      ------VSMNGDDP-KQILLIVNTMVDEYIKDADSDERQGRQRRRKIIEAH---------
A0A518INW8      ------VSFQSADP-EDAQHVLEVIYERYCHHVESRTQNVGQEAATLINQA---------
A0A518JPH9      ------VTYQSSDP-EDAEYVLEVVYERYCHHIESRTQNVGEEAAALIIQA---------
A0A5C5VEK8      ------VGLELPNR-FEAAQLVNAIVDAYITQYAEKRRNDTVEVLKILRSE---------
A0A532UTJ0      ------VTMQTTKP-EEARQIVDAFITAYMDIEVLSAVEGENARLTLLEDR---------
A0A432MFP3      ------VAAEAERA-HEAADVVNAVVRSYLDANKEWSEARTNNAIRMLVEY---------
A0A2E2CCW9      ------ITYENPNA-KDARTVTQAIVDAYKRYLHEVREENTEDIIQQLKEA---------
A0A3C0AGX3      ------ITYENPNA-KDARTVTQAIVDAYKRYLHEVREENTEDIIQQLKEA---------
A0A518AAQ5      ------LTYENPNS-HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLNKA---------
A0A517QBG9      ------LTYENPNS-HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLNKA---------
A0A518FTU3      ------LTYENPNS-HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLNKA---------
A0A517WHH5      ------LTYENKNS-HDAKAIMQAIVDAYQHYLDEVRDQNTGEIIEQLNKA---------
A0A5A8BGT3      ------LTYENKNS-HDAKAIMQAIVDAYQHYLDEVRDQNTGEIIEQLNKA---------
A0A2E7K7A9      ------LTYENKNS-NDAKVIMQAIVDAYHHYLDEVRDQNTGEIIDQLNKA---------
A0A517PTS5      ------LTYENKNS-NDAKVIMQAIVDAYHHYLDEVRDQNTGEIIDQLNKA---------
A0A6I6AH34      ------LTYENKNS-HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIDQLNKA---------
A0A517VTK3      ------ILYENPRS-QDAKIVTQAIVDAYQRYLHEVRQVNTNEIREQLDQA---------
A0A517WQT4      ------ILYENPRS-QDAKIVTQAIVDAYQRYLHEVRQVNTNEIREQLDQA---------
A0A517VID8      ------ITYENPNA-KDAQAVTQAIVDAYKRYLSEVREENTEDIIQQLKDA---------
A0A517RK10      ------ITYENPLS-ADAKAVTEAVVKAYRKYLNDVSDENTKDIIKQLNVA---------
A0A518IH18      ------ITYENPLS-QDAKAVTEAVVKAYRKYLNDVSDENTKDIIKQLNEA---------
A0A5C5XLF4      ------LQYTTSKS-KDATAILNGIIKAYDDYLKDDAQKNHSELQTLLEQI---------
A0A2D5NDU9      ------LTLDNRHK-HEACALVNEVVEAYQKFQRKMQRNSATELYRILDMD---------
A0A1P8WP26      ------VSYRSTDA-KVAAAVVAHVLVAYNSFMNDVNRGSSDKNIERLEAQ---------
A0A3L7V1F3      ------LSYKSKDP-KAAQAVLRSMLAAYVEFLDDTHNGSSEESIRKLKQQ---------
D5SZ21          ------LTCRSRDP-KAAAAILYAVLSASIDFLNKNHQGTSQEILQILSKE---------
A0A286RGB6      ------VSFTSTRP-DETAVIVNAIVDAYMREVVDTEQRERRQRLSELDQL---------
A0A518CHE5      ------IRFTSQSP-ETAAYTIDQVIMAYLKFMEETHQNGTQNLLKLLTED---------
A0A1V5N3W2      ------ITMDSLNP-KEAELVVDAFVRAYMNIEGSRSMEGGNKNLEVLESE---------
A0A3E0MY27      ------ISMSGDEK-EPVRMIVEAVAQAYLENVVRRERNDLLAKLSELERQ---------
A0A7C4Z5R7      ------LTLKGQNP-EELAAILNTITSVYLDQVKKQDLERRQARFNQLQTS---------
A0A2E0X9P6      ------VDYVSPSA-SDAATVANLVVLEYLQMQGQQERQRTQLVIDLLEQE---------
A0A286RLF2      ------VEYRSKDP-GVAARIVGAVVQSYLDFMRSTTQGTTAEIIRILTTE---------
A0A517NSK8      ------ATYDDPSP-EDCAVVLRAIFDAYDVYLKEHFSSNSSQAIDLLSQL---------
A0A5C5Z0D6      ------ASYDDPSP-SDCAVILRAIFDEYAAYLKEHFEGTSTQAVDLLTEL---------
M5UE94          ------ATYDDPSP-VDCALILRAIFDEYKIYLDDHFAGTSTQAVELLTQL---------
A0A2E8FLY0      ------VRYRSRDP-QVAATVVNHIVESYLTLMRGIHKNNAGNDIQFMTAE---------
A0A3D2U1E1      ------VRYRSRDP-QTAAAIVNHVVNSYLKLMREIHKSTASEDVEFLTKK---------
E8R3W3          ------VSIPTPYP-EEASTLTNTLVNSYLRFANVLEMDRKMDEFSQLRDS---------
A0A5C5ZM48      ------LSMESTDP-QAAKDVINALARSYLDFRSKQESETKRRVIALLQQQ---------
A0A5B9WF77      ------ISLESTNP-QEAADTVNAVALAYKLATQPDDTQLVPPAITGLRKDTAQAEVAAL
A0A518BBX8      ------VSFSGKLP-EESRLILAAVIDSYRDFLDETYKNITDETATLMTQA---------
A0A1P8WN28      ------IKCRSTSP-ESTVNVIEGLSVASGKFMDEYQKDLSVELMKQLERK---------
A0A3B9CTT0      ------ISCRSRDP-ESTVAVIEALQEVSEQFIEDYQTSLTVTLMNRLQED---------
A0A518ALT3      ------VAYTSSSA-DDAATVANYVVAEYMTVENDETDKRTNMVINTLREE---------
A0A3M1QRP3      ------IAVTLPDS-YDSAVVANAIADEYLRAVREDEQEDSESLAAERRRQ---------
A0A517TMV0      ------LGYESLDP-ETAAAVVRAVLDSYLDFVSESHRGAAADFLDKLIVQ---------
A0A3E0MY88      ------VRYQSKDP-DAAEAVLNSLLTSYKNFIKSTHGRTAEDVMEVLQQE---------
A0A5B9QF68      ------VSFRSKSP-DAAAAVVRAIIHSYLQFVQEKDRGTAVDALHSLLQK---------
A0A5B9QGF0      ------VTYRSKSP-DAAAAVVRAVINSYLQFVQEKHQGTAGDALHSLLQK---------
A0A5C6CK24      ------VTYRSKHP-EAAAAVVRAIINSYLQFVQDKHQGTAGDALHSLLQK---------
A0A2E3RCU8      ------ISATSTQP-KNAVAMVNAVIQSYLQFVDQTHQGTATKIIQVMTRE---------
A0A1C3E6N1      ------LTCRSRDP-KAAAAILYAVLSASIDFLNKNHQGTSQEILQILSKE---------
A0A518GJT2      ------LTCRSRDP-KAAAAILYAVLSASIDFLNKNHQGTSQEILQILSKE---------
A0A2E8B0L9      ------LNYRSKSP-HAAEAVVDAVVDSYIEFMKENHTDVSVEIVSILEKE---------
A0A5Q4GFE7      ------ISYKSRSP-GAAEAVVGAVVQSYLEFMERSHKDVSTEIVQILDRE---------
A0A257WS34      ------LRYRSTDP-ELSAYIVSSVLNSYLKFMQATHRHSSRETLDVLTRE---------
A0A7C4LP10      ------LRCTSKNP-QTAAFVVGAIVESYLRFMAETNRNSSQETLLLLTRK---------
A0A517MLW3      ------LSYRSASP-KAAEVVLDVLVQSYLDFMQQHHQDTSVTVLELLKGE---------
A0A5B9QVD0      ------LSYKSGSP-EAAKAVLDTLVDAYLAFMQQHHQDTSIQVLELLQAE---------
A0A3A0DET7      ------VSAELPNA-ADAAQLVNSIVDAYVSKYAEQRKTNTVEVLTILRNE---------
A0A3B8PNV4      ------VRYRSRDP-QVAATVVNHIVESYLTLMQGIHKNNAGNDIQFMTAE---------
A0A3D1DR40      ------VRYRSRDP-QVAATVVNHIVESYLTLMQGIHKNNAGNDIQFMTAE---------
A0A2E7RYU8      ------VRYRSRDP-QVAATVVNHIVESYLTLMRGIHKNNAGNDIQFMTAE---------
A0A3B8LXG8      ------VRYRSRDP-QVAATVVNHIVESYLTLMQGIHKNNAGNDIQFMTAE---------
A0A286RD13      ------ISMTGGDP-EQIAAIVNAVKDAYMSEVGDVSRNYALERKKLLEAN---------
A0A2E3GWX1      ------VNYRTTDP-KSAAIIVTEILNSYFAFMQDMHQNSSREMLKLLTAE---------
F0SG60          ------VNYRTTDP-KSAAIIVTEILNSYFAFMQDMHQNSSREMLKLLTAE---------
A0A2E9VST2      ------VSYCSESP-EVASLIVTEILNSYFQFMHEMHESSSGELLETLTTE---------
A0A356A6X2      ------VKYCSESP-EESSTIVTEILNSYFKFMHEMHESSSGQMLDTLTKE---------
A0A5C5XLM3      ------VKYCSESP-EESSMIVTEILNSYFKFMHEMHESSSGQMLDTLTKE---------
A0A7C5FXU1      ------VSYTAKNP-QEAAAIVNSVVESYLQEVVGVELAERRQRLDELDQL---------
A0A3M1VCL4      ------VRYRSRDP-KAAAAMVEAILAAYLDFMERTHKKGAHDNLEVLTRK---------
A0A5C5V7Z9      ------VSYRSHQP-ESAVAVVNSVINSYLRFVEETHRSTAADVLDVLTVE---------
A0A5C5YT05      ------VSYKSRRP-ESAVAVVNAVINSYLHFVEETHRSTAAEVLDVLTIE---------
A0A518D7F9      ------VRYRSKEP-EAATAVVTSVINSYLAFVDRTHRGAALDIHEMLTTK---------
A0A5C5ZIP0      ------VAYESLHP-EAAAAVVNAVINSYLEFVEETHRGTAADVLNVLTVE---------
A0A518KBK3      ------VGYDSLDP-EAAAAVVRAVIEAYVDFVGETHRGTAAEVLDVLTIE---------
A0A5C6AKF9      ------VGYDSLDP-EAAAAVVRAVIEAYLDFVAETHRGTAAEVQDVLTTE---------
A0A6M5Z0K7      ------VSMSSRGSGDDLRPIVHAVVRSYMSKSIEVEVDEKFKHLELLKTI---------
A0A350CI62      ------ISYRSRDP-RAAAAMLTAMLAGYEQFLNETNRGLSEQGLKTLATR---------
A0A4P5WQK6      ------ISYRSRDP-RAAAAMLTAMLAGYEQFLNETNRGLSEQGLKTLATR---------
A0A3C1X4W5      ------ISYRSRDP-RAAAAMLTAMLAGYERWLNETNQGLSEQGLKTLGTR---------
A0A3D3W3A7      ------ISYRSRDP-RAAAAMLTAMLAGYERWLNETNQGLSEQGLKTLGTR---------
A0A518DRX3      ------LSYRAKSP-EAATAVVAAILSSYLDFMDKNHKDVSLEIVTILDQE---------
A0A518DZF9      ------LSYRAKSP-EAATAVVAAILSSYLDFMDKNHKDVSLEIVTILDQE---------
A0A518AKT8      ------VRYRSLDP-DAAAAVVSEVVNSYLSFVDQTHKGSAGDTIEMLDGR---------
A0A5C5ZR72      ------VAYTSPSA-KESADVVRAVLQQYFARQSDEEYQRAQRVIDLLERE---------
A0A7C5R0U3      ------LAYRSRSP-RVAHATLESLISAYHDFIDEHHRGMAVEVADLLERE---------
A0A517TY85      ------VAFHSRSP-DDAATVVNAVVMTYLEKNREKETDRSKLVISELEKE---------
A0A5B9QEI7      ------VSFVSPSS-QDAASVANVVVAEYLALQNREERQRSQMVIEVLEKE---------
F0SI78          ------FTFTCGHP-KDAQKVLEAVIASYFAFLDESQRTASNRTVDLIKEA---------
A0A517MDV3      APLTFVAEFRHNDA-ADCALVLSAITESYQDFMAATLQDANSEATGLIQQA---------
A0A518IQ30      ------LSYRSKST-PAAQAVLQAVVESYLEFIDTSHKDVSVEIATILKDE---------
A0A517LWP4      ------LSYRSKST-LAARAVLEAVVESYLEFIDTSHKDVSVEIATILKDE---------
A0A518JNW8      ------LSYRSKST-LAARAVLEAVVESYLEFIDTSHKDVSVEIATILKDE---------
A0A2E7ENQ5      ------VSYRSRDD-EAAVAILDAVVESYLDFIDLNQKNVATEIVRILDKG---------
A0A7C2KUQ9      ------ITMQARDK-TSAAKIVNAVARRYEAHSDEQQRMKSDLRWQELDQR---------
A0A7C5BZF0      ------LQYRSKEP-RAAVAVVDAILDAYMEFIEETYQGAAKEIVTLLTSE---------
A0A1G3AQE9      ------ASYRSRDP-DAAVSVVSAVVACYLKFTDSTLKGQAGEVFDVLSQE---------
A0A3L7UQT9      ------VRYRSRSP-KVAAFIVQRIVTEYINNINRTYGNQTQDAVAKLTEE---------
A0A4P5YBU2      ------VRYRSRSP-KVAAFIVQRIVTEYINNINRTYGNQTQDAVAKLTEE---------
A0A7C7V5U8      ------IEYRSRDP-DAAVAVVNAVLDSYLEFMEQTQKGTASRVLEVFELQ---------
                                                                            

A0A5S9IJB5      ----EGELRAELETFANQIQDYVLKN-----------------------------KLINV
A0A5S9IPR9      ----VPNLEKKIREKRDILIKLQQEY---------------------------PEIRTYN
A0A533Q9U4      ----LKDVKIALEESEAALQRYKREN--------------------DLISVEAVGSENLT
A0A533Q6B7      ----MENVKDAVEQSELALQKYKKEN-----------------NIFGIEPVGSGESGRIE
A0A1U9NNE1      ----RASTAKQMQQQRKIIRQLAEEF-----------------------------GTTSL
A0A2G2JCA2      ----KNSRESGLKDLRGVVKTLAIET--------------------TGKDPYVVTSSSER
A0A1G2XVR0      ----LVDKKLKVEEAEEALILYKEKQ-----------------------NIVGLGE----
A0A1G3B0P0      ----LVDKKLKVEEAEEALILYKEKQ-----------------------NIVGLGE----
A0A1E3X4X0      ----LKDLGKDLEKDEEELQKYKEDE-----------------------DLITLDNLGTV
A0A286U4B3      ----LKEIKIKIEDSEKKLYKYAREN-----------------------DIVAMDA----
A0A5C6DDS2      ----LKEIKKRIEDSEKELYKYARQN-----------------------DIVAMDA----
A0A2E3GW02      ----KDDLTESLTKKETAYQQFREDS----A-LLWT------------------SDEGN-
A0A5B9QNZ7      ----RDDMSLEIDQLENTYREFRRST----P-LLTL------------------GPDSL-
A0A1Z8N7H5      ----KDDIGRQLMEEETKLADARVAS----GDFSIS------------------AESNIV
A0A1G2YPI3      ----KTKRDKELSETLKKLLDFQNDN----PDIVLE------------------DSRG--
A0A1U7CZ81      ----LDRLKKDKEEKVEALKEIVERGNVNGQSAGESKPKESTKTQGSDP-----APQTKD
A0A142YNY8      ----LKKMIDDKKEKVKELSTLMSKGKVDSQSLTPNQASQANTAGPAAPADGTVQDSSKA
A0A1U7GLS6      ----LDEKQKERKQKEKDLAALVDSG-VDARNVAQREPAPDR------------QGEDPA
A0A532UIN2      ----KTKRGKELTEKLTTMLDFKKEN----EALAFE------------------GSRG--
A0A0S8KNX5      ----RKLLAEKMESQRQAIYRLGQEY------GTVA------------------LGSRT-
A0A3D3UVZ8      ----RDYLYEKIENDRQTIYQLGQEY------GTVA------------------LEGRQ-
A0A517NFU9      ----RETHELELATADREYREFVTSV----P-VLIE------------------GSTVQ-
A0A5C5YWH4      ----RQTHEEELAAADIAYREFVKSV----P-VLIE------------------GDSVQ-
A0A3D2TNK4      ----RNQIQASLKSKQLQLQKFRQEV----GHLAVS------------------TEDGVI
A0A7C1Y4F0      ----KESRDKYLTDKLEEMIAFTEEN----GIVSFD------------------DKGG--
A0A6I0ENW6      ----EGRLKNTLTSLISSRGTFTGKF-----------------------------GSASL
A0A6L3A0B7      ----EGRLKNTLTSLISSRGTFTGKF-----------------------------GSASL
A0A0J1B4A0      ----QVQNEKALREADQAYREFVASV----P-ALIS------------------SNINGR
A0A142WSB9      ----RTALIDDISKMEAAWKAWRDASPYFYPTPPVV------------------TVNGVA
M5SZR3          ----RDLLLRDIRKQEFEYREFRRES----P-LLTT------------------DEGGS-
M5TW92          ----RDLLLRDIRKQEFEYREFRRES----P-LLTT------------------DEGGS-
A0A2S8FKY2      ----HSETENKARQMRSDFKQLAETLGTSDS-ETLS------------------LAQQGS
A0A517N8P6      ----RDSIIPKLDELENEFTEFRANA----P-LEWN------------------GKGEAI
A0A432MJP4      ----RDLISKELVDLEQKYLEIRKKN----T-VLAT------------------DQSGR-
M5UQ35          ----QLKNEETLRRADKAYREFLASM----P-ALVD------------------TNQDGE
A0A0S8FY64      ----MKEQEKALVKAEDDLLTYREQT----TIPELG------------------TPNEQ-
A0A1N6KFT7      ----RDDLKKELDLLQAEYHKFRKDN----P-GFAI------------------GSNGQ-
L0DFG4          ----RDELKSELDTLQDEYHKFRKNN----P-GLAI------------------GANGQ-
A0A5C5XXG1      ----KNEVEGELHIAEKKYLEHRQTA----P-MLFQ------------------GEGSS-
A0A7C7YUM8      ----LQGQLVTLQAAERVVADLQSEN----P-ETIS------------------LPDAA-
A0A7C2AHI6      ----LAAQEQALREAEDEVVQLQSLH----P-ETID------------------VSAAS-
A0A518BJJ1      ----LDEQLAALETAEHEVVDLQAEN----L-DAID------------------SVATA-
A0A518D182      ----LDEQTAALETAEADVVALRKQY----P-DLID------------------LTTSA-
A0A5C5WTY6      ----QQQLAAKIGELEQRQKLARDQA----P-ILFD------------------GSNTT-
A0A5C5Y033      ----KRALEADLQAAEEEYLVSRQNA----P-LFFQ------------------GEGSS-
A0A5C6G1Y2      ----KRALEADLQEAEEEYLVSRQNA----P-LFFQ------------------GEGSS-
A0A354PDV6      ----KDEVESELRNAEQDYLTARKAA----P-MLFQ------------------GEGSS-
A0A5C6FZ02      ----KNEVEGELHVAEKKYLEHRQTA----P-MLFQ------------------GEGSS-
M5TIT3          ----KQEVESELLASEQEHLKARQNA----P-LFFQ------------------GEGSS-
A0A5M6CY44      ----KSDVEESLATAEQEQLKARQEA----P-LFFQ------------------GEGSS-
F2AXG2          ----KSVVQKNLKEAEDEYLAARRKA----P-LSFQ------------------GEGSS-
M2BB46          ----KSKVEKSLEDAENEYLAARQKA----P-LFFQ------------------GEGSS-
L7CLQ6          ----KTDVQGKLTNLEAEHLKFRRDA----P-LFFQ------------------GEGSS-
A0A0J1B719      ----KTEVETDLIAAEQEHLKARQEA----P-LFFQ------------------GEGSS-
Q7UF18          ----KTEVEAELVAAEQEHLKARQEA----P-LFFQ------------------GEGSS-
A0A2G1W1E0      ----KTEVEAELVAAEQEHLKARQEA----P-LFFQ------------------GEGSS-
K5E235          ----KTEVEAELVAAEQEHLKARQEA----P-LFFQ------------------GEGSS-
A0A5C6FFI9      ----RIENEKELDAADREYREFISSV----P-VLLE------------------GERVR-
A0A5C5WDJ1      ----RETHEKELRDADEDYRNYVASV----P-VLLE------------------GDKVR-
A0A5C5X547      ----YQEKTKELKAARTRLVDLAETAGSGSS-ESLT------------------LNQQST
A0A353FIP5      ----VERIQLELAEAEAELVA-------------FQ------------------EEEKA-
A0A5B1CIK7      ----KNEVETELVAAEQEYLTARQNA----P-LFFQ------------------GEGSS-
A0A5C5WHS2      ----KTEVETDLVAAEQEYLTARQEA----P-LFFQ------------------GEGSS-
A0A5C6B6G8      ----KSEVEAELNAAEQEHLASRKAA----P-LFFQ------------------GTGSS-
A0A5C5ZZN3      ----KQEVESELLAAEQEHLQSRQNA----P-LFFQ------------------GEGSS-
A0A5C5XS91      ----KQDIEADLVAAEQEHMKSRQSA----P-LFFQ------------------GEGSS-
A0A5C6C4E6      ----KQDIEADLIAAEQEHLKSRQDA----P-LFFQ------------------GEGSS-
A0A2E1VVJ1      ----IERIQGELDAAEDEIVK-------------YQ------------------EANET-
A0A3M2AEL0      ----IERVRRELEDAEQELVS-------------YQ------------------EAEGA-
A0A2A2W9R6      ----QVQNEIALQKADQEYRDFVASV----P-ALLN------------------VSGSGV
A0A518HKC1      ----QVQNEIALQEADQAYRDFVASV----P-ALLN------------------VSGSGV
A0A518L3P0      ----QDQNEVALQKADQEYRDFVASV----P-ALLN------------------VSGSGV
A0A255R1S0      ----QAKNEEELRAADKAYRDFVASV----P-ALVL------------------SGG---
A0A5B9MKP1      ----QLRNEMDLRKADEEYRNFVASV----P-ALVN------------------VSGSGV
A0A0S8J591      ----AQDIKREQDKASRAVQDFSAER----E----------------------IYALPE-
M5RT57          ----KQARSVEIQNLREKMRQLGQDV-------------------VGMDPYTGMPQKNGG
A0A351FYP6      ----MKKTNDEITAMQANVDDLRAKL----G----------------------ISDAAGE
A0A2E7ESJ6      ----KDDLLKKWQMLEREYGEFKAST----PL---------------------MYNGQE-
A0A2D5AWU0      ----LGSILKVRDDLTEKIIRLRT----------------------------ENNITQG-
A0A1G2YQB7      ----RRVMGEKIERQRKTLNDMAQ-------------------------EFGTIVLDNR-
A0A353P687      ----RRVMAEKIERQRKTLNDMAQ-------------------------EFGSVILDNR-
A0A356EME5      ----IANRKKHVEEKRRQIQT-RTLA-------------------ETGKDPFATTLHAG-
L0DC26          ----WNRYQESLREKRKQLKRLTELA-------------------GSDDKTTLASIHQHE
A0A3L7P4E4      ----KEEWLTTLRKCEDEYAEFRK-------------------------SSSLIYNGEN-
A0A3L7PEB5      ----KDEWTTNLRKLEAEYAEFRK-------------------------TTSLIYNGES-
A0A1U9NL64      ----KTKRAKELEENLHAMMNFKR-------------------------ENEGLAFENN-
A0A2N1UCJ3      ----KITRDQELSANFKELLEFTR-------------------------QYGVISFEKS-
A0A7C4EK84      ----KDRRDAELAEKLRAMLEFKQ-------------------------ANGALSFESD-
A0A7C3F0T2      ----KARRETELAAALKAMTDYQK-------------------------SNDLLAFQGS-
A0A2E0X4J3      ----KRDRQAELDAAQTALDDFRN-------------------------AHPELAVQVR-
A0A5C5YU10      ----KQRRDKVLIEARRELTAFRE-------------------------ANPELAVLVD-
A0A517MPZ6      ----KQRRDAELEQRIEALEKFRG-------------------------QNAALAVQVG-
A0A5C6CNV7      ----KQRRDAELEARRQELIEFRQ-------------------------QNAALAVQVG-
A0A518K5H4      ----KQRSDQDLEERRQALDEFRR-------------------------DHVTLAVQSKE
A0A5C6AA28      ----KQRRDDELESRRKALESFRQ-------------------------EHVSLAIQSK-
A0A2E9VK20      ----NNDLSPRLAAKTKEYHEFRRNA----PLVWKAPAGA-------------DKGPNN-
A0A3D4PJK1      ----NNDLSPRLAAKTKEYHEFRRNA----PLVWKAPAGA-------------DKGPNN-
A0A532UT69      ----KTKRTQELSEKLKTMTDFKKAN----EA---------------------LALEGE-
A0A355AI52      ----KEEVDKKIQVKQEEFLAVRKKV-------------------GDLG----IKEGGK-
A0A354PCQ3      ----IQRWEQEVAERRRVVQKLSEQT----L--------------GYAPGSKTSILENQ-
A0A0S8GZ23      ----KLELENKLKNHLQELRKINEKY----G----------------------ADSLEG-
A0A1I3DDV4      ----QGKIESDLKSLEEQYVQARQSA----PI---------------------IYVGNE-
A0A2E0SMM6      ----QANLIAQYKQNATDLIELQRRS----DLL--------------------LNNGTE-
A0A3L7SI46      ----KAQSEVAIRNKETDLLGLKRDS----GIL--------------------LHGNDK-
A0A356KTN1      ----ADLLYQKLTKSEQDLRDFLNQS----AE---------------------TPLLEE-
A0A5B9PJZ8      ----NENMLSRTKEVQEEIEKLMGLP----EM---------------------LIVDGR-
A0A2S8G191      ----YSETENELRSKRSEFRRLADTL-------------------GTGD----TASLSL-
A0A2E7EGG1      ----RARRSEEIKLLQAEVRQLQKQL----V--------------ANDPSLTSTSLIGS-
A0A2E2N5A9      ----LEELRQKLQESENRLQAYRESE----G----------------------LVDLQG-
A0A7C8AGA2      ----RRNLAEKIQRQQDTIRQLADEF----G----------------------STELTS-
A0A7C2FXP7      ----RRVLAENMQRQRHDILEMGKEY----G----------------------DTALGT-
A0A2E3GWC6      ----NNDLTPRLNAKTEEYQRFRDEA----P---------LLWKAPPGA----DAAPGD-
F0SLB0          ----NNDLTPRLNAKTEEYQRFRDEA----P---------LLWKAPPGA----DAAPGD-
A0A3L7NDH9      ----KTDVDLRLQKTEAEFLVIRQRV-------------------GDLG----IKSDGK-
A0A1N6DAJ8      ----WNRYQENLREKRKELKRLTELA-------------------GSDD----KKTIAN-
A0A532UD06      ----KVRRDEELSGKFSELLAFTREN----GV---------------------VSFNDN-
A0A660URN1      ----KVKRDAQLTEKFQQLVQFTKEN----GI---------------------VSFDDK-
A0A517ZCB5      ----KDALERDLKAREAELIEMKSRS-------------------QLLF----ASDEDR-
A0A225EH48      ----LETLNRLIKSREDRLKDWVKLG-------------------QAPG----EQASVL-
A0A518INW8      ----QLTNEQELQQATQAYTNFLSTS----VG---------------------MFDGDQ-
A0A518JPH9      ----QATNEQELQDATQAYTAFLATS----VG---------------------MLDGEQ-
A0A5C5VEK8      ----QERRDAALAEARQDLTAFREAN----PE---------------------LSVQVD-
A0A532UTJ0      ----RKGLYEKIDNERKTIYQLGQEY-------------------GDIV-------LEG-
A0A432MFP3      ----EKELGDKVEAQQKKLIELFKEA----EDPRRMLGNLAAMDGGVAPAASGEEGQRA-
A0A2E2CCW9      ----EKQIAAELELKKNEYKKFRENA----P---------LYWESTPGS----EAAVAG-
A0A3C0AGX3      ----EKQIAAELELKKNEYKKFRENA----P---------LYWESTPGS----EAAVAG-
A0A518AAQ5      ----NKSLLAELERKKKEYTEFRKDA----P---------LYWESTPGS----EAAVAG-
A0A517QBG9      ----NKSLLAELERKKKEYTEFRKDA----P---------LYWESTPGS----EAAVAG-
A0A518FTU3      ----NKSLLAELERKKKEYTEFRKDS----P---------LYWESTPGS----EAAVAG-
A0A517WHH5      ----NKALLTELEQKKKEYKEFRKDA----P---------LYWESTPGS----EAAVAG-
A0A5A8BGT3      ----NKALLTELEQKKKEYKEFRKDA----P---------LYWESTPGS----EAAVAG-
A0A2E7K7A9      ----NESILSDLEKKKQEYKEFRKDA----P---------LYWENTPGS----EAAVAG-
A0A517PTS5      ----NESILSDLEKKKQEYKEFRKDA----P---------LYWENTPGS----EAAVAG-
A0A6I6AH34      ----NESILSDLEQKKKEYKEFRKDA----P---------LYWENTPGS----EAAVAG-
A0A517VTK3      ----NKQILNDLERKKKEYREFREDA----P---------LYWENTPGS----DAAVAG-
A0A517WQT4      ----NKQILTDLERKKKEYREFREDA----P---------LYWENTPGS----DAAVAG-
A0A517VID8      ----EQQIATELELKRNEYQKFRENA----P---------LYWESTPGS----EAAVAG-
A0A517RK10      ----NQQISTDLEQKKKEYKEFREKA----P---------LYWENTPGS----EAAVAG-
A0A518IH18      ----NQQILSDLEQKKKEYKEFREKA----P---------LYWEHTPGS----EAAVAG-
A0A5C5XLF4      ----NNDLSPRLAAKTKEYHEFRRSA----P---------LVWKAPAGA----DKGPNN-
A0A2D5NDU9      ----RKRYEVEYDTALRALDEYCKKH----P---------A------------MRLDMQ-
A0A1P8WP26      ----FAEVTKELQELQAYRDELTKRS-------------------PDFVG---VGDGES-
A0A3L7V1F3      ----LKDDNERLTLAEAERLRLRNSA-------------------PELVE---TGDKNS-
D5SZ21          ----KVELEQKLATREAELIELRGRS-------------------LTFV----SNGTDN-
A0A286RGB6      ----YSEKEADVRKLENDLKSLSQQL-------------------ETGD----SQALSL-
A0A518CHE5      ----QTKMENQYQENANQLIELQRRS--------------------DLL----LNSGSE-
A0A1V5N3W2      ----RKAIQDKIQRQQETIRKMGEEY-------------------GTIA----LTGRQD-
A0A3E0MY27      ----HQELEADIGRRRKRYNDMVAEV-------------------DVFD----GGQADA-
A0A7C4Z5R7      ----YQTHEAELRIKQEQLRALEKKI-------------------GVVDPQAMVLSQQT-
A0A2E0X9P6      ----RHARSSRLEQLRRRVVELSREV----T---------GTDPFGQGA----VFNLDR-
A0A286RLF2      ----KDDIAARLSEKEQALQQLSQQI-------------------GALD----VGVNSQ-
A0A517NSK8      ----ANDTADEVREAEQNLT-------------------------KHLASSKVMWDGSK-
A0A5C5Z0D6      ----SDKTAQDVKDAEEAFA-------------------------SHVASSTLMWDGQK-
M5UE94          ----SEETAQEVRDAERKLA-------------------------EHLAGSQIMWDGEK-
A0A2E8FLY0      ----KKKLDEETNQINAELLNLKRQM--------------------QII----SGPDNQ-
A0A3D2U1E1      ----REKLDEETNAINAELLVLKRQM--------------------QII----SGPDNQ-
E8R3W3          ----YVKFNESLNTKRKELQKLAEQ----------------------------YGSGDP-
A0A5C5ZM48      ----KEKYFEDIKRLRGNLVTVADQA----T---------KNDPYGGLM------SGGG-
A0A5B9WF77      EEYRKKEIDSKIKMKKDALLKLAKNG----G---------VQFKKDANAKGEPVDTPQA-
A0A518BBX8      ----RDVLRKELRDKEEGYREFRLES---------------------PL----LGRSSE-
A0A1P8WN28      ----GETVLKGLLAKENELLEARQNC-------------------GDIA----LSKESE-
A0A3B9CTT0      ----RRGVETKLIEKNKELLEERRDC-------------------GDIV----INKNST-
A0A518ALT3      ----LKDREGHIEQLRTRVVDLAKDV----T---------GRDPFGQGA----I-VGVT-
A0A3M1QRP3      ----EELLRKQIEIKEEEVDALRKML----------------------------------
A0A517TMV0      ----REKFETELANKQVQLLQIRERI-------------------GHLA----LPDREN-
A0A3E0MY88      ----KIQLKGEIDRKKERLLEAQRRF-------------------GDFT----NGGETD-
A0A5B9QF68      ----GAELEAKLTEKQNELQSFSQAV-------------------GHLA----VSQDDS-
A0A5B9QGF0      ----GAELEAKLTEKQNELQSFSQEV-------------------GHLA----MSQDDS-
A0A5C6CK24      ----GAELEAKLTEKQNELQDFSQQV-------------------GHLA----VGQDDS-
A0A2E3RCU8      ----KDNLARQLSAEEVKLADARLAA-------------------GDFS----IDPESD-
A0A1C3E6N1      ----KVELEQKLATREAELIELRGRS-------------------LTFV----SNGTDN-
A0A518GJT2      ----KVELEQKLTTREAELIELRGRS-------------------LTFV----SNGTDN-
A0A2E8B0L9      ----RVAKEQELQAKQQEMLSLKRAV-------------------GALG----TEGSTT-
A0A5Q4GFE7      ----RLEIEGRLSTKQEEILDVQRRL-------------------RDLG----LSGNQN-
A0A257WS34      ----KRDLESQLTQKEQQLHGLKSQV-------------------GLLL----SGNGTS-
A0A7C4LP10      ----RDEYAQILDEKESRLHQLKSQS-------------------GILL----SGTNEH-
A0A517MLW3      ----REKIEETLHLEQQRLIKLRDEA-------------------HVVG----FDNDSL-
A0A5B9QVD0      ----RTKVEKRLGEQQEKLVELRDET-------------------RVVA----FDDQSL-
A0A3A0DET7      ----KHKRDAELAECRKALDDFRQ---------------------QHME----LAVQLE-
A0A3B8PNV4      ----KKKLDEETNRINSELLDLKRQM--------------------QII----SGPDNQ-
A0A3D1DR40      ----KKKLDEETNRINSELLDLKRQM--------------------QII----SGPDNQ-
A0A2E7RYU8      ----KKKLDEETNRINSELLDLKRQM--------------------QII----SGPDNQ-
A0A3B8LXG8      ----KKKLDEETNRINSELLDLKRQM--------------------QII----SGPDNQ-
A0A286RD13      ----YAQTLELVKKRDQRYRELANAV-------------------GSAD----SEVARK-
A0A2E3GWX1      ----RKKVEQQMTDKQNELLRLRAES-------------------DSL-----LGTGDS-
F0SG60          ----RKKVEQQMTDKQNELLRLRAES-------------------DSL-----LGTGDS-
A0A2E9VST2      ----RDNIQKQIFEKQAELLNLQRDS-------------------DSL-----IGTGDN-
A0A356A6X2      ----RDNIQNQILVKQSELLDLQRES-------------------DSL-----IGTGDN-
A0A5C5XLM3      ----RDNIQNQILVKQSELLDLQRES-------------------DSL-----IGTGDN-
A0A7C5FXU1      ----YSEKEAELRKRRNDLMQLAEQL-------------------Q--------------
A0A3M1VCL4      ----QRQLEEEIRSKESQLAALRSAS-------------------EEIV----TADGRQ-
A0A5C5V7Z9      ----RDQLQEELLQKQRLLQACRERC-------------------GHLA----IDQKDS-
A0A5C5YT05      ----RDQLQSELLRKQKLLQEARERC-------------------GHLA----IDQKDG-
A0A518D7F9      ----HAQLVEELDAKQRELQQVRNEV-------------------GRLV----AAGDSD-
A0A5C5ZIP0      ----RDQIEQDLIVKQQLLQEFRQRI-------------------GHLA----LPKDNE-
A0A518KBK3      ----RDQLEQSLAAKQLELQQSRERV-------------------GHLS----LPDRDD-
A0A5C6AKF9      ----GTKLKQELSAKQLELQQTREQV-------------------GHLS----LPDHEN-
A0A6M5Z0K7      ----ALNYQIEIDKQRSSLK-------------------------SAMT----LNVGAT-
A0A350CI62      ----LEAIEQEVKELQSRRLHLKASA----P---------ELVDTGERN----QNSLNT-
A0A4P5WQK6      ----LEAIEQEVKELQSRRLHLKASA----P---------ELVDTGERN----QNSLNT-
A0A3C1X4W5      ----LEVIEQEVKSLQARRLQLKASA----P---------ELVDTGERN----QNSLNT-
A0A3D3W3A7      ----LEVIEQEVKSLQARRLQLKASA----P---------ELVDTGERN----QNSLNT-
A0A518DRX3      ----RKQVEETLAEKQDQMLDLQHRV-------------------GDLG----MREGST-
A0A518DZF9      ----RKQVEETLAEKQDQMLDLQHRV-------------------GDLG----MREGST-
A0A518AKT8      ----LKQVQTDIQDKQRQLIELRDRV-------------------GHLA----LGDEKE-
A0A5C5ZR72      ----RARRQFEVERLRKHVIDLAKDL----T---------GMDPFGHRT----MTNADR-
A0A7C5R0U3      ----RHDVQSRIEQKQQQLRRVQRAL----S--------------TAGM----LDHPD--
A0A517TY85      ----SADRSMRVELLRKEVIALARKL----T---------GTDPFQPGL----VTDVG--
A0A5B9QEI7      ----RLERGTKVDQLRKRVVELAKDL----T---------GKDPFGQGV----VTDAV--
F0SI78          ----KDDLTESLTKKETAYQQFREDS-------------------ALLW----TSDEGN-
A0A517MDV3      ----RDDLTLEIDQLEQSYREFRRGT-------------------PLLT----LGPDSL-
A0A518IQ30      ----LREKERDLKAKQEEWVQVSRDA-------------------GDLG----LRSGSN-
A0A517LWP4      ----LREKERNLKAKQEEWVTVSRDA-------------------GDLG----LRSGST-
A0A518JNW8      ----LREKERDLKAKQEEWVTVSREA-------------------GDLG----LRSGSS-
A0A2E7ENQ5      ----RSDVASQLDAKEQELLVAQRET-------------------GDLG----LRNGST-
A0A7C2KUQ9      ----KRDLETEIAHHKEMVLKYRTDL-------------------G--------------
A0A7C5BZF0      ----KSQLEERLAEKEAQLLALRQEA-------------------ADLG----YQTEGR-
A0A1G3AQE9      ----KNTLGVELSHKEQERLALRQQC-------------------GVLR----VGPEGE-
A0A3L7UQT9      ----KKETSRKLTEKNQEFLELQSQT-------------------GNIY-----DGEGK-
A0A4P5YBU2      ----KKETSRKLTEKNQEFLELQSQT-------------------GNIY-----DGEGK-
A0A7C7V5U8      ----LDQGRAQMVAVETALRQAREEV-------------------GAFA----EDGQAG-
                                                                            

A0A5S9IJB5      ESRQNIIFQRLND--INEKLTEIELKRISAYTSYRETIDNYNKAK---------------
A0A5S9IPR9      LEKEGRAISRVEA--AKSDLYELERSMYDVKLRYGKCQEVKK------------------
A0A533Q9U4      SEKQNVVLQKLME--LNTAVTYARTERIKLEVLYNKLKDFKSIQYKDD------------
A0A533Q6B7      DPQHNVVFQKLEE--INAAITKAKIERLRLETLYNKLAILKNAQNQAE------------
A0A1U9NNE1      TGRQEMMLEQVMK--LQNELTTLETKRIALEANVQMKVNGDKVLL---------------
A0A2G2JCA2      AGTYSPVSE------LQSRLVSAKVEKLVLEVEHQALKEIHEKET---------------
A0A1G2XVR0      --TAGIIEQKLEG--LKSNLTETKIEKVKLKALSDQIKQYSKDPT---------------
A0A1G3B0P0      --TAGIIEQKLEG--LKSNLTETKIEKVKLKALSDQIKQYSKDPT---------------
A0A1E3X4X0      EQRQNIVLEKLSE--LSTELTRAKTQRIGVETLYNEIQKLSERPE---------------
A0A286U4B3      --SQSIILKELTT--ISDELTRAEAERIGKEIRFLAVQNSDD------------------
A0A5C6DDS2      --SQNIFMKELIT--ISEELTKAEAVRIAKEVRFLAVQNSDD------------------
A0A2E3GW02      ----NLHQARLAQ--IEGQRSELLIKSSQVRAELEAIQNALNRGTSRQALLM--------
A0A5B9QNZ7      ----NKNQIRLAA--LHSELIRLQLRESELESRAIILKNTAGQESLRE---FS-------
A0A1Z8N7H5      ----HPVVQSVIT--LNEAFLDAKKDSLIQQSLVEGIQRAIVRG--------E-------
A0A1G2YPI3      ----NILIEQLQR--WSTLLTEAKLKTIERNSAYESTKEMVSDPVKLQQ-----------
A0A1U7CZ81      ASIEKFSIEQYRN--FKADILKKKLELNELEFALQKRVADSQ---EQDSEVAE-------
A0A142YNY8      RNLGDVSIEQYRK--WKDRLLETQVDLFQAKALLEQRTADYQNGAEIEQLESG-------
A0A1U7GLS6      TTLQDVSMEELRT--IKAQLLDVQIELMTAKSRLQSRTQDYQDLGQIEPTAAE-------
A0A532UIN2      ----NIVITRLER--LSQELTEAQLATIESKSAYESVGEMVSDPVKLKQ-----------
A0A0S8KNX5      ----DMMLQRVGS--LLSTLTEVEAERIKLEAQVQLLELTKTQPIA--------------
A0A3D3UVZ8      ----DMMLQRVAS--LLDTLTSVEAKRIELEAQVLLLERTREQPIS--------------
A0A517NFU9      ----DVHKDRLEN--LEAELNIVTTSLAESRSRLEVIKSYLATRDSSK---IN-------
A0A5C5YWH4      ----DIHKERLAN--LEKELHLVTNSLAESRSRLEVIATYLADRNGQE---IN-------
A0A3D2TNK4      ----DPKIQRVMK--LNEVLLTAQEKRLSLQANLATVETAYNRG--------E-------
A0A7C1Y4F0      ----NIVFEMLRT--LSTELSQAEMAAMTAKTDFDAIMGIEDDPFKIKQFAA--------
A0A6I0ENW6      EDVQTLHNSERLK--LQGELRSLETTIKMYDWERDYLRQIVEGATPEEADAAA-------
A0A6L3A0B7      EDVQTLHNSERLK--LQGELRSLETTIKMYDWERDYLRQIVEGATPEEADAAA-------
A0A0J1B4A0      DSLEDVHRLRLNN--IEQQLGGIRESLSHAKSRRVVIREFVKGKDPDS---LS-------
A0A142WSB9      TPQMSPQAQALDR--VIREQESIQTQRANVQGKIATLKKMIAANESPDEIQFW-------
M5SZR3          ----NPVYSRIAA--IQRQQSELLLRRTELESLIQSLENAIESGLEPK------------
M5TW92          ----NPVYSRIAA--IQRQQSELLLRRTELESLIQSLENAIESGLEPK------------
A0A2S8FKY2      VQHYGLVRNELAQ--VRFELMRAEGELDFLLSSNKAQIESVSRSGGDGGLTTE-------
A0A517N8P6      ----NPYRDDAIR--LEDNLYNLQSQARQLDSKLRLIREAVKGGRHPY----A-------
A0A432MJP4      ----SFITRRVDG--WDSVINQTLVRAVELRTQLELGKS---------------------
M5UQ35          ASLQDVHRIRLAQ--IESELSETRKKLAQVRARRQTIRDFVGGRSRDE---IT-------
A0A0S8FY64      ----SPVLTRRRA--LNDEFTRVQLKRIELGVVVQANLG-------TGEEPQD-------
A0A1N6KFT7      ----TLTMRKLEQ--WSQGINNTTDLMIQLKTQLELIKK--------MESSGS-------
L0DFG4          ----TLMMRKLEQ--WSQGINNTTDLMIQLKTQLELIKK--------MESSGS-------
A0A5C5XXG1      ----NVYQDKYRR--LQDELIDLQIQESTIKTRLARVENELEDLDGKTLSMTE-------
A0A7C7YUM8      ----KAVIDRLSA--LELQRTQLDLARTVLRQALEHLDG--GDFEALARLGKE-------
A0A7C2AHI6      ----QAWIDRVSD--LELRRTQAELARTALGEAIALLRE--GKREAIARLAKE-------
A0A518BJJ1      ----ESLIRNLSD--LEVQRMRLDLQASSLSESLALLRG--GDFDALGRIAQE-------
A0A518D182      ----GRIVEQLSG--FEVERLRLDLARHALEEALELTQA--GDDRGLSQLSSE-------
A0A5C5WTY6      ----NVYEERYRS--LQSELVSADLEVSKLRSRLEQVNSTIEQIAASDRKS-D-------
A0A5C5Y033      ----NVYQDRYRR--LSEELLELDIQQSTMRTRLERVRESLKHIGGGSDLS-D-------
A0A5C6G1Y2      ----NVYQDRYRR--LSEELLELDIQQSTMRTRLDRVRESLKHIGGGSDLS-D-------
A0A354PDV6      ----NVYQDKYRR--VEEELLNVDIEESSLKTRLERVRETLGDMDLDGPLS-E-------
A0A5C6FZ02      ----NVYQDKYRR--LQDELIDLQIQESTIKTRLARVENELEDLDGKTLSMTE-------
M5TIT3          ----NVYQDRYRR--LQEELLDVDIKESTVRTRLQRVADTLNEMDDSGDAF-D-------
A0A5M6CY44      ----NVYQDRFRR--LQDEMLDLDIQESTLRTRLDRVQAVLAELEESNDPV-D-------
F2AXG2          ----NIYQDRYRR--LQDELLDLDIQESTVKTRLARVDETLKEMDGSVDPI-D-------
M2BB46          ----NIYQDRYRR--LQDELLDLDIQESTVKTRLTRVDETLKEMDESVDPI-D-------
L7CLQ6          ----NIYQDRYRR--LQDELLDLDIQESTVKTRLTRVDETLKEMDESVDPI-D-------
A0A0J1B719      ----NIYQDRYRR--LQDELLDLDIQESTVKTRLTRVDQTLKEMDESTDPI-D-------
Q7UF18          ----NIYQDRYRR--LQDELLDLDIQESTVKTRLTRVDETLKEMDESTDPI-D-------
A0A2G1W1E0      ----NIYQDRYRR--LQDELLDLDIQESTVKTRLTRVDETLKEMDESTDPI-D-------
K5E235          ----NIYQDRYRR--LQDELLDLDIQESTVKTRLTRVDETLKEMDESTDPI-D-------
A0A5C6FFI9      ----DVHKTRLEQ--LESELNTVRTSLAEAKSRLKVIEAFTDENETS----VN-------
A0A5C5WDJ1      ----DIHKERLAD--IEKELNDVRSGLAESKSRLEVIESTLERNGGTT----G-------
A0A5C5X547      LSEREILEKQRHE--LRFKRMELEAQLFALLETQKHRQAVGETAPNEDGQPVV-------
A0A353FIP5      ----SVLSDTAQA--IVGRMSEIDLEQAKLVMMAERQNQLAESLRKG--SPVE-------
A0A5B1CIK7      ----NIYQDRFRS--LQEQLLDIDIQESSIKTRLKRVEVTLNEIDETNTSAVD-------
A0A5C5WHS2      ----NIYQDRYRR--LQEQLLDIDIQESTIRTRLERVEETLSEMDEEKSTAAD-------
A0A5C6B6G8      ----NVYQDRYRR--LQEELLDLDIKESTLRTRMERVQATLEDMDTST-DPVD-------
A0A5C5ZZN3      ----NVYQERYRR--LQEELLDIDIQESTVRTRLTRVEDTLKEMDDSG-DAFD-------
A0A5C5XS91      ----NVYQDRYRR--IQEELLDLDIKESTVRTRLQRVDATLKEMDGSD-NPVD-------
A0A5C6C4E6      ----NVYQDRYRR--IQEELLDLDIKESTVRTRLQRVDATLKEMDGSD-DPAD-------
A0A2E1VVJ1      ----PVLPEVAKA--IVEQQSSLTLELARLRLTIRAHELVAERLQDPE-ASLM-------
A0A3M2AEL0      ----VALSEEASL--LVQRLSELDLRDADLDLRIRTVKNLIETVRTSD-SGLE-------
A0A2A2W9R6      GSLEDIHRTRLKS--IEVELATVRAALASARSRRLVIADAVKGKRADE---LT-------
A0A518HKC1      GNLEDIHRTRLKS--IEGELASVRTALASARSRRLVIADAVKGKRPED---LT-------
A0A518L3P0      GNLEDIHRTRLKS--IESELANVRTALASARSRRLVIADAVKGKTPED---LT-------
A0A255R1S0      ----NIQRDRLTA--IEAELNTIRRTIAEIETRRQKISSSVKGQRPEE---LT-------
A0A5B9MKP1      GTLEDVHRARLKS--IEEELASVRRVLAETRSRRSVIAEAVDGKAPEE---IT-------
A0A0S8J591      --IRSVVLTNERW--LQEAAAQANVEMIAAQSLYDAVNKAVEEGT---------------
M5RT57          QAGAGPLER------LRERLTAAEVDRKMLEMEITAIREAMAKED---------------
A0A351FYP6      DSYSIVEPEIVRR--YESELITAKGLYTQQATLLQGLQEQSLEEL---------------
A0A2E7ESJ6      --SINVHAQRQAD--YENERVSLQKQMTELGAQIKSVEEALERDD---------------
A0A2D5AWU0      --GETLIQARLTQ--TRELWTDAHFDMLRERATFELFSRAEADAE---------------
A0A1G2YQB7      ---QQMMMNHISR--MQEKLTELELERIVLQTKIDLHSSKEEKTI---------------
A0A353P687      ---QQMMMNHLAK--LQEKVTELELERIVLQTKIDLHSSQKEKTI---------------
A0A356EME5      --SGANWPHPLAG--LQTRLTEVEVEREVLEAEWKALNEM-PNPL---------------
L0DC26          LDRLGRAEDELSR--IQSELRSLRVE-AEVLEEQATLNETMVTPA---------------
A0A3L7P4E4      --VTSLSESRMAG--IEIERSKVMIAQTEIQSQIDAIQKALERGG---------------
A0A3L7PEB5      --VTSVSESRMAG--IEAERSKVLIAQTEVQSQIDAIKKALDRGG---------------
A0A1U9NL64      --GNNIILDRLAN--LSQAVTDAQLALIEAKSEYDTVKAMVSDPK---------------
A0A2N1UCJ3      --GGNEVFQRLKA--LGDSLTIAQLDTIKAKATLEAVKKF-DSPQ---------------
A0A7C4EK84      --RGNIITQKLAR--LSEALTTAQLQTVEAQAAYDAAQAI-KDPT---------------
A0A7C3F0T2      --DGSFMSKRMES--YSSALIAVQNELLDALADVQATRETVEDPT---------------
A0A2E0X4J3      --SSDIVSDRFSA--LTNELNETEIELLEAKALHNRVQRMYESPT---------------
A0A5C5YU10      --NQDVASDRFSR--LMSELNQTELEQLTAKAEYERVKEMAASPT---------------
A0A517MPZ6      --EENVITKRFAA--LASELDRVELALLDSKARHNRTQQMLESPS---------------
A0A5C6CNV7      --EENVITKRFSS--LAQELDRVELELLDAKARYNRTKSMYETPS---------------
A0A518K5H4      GREGNVVTELFAA--LSRELNATQIELLEAKTRYARAQKMLENPD---------------
A0A5C6AA28      --EGNVVNELFSA--LSQELNATQIQLLESKTRYARAKKMLENPD---------------
A0A2E9VK20      --VTNIHHQRVDA--IATERVKVELLYEEISSRLSTLKSAIERGE---------------
A0A3D4PJK1      --VTNIHHQRVDA--IATERVKVELLYEEISSRLSTLKSAIERGE---------------
A0A532UT69      --RGNVVTERLAR--LSSVLTEAQLATVEARHTYESMKAMVSD-----------------
A0A355AI52      --TMHPLVERAIQ--LNSTLIETQKKRLLLEASYQSLTEAIKAGQ-----NIRQS-----
A0A354PCQ3      --GAIALLTRLRS--QIAELTVELSVRDAQSAMQNNLMQAESDGAGEVLQVAAEALVPDP
A0A0S8GZ23      --LQRVALGDITS--LREQLRNLELVISDTLTQIELLSDPNHPID---------------
A0A1I3DDV4      --SSNVYLDTFRR--LQDELVTVDIERSAVATRLQNVLTSLDQIKQNKGNSLEML-----
A0A2E0SMM6      --TVSLVGQRIIA--LQNSYMEAQNQMIKMQTLIDALTEAIENGS-----NVQQYAE---
A0A3L7SI46      --NSHVIIEQTVK--LNDALIEAQKKTLESRALLISVQHALAEGN-----DIQPY-----
A0A356KTN1      --HEKLLVERIRI--NNNALSDIQRQRIQLNAQLESIQRVLEQGR---------------
A0A5B9PJZ8      --VQNPYQLQQAR--LHEELHQLRRERTRLEARVTSIQQAKAMGK-----NPESL-----
A0A2S8G191      --VQQNALQQFAA--LRSELTRVQLDLLRAKGKLAGIQSSVAANLTEPVVAKKPVVEEEE
A0A2E7EGG1      --DVVISESPLKS--MQENLAKAQIEHKVLAAQVQALEDSVQTGP-----AVPD------
A0A2E2N5A9      --ISTIAATELTL--TSDRLINARRQRAESESQFRQVEAMKASRLDE-------------
A0A7C8AGA2      --RQEMMLQQVTS--LQNELININIRRISLETQIQVQENGIGDVA---------------
A0A7C2FXP7      --RHEMKMERVAR--LLSELTELEAERIHLEAKIPVLEQTQGNYS---------------
A0A2E3GWC6      --VTNIHHQRVDA--IAAERVKVELKYQEITSRIQTLRNAVQRGE---------------
F0SLB0          --VTNIHHQRVDA--IAAERVKVELKYQEITSRIQTLRNAVQRGE---------------
A0A3L7NDH9      --VMHPLVERAIQ--LNAALIEAQKKRLSLQASQASFQTAIQNKQ-----NIRQS-----
A0A1N6DAJ8      --IHQHELDRLGR--AEDELARVQSELRSLRIEHEVSQEKVTQTA-----SMIT------
A0A532UD06      --GGNIVLERLTR--LSNALTETQLAALNAKADFEATKKMANEPA-----KIRQF-----
A0A660URN1      --NGPIVFQRLAK--LSTALTDAQLATINAKADFEAILSMVDEPE-----KIKQF-----
A0A517ZCB5      --MISVLNQRVIK--LNESLVKAQHEAIDARSFLLAIEEAIRQGE-----DIQQF-----
A0A225EH48      --KMKLLTDEVSK--FNSTVSSLSLEIVSHETNLITLQHKQ-------------------
A0A518INW8      --LQSVSHNRLQS--IEQELANVRSQLTYAKSKLETIAEIQAEDVEHQRTDIERL-----
A0A518JPH9      --LHSVSHDRLQT--LEQEIAEVRSQLVYAKSKLESIAEIEASGSDQEQMDIERL-----
A0A5C5VEK8      --NQDVASDRFSR--LMNELNQTELEQLTAKAEYERVKQMAASPS---------------
A0A532UTJ0      --RQEMMRERVIA--LLDRLTAVQLDKISLEAQVQLLERSTERAI---------------
A0A432MFP3      --AFQVDVDEYER--LSQALLELEYEEIEARADLEAVRRQAAATD---------------
A0A2E2CCW9      --STNVHQERVKA--IDNERRLNLLKLTELKSKIDSLKAAIASGE---------------
A0A3C0AGX3      --STNVHQERVKA--IDNERRLNLLKLTELKSKIDSLKAAIASGE---------------
A0A518AAQ5      --STNMHQERVKA--IDNERRQNLLKLTELKSKINTLKAAIASGE---------------
A0A517QBG9      --STNMHQERVKA--IDNERRQNLLKLTELKSKINTLKAAIASGE---------------
A0A518FTU3      --STNMHQERVKA--IDNERRQNLLKLTELKSKINTLKAAIASGE---------------
A0A517WHH5      --STNMHQERVKT--IDNERRQNLLKLTELKSKINTLKSAIASGE---------------
A0A5A8BGT3      --STNMHQERVKT--IDNERRQNLLKLTELKSKINTLKSAIASGE---------------
A0A2E7K7A9      --STNMHQERVKT--IDNERRQNLLKLTELKSKINTLKSAIASGE---------------
A0A517PTS5      --STNMHQERVKT--IDNERRQNLLKLTELKSKINTLKSAIASGE---------------
A0A6I6AH34      --STNMHQERVKT--IDNERRQNLLKLTELKSKINTLKSAIASGE---------------
A0A517VTK3      --STNVHQERVKA--IDNERRLNLLKLTELKSKISSLKAAIASGE---------------
A0A517WQT4      --STNVHQERVKA--IDNERRLNLLKLTELKSKISSLKAAIASGE---------------
A0A517VID8      --STNVHQERVKA--IDNERRLNLLKLTELKSKIDSLKAAIASGE---------------
A0A517RK10      --STNVHQERVKA--IDNERRLNLLKLTELKSKIDSLKAAIASGE---------------
A0A518IH18      --STNVHQERVKA--IDNERRLNLLKLTELKSKIDSLKAAIASGE---------------
A0A5C5XLF4      --VTNIHHQRVDA--IATERVKVELLYEEISSRLSTLKAAIERGE---------------
A0A2D5NDU9      --GARASVEEHGR--VRKLIHDVDQRLLTARTEAATAADFVDNPKLLAQLNLGAT-----
A0A1P8WP26      --VVNLSVANMKH--LLARLSEAQQEAANAQATLETLRQAVANGE-----DVLQY-----
A0A3L7V1F3      --GLSIVSETIRL--LNIDYSAARRISEQSRTQFDGLQRAIASRE-----DILQF-----
D5SZ21          --ATNVAVARVVR--LNEEFMKAKEETLRATAQLAALEQAISRGE-----DVLQF-----
A0A286RGB6      --KQQITLQQFST--YRNELINVQLRMLRLQGELSIKKAIRDKAA-----QIPVT-----
A0A518CHE5      --TVSLVGQRILS--LQTAYTEAQNQMIKLESLIKVLKQAIEKGS-----NAQQYAE---
A0A1V5N3W2      --M------------MLARVSDLRQQLTQIESKKLALQSLVQLSE---------------
A0A3E0MY27      --NRELLMAEQKS--LREEIGLIRIDILRQQLQISQLQRLEANDP---------------
A0A7C4Z5R7      --AQAAVTAAELK--LQEAQVATKRAQLEVSNLRARLTQKPR------------------
A0A2E0X9P6      --ALSPVDTLYQS--LNEIDVNQEVLKAELQALNDAPIVYGDETA-----SSGLF-----
A0A286RLF2      --TVHPLVERAKA--FNQALVEVQKERVQLAASLQALENAVQQGA-----DIRQY-----
A0A517NSK8      --TTNIYKKRLES--IEIDLLELTENEAHIESRLAVISDFVENADPEKVSDFDRL-----
A0A5C5Z0D6      --ARNIHKDRLMK--IEESLLELTEQEAEVESRLAVITDFLQNTDPNSITDFNRL-----
M5UE94          --TRNIHKERLEK--IEDDLHELTEREAESSSRLTVISDFLASKDASEITDVDRF-----
A0A2E8FLY0      --NINPAAERVAA--LNKELIVAQNRTRENRATLEAIENAAAQGQ-----SIEQF-----
A0A3D2U1E1      --NINPAAERLQE--LNKHLIDAMNRTREARATMQAIREAAARGE-----DIHQF-----
E8R3W3          --IILEMRYQFHQ--NKVARLEQLLEEVNQRIRLAEIRRQILLEE---------------
A0A5C5ZM48      --GVSPLVEDSVR-----RLIEIDLARVSLTAERENLKQDTPNHAA----DYAAA-----
A0A5B9WF77      --TSDDLLEQFRS--TNELLMQTDFQLIEAEAKLTARQAQAAG-------DVASQ-----
A0A518BBX8      --GVDTNLESLAS--IQREISQLKLERAEVESDLLTLQRAIQEKE---------------
A0A1P8WN28      --DSHPLVQRVSH--LNENLTTVQSRRLQLEATLVSARELVATNS-----DLTSA-----
A0A3B9CTT0      --QSHPLVERVGQ--INQRFTELRSQRMELEAAMKSARRLVATQA-----DLTPA-----
A0A518ALT3      --AFSPSTSVYQE--LTETEVSLEVAKAELQALKTSDIISADNAI-----ATGHF-----
A0A3M1QRP3      ---------RVHT--ADDLVNTQRLYLDKLESRREDLLLAISNREA----RLKR------
A0A517TMV0      --VVDPIVARAIH--LNESLLEAQRERIEIEASQATIQSAIDNGS-----DLSRH-----
A0A3E0MY88      --HVHPLVERALA--LHTELTVAETERIKHQAALESIRAAIHSGA-----DLNQF-----
A0A5B9QF68      --AVEPTIQRALR--LNDALMDEQQRRLELQATLLSVEGALDRGE-----NIHQY-----
A0A5B9QGF0      --AVEPTIQRALR--LNDALMDVQQRRLELQATLASIDGALERGE-----DINQY-----
A0A5C6CK24      --AVEPIIQRALR--LNDALMDVQQRRLELQATLVSVEGALERGE-----DINQY-----
A0A2E3RCU8      --VIHPVVQTVVT--LNEAFLDAKKDRLVQQSLVEGIQRAIVRGE-----DLKQY-----
A0A1C3E6N1      --ATNVAVARVVR--LNEEFMKAKEETLRATAQLAALEQAISRGE-----DVLQF-----
A0A518GJT2      --ATNVAVARVVR--LNEEFMKAKEETLRATAQLAALEQAISRGE-----DVLQF-----
A0A2E8B0L9      --VVHPMVQRVIT--LNNALVEVQQERMQLEASLGAVRMAVRNGS-----DLRQH-----
A0A5Q4GFE7      --VVHPAVQRVIR--LNETLLKVQQDRLQLEASLWAIRTAIRDGN-----DLRQH-----
A0A257WS34      --ESGTHIAADRARQLNLTLTTAVEQTAEARAFYEAVAYAVRSGG-----DIQQF-----
A0A7C4LP10      --ERESHILAERAKKLNLALTDAVQKTADAKAFYEAVAFAVNSGG-----DIQQF-----
A0A517MLW3      --KSHPALQRVNS--LNESLTQAQKTRIELQAISAVVSDAIREGR-----DPRPH-----
A0A5B9QVD0      --ASHPAVQRVNS--LNASLTDAQKTRIELQAIAGVVEQSIREGR-----DPRPH-----
A0A3A0DET7      --QGNVVTQRFSS--LAEELNSTEIELLQAKALFHRVKSMYDTPK---------------
A0A3B8PNV4      --SINPAAERVAA--LNKELIVAQNRTRESRATLEAIVDAAARGQ-----NIEQF-----
A0A3D1DR40      --SINPAAERVAA--LNKELIVAQNRTRESRATLEAIVDAAARGQ-----NIEQF-----
A0A2E7RYU8      --SINPAAERVAA--LNKELIVAQNRTREARATLEAIVDAAARGQ-----NIEQF-----
A0A3B8LXG8      --SINPAAERVAA--LNKELIVAQNRTREARATLEAIVDAAARGQ-----NIEQF-----
A0A286RD13      --KALTALETLAD--HRKHVNELRQQISGLERRIAILQSRLRYMEE----HRPQT-----
A0A2E3GWX1      --VVSVVNERVVE--LNRSLAAAQKETIESRSFYTAVEQAIRNGE-----NLQQL-----
F0SG60          --VVSVVNERVVE--LNRSLAAAQKETIESRSFYTAVEQAIRNGE-----NLQQL-----
A0A2E9VST2      --VMSVVNERVIE--LNRALAKAQQDSIQAQSHYTAVEQAIRNGE-----SLQQL-----
A0A356A6X2      --VMSVVNERVIE--LNHALAKAQQESIQARSYYTAVEQAVRNGE-----SLQQL-----
A0A5C5XLM3      --VMSVVNERVIE--LNHALAKAQQESIQARSYYTAVEQAVRNGE-----SLQQL-----
A0A7C5FXU1      -------TGDAEA--LNLKERSALQRFSMFRQELGNIQMAILRAQA----EMRIR-----
A0A3M1VCL4      ---ISLIAEQIAR--LNQALLEAKKETINARVFLNAVENALATGQ-----DVFQL-----
A0A5C5V7Z9      --VVDPLIGRAIH--LNDSLMQAQQQRLDLQASLASVSAALARGE-----DMRNY-----
A0A5C5YT05      --VVDPMIGRAIH--LNDALMEAQQRRLDLQGSLASVAMAMARGD-----DMRNY-----
A0A518D7F9      --AVDPMVARALK--LNDALMDAQAKRLEVEASLATVREALASGQ-----DLRRY-----
A0A5C5ZIP0      --VVDPIIGRALQ--LNTALMEAQQERIGMQASLATVRRAMSQGE-----DLRQY-----
A0A518KBK3      --VVDPIISRAIQ--YNDALLEAQRRRLDLQSSLTTIQMAIDRGD-----DLSQH-----
A0A5C6AKF9      --VVDPIVGRAIQ--YNDALMGAQRRRLDLTASLATIQVAIARGE-----DLSQH-----
A0A6M5Z0K7      --SSDPKIVAYLQSNLMEQHSDAKRRERAIESQKQELQLKIDAAR-----ARLER-----
A0A350CI62      --ISKNIEM------LTQEYTNSRRRTEEARTTSQELQRAIASGE-----DILQF-----
A0A4P5WQK6      --ISKNIEM------LTQEYTNSRRRTEEARTTSQELQRAIASGE-----DILQF-----
A0A3C1X4W5      --ISKNIEL------LTQEYINARRRTEEARTTSQELQRAIAGGE-----DILQF-----
A0A3D3W3A7      --ISKNIEL------LTQEYINARRRTEEARTTSQELQRAIAGGE-----DILQF-----
A0A518DRX3      --VVHPAVQRVVE--LNRTLIEAQKNRVHLEALQTAVGDAVREGR-----DLRQH-----
A0A518DZF9      --VVHPAVQRVVE--LNRTLIEAQKNRVHLEALQTAVGDAVREGR-----DLRQH-----
A0A518AKT8      --AIDPIVQRALS--LNESWIEAQQQRVDLEARLAAVNSSIARGD-----DMRQH-----
A0A5C5ZR72      --AFSPLSGYHRQ--LAEIEVKKEVLRAELESIQEAEVVNTDFRE-----RSGAI-----
A0A7C5R0U3      --AMHPLVARVMQ--LNEALMEARSRRVELESQQAALEEAIRQGR-----DLGPL-----
A0A517TY85      --AITAAGSFHQG--IVEAEVGAEIARAELEAIKR-PIASDDQGS-----VSGIL-----
A0A5B9QEI7      --AFSPAGSLYQS--LTETDVEFEVLKAELQAINNSPMLGEDRAV-----ASGLL-----
F0SI78          --NLHQARLAQIEGQRSELLIKSSQVRAELEAIQNALNRGTSRQ----------------
A0A517MDV3      --TKNQIRLAMLH--NELIRLQLRESELQSRASILARTQNDESLQ-----DFSDLERLGL
A0A518IQ30      --VVHPLVQRAVK--MNDILVAAREKRLKLQASEVAVKHAVETGG-----DLRQY-----
A0A517LWP4      --VVHPLVQRAVK--MNDILVAAREKRLKLQASEVAVKHAIQTGG-----DLRQY-----
A0A518JNW8      --VVHPLVQRAVK--MNDILVAAREKRLKLQASEVAVKHAVQTGG-----DLRQY-----
A0A2E7ENQ5      --ITHPLVHNVVR--INEALIDVRKERMRLDASLAAVRRAISQGQ-----DVRQF-----
A0A7C2KUQ9      -----------VT--TADELVTQQRTRTDAEQAQLASLRQEIKLI-----EFQLE-----
A0A7C5BZF0      --MTHPLVQRAID--LNSKLMEARTRRISLEVAAQQLQLAIQTGA-----DLHQH-----
A0A1G3AQE9      --VQHPLVQAAIA--LSEQLIESQSRRAKLEASLAAIEAAVHDGE-----DLEKC-----
A0A3L7UQT9      --STNLLSLRVVE--LNKLLIEAQRVTLDAWSFLQTVEQAARTGQ-----DLQQL-----
A0A4P5YBU2      --STNLLSLRVVE--LNKLLIEAQRVTLDAWSFLQTVEQAARTGQ-----DLQQL-----
A0A7C7V5U8      --VTHPVLKTAME--FTQELITLQKRRGDLEATLIEVRQAVGRGE-----NPLQY-----
                                                                            

A0A5S9IJB5      ----------IISTPEILKSRTIQELKV--------------------------------
A0A5S9IPR9      ----------KKSLEAILSSDLFVQNAMIDDLQK--------------------------
A0A533Q9U4      ----------IIQSIPAVVQSPLIQNL---------------------------------
A0A533Q6B7      ----------IIQSIAPVVQNDLIQNL---------------------------------
A0A1U9NNE1      ----------APTDRMKLKYEFINADLTIKAL----------------------------
A0A2G2JCA2      ----------FIVPETGLNQAVEQHPDVLTLRARIATN----------------------
A0A1G2XVR0      ----------LTKLIPEIVKDGSINTL---------------------------------
A0A1G3B0P0      ----------LTKLIPEIVKDGSINNL---------------------------------
A0A1E3X4X0      ----------MIEAITPVIENRLIQDL---------------------------------
A0A286U4B3      -----------LSSLPGIADNKLINEL---------------------------------
A0A5C6DDS2      -----------LSSLPGITDNVLINEL---------------------------------
A0A2E3GW02      -----------------------------------------MADQARQRAGQSSAEGVQN
A0A5B9QNZ7      ----------DLERLGLIDARDVERLALLVTVERGD-----ATTDESFVAQQPQRTTTAT
A0A1Z8N7H5      ----------DLKQYAMAVEETIGKELLIKGLGF-------NTENIQVRNQLEQGLLADI
A0A1G2YPI3      -----------------------------------------FIEAQRARGMYIPQDSEKA
A0A1U7CZ81      ----------TTGFQKSQLEARINETFRRDPSVASLIQQILETDEELAHTVGVARKGYDP
A0A142YNY8      ----------LRP-SEEELTERIQAAFLADPAIADLRDEILTVRDRLSHVVSNARKGNDP
A0A1U7GLS6      ----------TATLPEEEVARRIEAEFRSDPMIADLYGQKQEVERRRDHVQKGARKVADP
A0A532UIN2      -----------------------------------------FIEAQRARGIYVSTDSAKA
A0A0S8KNX5      -----------------------------------------PGELLSMRQSYINEDPAVV
A0A3D3UVZ8      -----------------------------------------PEELLKMRQDYINQDPAVV
A0A517NFU9      ----------SMDHLALLSQKEVERLKLFLDVTRG------ETQSEAFQAEQPIRQEVAK
A0A5C5YWH4      ----------NIDHLALLSHNEVERLKLFLDMTRG------ETQSEAFQAEQPIRQEVAK
A0A3D2TNK4      ----------DLNQHLMHLEAPLGQQVLLSSVGVS-----------------PQDMQVLG
A0A7C1Y4F0      -----------------------------------------ASTGSGVRMPVADREMQLR
A0A6I0ENW6      ----------DGTSASASASVGVEEGGE-AGVRGDERPRRLFWSDREWSRLYQDRESKRA
A0A6L3A0B7      ----------DGTSASASASVGVEEGGE-AGVRGDERPRRLFWSDREWSRLYQDRESKRA
A0A0J1B4A0      ----------DVHVMSLLDADEIDRVNAFLAISANR-----DDQTNDEMLSRAVMQESTR
A0A142WSB9      ----------VMHALSAGTGGGAEGGGGGGGGGGG------VLQGPSGKAELDGRLLAAR
M5SZR3          -------------HLAMLISNAGVQLAAMDDDAEPMGLDRLRMDQKFHSLELEDERDLAE
M5TW92          -------------HLAMLISNAGVQLAAMDDDAEPMGLDRLRMDQKFHSLELEDERDLAE
A0A2S8FKY2      ----------NAPGVGDDATPRVPVSDADDSVDEVAENGDGDSNDGEVADLKLSDVEMDE
A0A517N8P6      ----------VFQEVQYLLDD--------------------VRDIEQMHQAIVEAPNDNL
A0A432MJP4      -----------------LREKGVGLAGIAYALGQF------RGDPGESLAISSSAGRSQA
M5UQ35          ----------DAEVLAILTEEELSRLKTLVTLN--------RGDQDDLESVMLSRYLSQQ
A0A0S8FY64      ----------LEELLSISIVRS--------------------------------------
A0A1N6KFT7      ----------QGNAISLALSQFPTMTPGGSNGQIP------QSSGTA------GSYEQLQ
L0DFG4          ----------QGNAIALALNQFPTVSSNGAGHLTQ------GMTGAAIGTSGTGSYEQLQ
A0A5C5XXG1      ----------SMDKLALIDSESLERLGLFAGLQIS------ASNTAEFKATMPVRAEEAR
A0A7C7YUM8      ----------TPNLLVLGYIKELATLEA-ESLRLE------RTDVLGYKQLLQAEELRLR
A0A7C2AHI6      ----------VPDLESLVLIQEVGRLSA-EALLLD------RRDSGEFRLMLEQELNRER
A0A518BJJ1      ----------LDDPLAKSLLEQLSVLHM-RLLLKG------RSDGDPYALLLAQRSELLE
A0A518D182      ----------LADPLSKGLVERLETLGL-ERFAAA------RADGGPYRTLLQQRAVELD
A0A5C5WTY6      ----------HIDKLALIDVESLQRMGVFTDMQRD------AASSTEARAELPGEVERAR
A0A5C5Y033      ----------HLDKLALIDSDSLERLGAFAGLQVS------ASNSAEFKAAMPAKMEEAR
A0A5C6G1Y2      ----------HLDKLALIDSDSLERLGAFAGLQVS------ASNSAEFKAAMPAKMEEAR
A0A354PDV6      ----------HLDKLALIDSESMQRLGLYASLQVN------AASTADFQATQPARIAEAQ
A0A5C6FZ02      ----------SMDKLALIDSESLERLGLFAGLQIS------ASNTAEFKATMPVRAEEAR
M5TIT3          ----------HLDKLALIDSESLERLGVFAGLQMN------AADSPEFKAAMPAKAEEAR
A0A5M6CY44      ----------NLDKLSLIDSESLERLGLFTGLQMN------SSNTAEFKAAMPAKIEEAR
F2AXG2          ----------QLDKLALIDSESLERLGVFAGLQMN------SANTAEFKAAMPAKAEEAR
M2BB46          ----------QLDKLALIDSESLERLGVFAGLQMN------SANTAEFKAAMPAKMEEAR
L7CLQ6          ----------QLDKLALIDSESLERLGVFAGLQMN------SANTAEFKAAMPAKAEEAR
A0A0J1B719      ----------QLDKLALIDSDSLERLGVFAGLQMN------SANTAEFKAAMPAKAEEAR
Q7UF18          ----------QLDKLALIDSESLERLGVFAGLQMN------SANTAEFKAAMPAKMEEAR
A0A2G1W1E0      ----------QLDKLALIDSDSLERLGVFAGLQMN------SANTAEFKAAMPAKMEEAR
K5E235          ----------QLDKLALIDSDSLERLGVFAGLQMN------SANTAEFKAAMPAKMEEAR
A0A5C6FFI9      ----------DFDKLALLSQKDVTRLKLFLDMTRG------ESQSETFQAEQPARAEAAR
A0A5C5WDJ1      ----------DMGHLALLSQKEVERLKFFLDMARG------GAQSEAFQAAQPMRAEVAK
A0A5C5X547      ----------SEEPVDPSLRAPLPPLPVGQSTNQWVLTEEILEEEYAFDPEIRRLNDEKE
A0A353FIP5      ----------EVGAAVELDPQ-------------------------------------TS
A0A5B1CIK7      ----------QLDKLALIDSESLERLGVFAGLQMS------ASNTAEFKSAMPAKMEGAR
A0A5C5WHS2      ----------QLDKLALIDSESLERLGVFAGLQMN------SANTAEFRAAMPAQTEKAR
A0A5C6B6G8      ----------HLDKLALIDSESLERLGLFAGLQMN------SSNTAEFKAAMPAKMEEAR
A0A5C5ZZN3      ----------HLDKLALIDSESLERLGVFAGLQSN------AADTAEFKAAMPAKMEEAR
A0A5C5XS91      ----------HLDKLALIDSESLERLGVFAGLQMN------ASNTAEFKAAMPAKVEEAH
A0A5C6C4E6      ----------HLDKLALIDSESLERLGVFAGLQMN------ASNTAEFKASMPAKAEEAH
A0A2E1VVJ1      ----------SLAGAIELDPL-------------------------------------LQ
A0A3M2AEL0      ----------RLVSVPDLDPV-------------------------------------TR
A0A2A2W9R6      ----------DAGVMALLTEEDIARLETLVSIAKER-----KGGDSGMDIARIVANTSST
A0A518HKC1      ----------DAEVMTLLTEDDMARLQTLVSIAKER-----KAKDDGLDIARIVANTSST
A0A518L3P0      ----------DAAVMTLLTEEDIARLQTLISIAKER-----KAGDDSLDIARIVANTSST
A0A255R1S0      ----------DAQLATLLSKEDISRLQMFMDFAEGRSKVEEKALTEEERMALALERQAQQ
A0A5B9MKP1      ----------DADVMTLLSDTEVTRLQALISIKKQR-----QPGSAGESESQAIARSSRQ
A0A0S8J591      ---------------------------YENTRDTDLLQ----------------------
M5RT57          -------------------LRIAEVDVEMAVGESQEVL----------------------
A0A351FYP6      ----------RESIMTANPDAQLDALIREYQTGQTTLA----------------------
A0A2E7ESJ6      ------------NLESILLLAEKDGHQGLKEKFSSRLA----------------------
A0A2D5AWU0      ----------KFLDLGRNRRSTKQNPNLEPELQEIEKD--------------------L-
A0A1G2YQB7      ----------TPEMMAKLRHDFINSDL----------M--------------------VQ
A0A353P687      ----------TPEVMAKLRHDFINSDL----------M--------------------VQ
A0A356EME5      ----------AQQVDEALAGNVTSAVETNPQVQALVQQ--------------------IW
L0DC26          ----------MIEDAISRDRSIELYKEKEGLAQRAIDR--------------------VY
A0A3L7P4E4      ----------SREAITLMLESFNDKKKSGDGLETSLTP--------------------TQ
A0A3L7PEB5      ----------SREAITLMLESFNDKNNSGEAVEKALTP--------------------MQ
A0A1U9NL64      ----------KVKQFVEAKRVSGLYVSSGTENTRLKAE--------------------LD
A0A2N1UCJ3      ----------KVRQYAMAQPGISSNLFARDMETKLRDE--------------------LQ
A0A7C4EK84      ----------QLRQLVQMQQSRQTGVGPERGGGALAVE--------------------LG
A0A7C3F0T2      ----------RFRRFVELRRLGGREGLAAPEEGVLRAD--------------------VA
A0A2E0X4J3      ----------LRPLLADMAMDGKPVDT---LEERSVLA--------------------LQ
A0A5C5YU10      ----------LRPMLLDMALDSVGKAN-------LNDD--------------------LE
A0A517MPZ6      ----------LRPFLLELASGQQSVAQDISLENRLQVD--------------------LE
A0A5C6CNV7      ----------QRPFLLELASSQQQVANEIRSESQLSLD--------------------LE
A0A518K5H4      ----------QIPFLMELARTAQAGSR--------SGD--------------------LD
A0A5C6AA28      ----------QAPFLMELARSAHSNSR--------GSD--------------------LE
A0A2E9VK20      ----------SHEALMLLVKTFLQKDQTSNSQTVVSGA------------------TERQ
A0A3D4PJK1      ----------SHEALMLLVKTFLQKDQTSNSQTVVSGA------------------TERQ
A0A532UT69      ----------PAKLSQFIEAQRATGPYGTNGEKA--------------------------
A0A355AI52      ----------LIAIEETLGKEAFLDSMGLGDRDKQTRI----------------------
A0A354PCQ3      VFQPRRKHPSESEIEQLVDRDPKVAEAKTRISRYKSIM-------------INMEDSDLV
A0A0S8GZ23      -----------------IPPDMLKNRSDSINNDPYVRE----------------------
A0A1I3DDV4      ----------ALIDSESLTRLGTFGSFSSAQTQDFQEN-------------QATRLKEAE
A0A2E0SMM6      ----------EILGAGPVGNELLGQELGLQDRVVVS------------------------
A0A3L7SI46      ----------LQQAAGDISREFLLQELGVGANDAYTVA----------------------
A0A356KTN1      ----------PLESASPIATNHIVL-----------------------------------
A0A5B9PJZ8      ----------------VIGVLQEFSETNMGAYTSTHNK----------------------
A0A2S8G191      NAPDAKQDVPLEEDSDVELQNILASDEVIAALKSQIMQ----------------------
A0A2E7EGG1      ----------VLIEREIAGREEVQRVLVALNQKKALRD----------------------
A0A2E2N5A9      ----------LASVPAVLSDPVIQQFKATKAQAAARVD----------------------
A0A7C8AGA2      ------------------TPGSLIERQNAVINSDPIIQ----------------------
A0A7C2FXP7      -----------------ITSDELMQIRQQYINSDPMIR----------------------
A0A2E3GWC6      ----------SSEALLLLVRTFLQRDQQSNTQTVMTGT------------------SERQ
F0SLB0          ----------SSEALLLLVRTFLQRDQQSNTQTVMTGT------------------SERQ
A0A3L7NDH9      ----------LMAIEESLGKEAFLDSVGLSSRDKDTRT----------------------
A0A1N6DAJ8      ----------PVMIEDAISRDRSIELLKARESAAIKAI----------------------
A0A532UD06      --------------------AGAAAGAGAQVSGSDRET----------------------
A0A660URN1      --------------------AMAQPNAGVRVFVNDVQS----------------------
A0A517ZCB5      ----------ASRMSEGLATELLKRHAGIASGDVYTQS----------------------
A0A225EH48      ----------SVIDMQEVSLDELEKAVAKNEKVAPKVE----------------------
A0A518INW8      ----------ALLNPRDTERLRFFMDVASGDPSGSGAL-----------------RDDPQ
A0A518JPH9      ----------ALLNARDADRLKFFMDIANGDVGSTGAS-----------------REDPL
A0A5C5VEK8      --------------LRPMLLDTALDAFGSKSDLDRDLE----------------------
A0A532UTJ0      -----------------APEELLRMRQEYINQDPTVVA----------------------
A0A432MFP3      ----------PRVWVDRRIEQVFLSDERVNALRGAIRD----------------------
A0A2E2CCW9      ----------SKETLELLAQQYLMGQTR-GQAANGNAS---E-GHHLATPGTSQLDRART
A0A3C0AGX3      ----------SKETLELLAQQYLMGQTR-GQAANGNAS---E-GHHLATPGTSQLDRART
A0A518AAQ5      ----------SKETLELLAQQFLMGQAR-GQAGAAAGG---V-ETQALAPGNTQVERARA
A0A517QBG9      ----------SKETLELLAQQFLMGQAR-GQAGAAAGG---V-ETQALAPGNTQVERARA
A0A518FTU3      ----------SKETLELLAQQFLMGQAR-GQTGTAAGG---V-ETQALAPGNTQVERARA
A0A517WHH5      ----------SKETLELLAQQFLMGQAR-GQAGAVTGG---V-ESQAIAPGNTQVERARL
A0A5A8BGT3      ----------SKETLELLAQQFLMGQAR-GQAGAATGG---V-ESQAIAPGNTQVERARL
A0A2E7K7A9      ----------SKETLELLAQQFLMGQAR-GQSGATTGG---V-ESQAITPGNTQVERARL
A0A517PTS5      ----------SKETLELLAQQFLMGQAR-GQSGATTGG---V-ESQAITPGNTQVERARL
A0A6I6AH34      ----------SKETLELLAQQFLMGQAR-GQSGATTGG---V-ENQAITPGNTQVERARL
A0A517VTK3      ----------SKETLELLAQQFLMGQTRGGQPGSTSSA-----GASISAPGTSNLDRART
A0A517WQT4      ----------SKETLELLAQQFLMGQTRGGQPGSTSSA-----GASISAPGTSNLERART
A0A517VID8      ----------SKETLELLAQQFLMGQTR-GQAANKNTS-----EGRIATPATSQLDRART
A0A517RK10      ----------SKETLELLAQQFLMGQTR-GQAGNANAN-----QGQIATPNTTQVDRARA
A0A518IH18      ----------SKETLELLAQQFLMGQTR-GQAGSANGN---TSQGQIATPNTTQVDRART
A0A5C5XLF4      ----------SHEALMLLVKTFLQKDQTSNSQTVVSGA----------------------
A0A2D5NDU9      ----------------ETGKPLISPPEELSTP----------------------------
A0A1P8WP26      ----------ASEL----GEQVLAEVMGVSGQSVFQTT----------------------
A0A3L7V1F3      ----------ANKTLDTAGRQLIEQSMGLGSQDAFLIQ----------------------
D5SZ21          ----------AMASLDVVGKQFMMGELGLDSQEGMAIS----------------------
A0A286RGB6      ----------DREIEAAARTDPVILQLQLRESELKNLV----------------------
A0A518CHE5      ----------EILGPGPVGNELLSQEMGLQDRLIVS------------------------
A0A1V5N3W2      ----------QTKDKTIVPEKLLERRYDFINSDPTLQM----------------------
A0A3E0MY27      ---------------EQVRQRLISNTLAADQQYGQLRG----------------------
A0A7C4Z5R7      ----------VKVSEEAINEALAKDAVAE-------------------------------
A0A2E0X9P6      ----------ALEISNREDIRELESRLAAQRDRLTRIR----------------------
A0A286RLF2      ----------LFAADDTLGQQILLGVLGFSREETAARL----------------------
A0A517NSK8      ----------ALLSEKEVNRLKVLFDVTRGDTMSEAFV-----------------QDNPI
A0A5C5Z0D6      ----------ALLSEKEVNRLKLLYEITRGDVASEAFQ-----------------AEQPI
M5UE94          ----------SLLSEKEVNRLKLMIEMTRGDVASEAFQ-----------------ADQPI
A0A2E8FLY0      ----------AMQQIEVVGKEFLLRRMGLDSQDSWMVM----------------------
A0A3D2U1E1      ----------ALQQIEVVGKEVFLRQMGLNPQDSYLDG----------------------
E8R3W3          ----------QRTNRTGTGLTPRRDAEGKSDSNAASRSPAATSPGRLDSREIDDLVEEYL
A0A5C5ZM48      ----------EAAVVELIGRDEQLRAW---------------------------------
A0A5B9WF77      ----------SQAPDSNVPNEQIREEFTRDPEVIELVD----------------------
A0A518BBX8      ----------PFDALLVMATEIAQKSKQTDTKDDSRLN----------------------
A0A1P8WN28      ----------LKKLEEIVGEDVLERIPGAGATDPKAIE----------------------
A0A3B9CTT0      ----------VQALQRIVGPEVMQQVPGRPGLDVKAIE----------------------
A0A518ALT3      ----------ELEISNRADVRRLEDQI----------R----------------------
A0A3M1QRP3      ----------LELLAASGDGAASAPAPDRRFSEDSVWR----------------------
A0A517TMV0      ----------LALVEESLGEQAVLAAMGMGPNDLEVLA----------------------
A0A3E0MY88      ----------LMSAEQSVGRSVLMTALGINDRDVVGHT----------------------
A0A5B9QF68      ----------LVAMEESVGRQMMLSSLGLSSEDLNVIE----------------------
A0A5B9QGF0      ----------LVAMEESVGRQLMLSSLGLSSEDLSVIE----------------------
A0A5C6CK24      ----------LVAMEESVGRQMMLSSLGLSSEDLSVIE----------------------
A0A2E3RCU8      ----------AMAIEETLGRELLAKGLGFSTDTIHTRS----------------------
A0A1C3E6N1      ----------AMASLDVVGKQFMMGELGLDSQEGMAIS----------------------
A0A518GJT2      ----------AMASLDVVGKQFMMGELGLDTQEDMAIS----------------------
A0A2E8B0L9      ----------MIDLEPLVGRQLVMSGLGLSPEATDLVN----------------------
A0A5Q4GFE7      ----------LTAIEPLIGRELTMSVMGLNSKDMETRA----------------------
A0A257WS34      ----------ITQVADVVGSQVLLRELGMGSQDGFILA----------------------
A0A7C4LP10      ----------VMQLADVVGREVLLKELGLGTQDSYTLA----------------------
A0A517MLW3      ----------MHAVDPDAARSLTAAVLGVAPEQMRSIH----------------------
A0A5B9QVD0      ----------MHAVDPEAARSLTAAVLGVAPEQMRSVH----------------------
A0A3A0DET7      -------------------QRPFLLDMAGDDQQALRDI----------------------
A0A3B8PNV4      ----------AMQHLEVVGKEFLLRRMGLDSQDTWMVM----------------------
A0A3D1DR40      ----------AMQHLEVVGKEFLLRRMGLDSQDTWMVM----------------------
A0A2E7RYU8      ----------AMQHLEVVGKEFLLRRMGLDSQDSWMVM----------------------
A0A3B8LXG8      ----------AMQHLEVVGKEFLLRRMGLDSQDSWMVM----------------------
A0A286RD13      ----------SEEERRQRDEAVIQQIVENALRADPWIA----------------------
A0A2E3GWX1      ----------MAQTNSSVASELMKIGIGVDSRDQYVYA----------------------
F0SG60          ----------MAQTNSSVASELMKIGIGVDSRDQYVYA----------------------
A0A2E9VST2      ----------MNQSNQTLANELMKLSAGVDSRDSYAYA----------------------
A0A356A6X2      ----------MNQSNQTLANELMKLSAGVDSRDSYAYA----------------------
A0A5C5XLM3      ----------MNQSNQTLANELMKLSAGVDSRDSYAYA----------------------
A0A7C5FXU1      ----------EAWANESL-------KIPISEEDLEMFA----------------------
A0A3M1VCL4      ----------MQGELEPVGRQMLESELGFSQQDALVLS----------------------
A0A5C5V7Z9      ----------LSVVEEAVGEQMMLASLGLSHQDLEMLS----------------------
A0A5C5YT05      ----------LSVVEEAVGEQMMLAALGLSHQDMEMLT----------------------
A0A518D7F9      ----------VALVEEAVGQQMLMSAMGVAPDDLALIA----------------------
A0A5C5ZIP0      ----------LSLVQEAVGEQMLLSALGMGENDVRAMA----------------------
A0A518KBK3      ----------LGLVEQSIGEAAMLAAMGMGPNDMEVLA----------------------
A0A5C6AKF9      ----------MGLVEESIGQAAMLAAMGMAPNDIEVLA----------------------
A0A6M5Z0K7      ----------PAPKEAGAPNDRVDPLLERELDLDPRIA----------------------
A0A350CI62      ----------AMETLDSAGRQLVEQSMGLGTQDSYHVQ----------------------
A0A4P5WQK6      ----------AMETLDSAGRQLVEQSMGLGTQDSYHVQ----------------------
A0A3C1X4W5      ----------AMEALDSAGRQLVEQSMGLGTQDSYHVQ----------------------
A0A3D3W3A7      ----------AMEALDSAGRQLVEQSMGLGTQDSYHVQ----------------------
A0A518DRX3      ----------LLTFSPEIGRELLVSSMGLGPEFATNLR----------------------
A0A518DZF9      ----------LLTFSPEIGRELLVSSMGLGPEFATNLR----------------------
A0A518AKT8      ----------LMSLEETLGQQVLISSLGMSSDDLSSIR----------------------
A0A5C5ZR72      ----------DLEVDMNGEVQQR----------ERQIS----------------------
A0A7C5R0U3      ----------LLKIEPLVGRELMLVALGLDAESTESSR----------------------
A0A517TY85      ----------TLEVANRPDVRRL----------EEEIE----------------------
A0A5B9QEI7      ----------ELEISNRADVRRL----------EERGD----------------------
F0SI78          ----------ALLMMADQARQRAGQSSAEGVQNASITS----------------------
A0A517MDV3      IDNRDVERLALLVNVERGDANSDESFVAQQPMRTTAAN----------------------
A0A518IQ30      ----------LVELEPTIGRELMLNELGMSPRFAEVAD----------------------
A0A517LWP4      ----------LVELEPTIGRELMLNGLGMSPRFAQVAD----------------------
A0A518JNW8      ----------LVELEPTIGRELMLNGLGMSPRFAQVAD----------------------
A0A2E7ENQ5      ----------MLSMEDAGGREMALGMLGMSTKDEDFAK----------------------
A0A7C2KUQ9      ----------MARPVQEKGAPGDHAPVQPEYALDPGWQ----------------------
A0A7C5BZF0      ----------LLGISELVGQDLIRQRLGLNAPDTYLQA----------------------
A0A1G3AQE9      ----------ILLAAEVVGWEVLRNHLGSSADDGLQAA----------------------
A0A3L7UQT9      ----------MFQAVETLGASILSKQMGLGEQDAWAVA----------------------
A0A4P5YBU2      ----------MFQAVETLGASILSKQMGLGEQDAWAVA----------------------
A0A7C7V5U8      ----------LFDVQEVVGKEMMLAGLGLSELDASRQA----------------------
                                                                            

A0A5S9IJB5      -------------------------------------------------QSLVVDQEIQ-
A0A5S9IPR9      -------------------------------------------------KKFLYENQLR-
A0A533Q9U4      -------------------------------------------------KADYARVEND-
A0A533Q6B7      -------------------------------------------------KGESIRIQNE-
A0A1U9NNE1      -------------------------------------------------TEDMAKLERD-
A0A2G2JCA2      -------------------------------------------------GSTALEYEKT-
A0A1G2XVR0      -------------------------------------------------KAKYADLQAN-
A0A1G3B0P0      -------------------------------------------------KAKYADLQAN-
A0A1E3X4X0      -------------------------------------------------KADYARLEAQ-
A0A286U4B3      -------------------------------------------------KLEYTRLNAK-
A0A5C6DDS2      -------------------------------------------------KLEYTKLQAK-
A0A2E3GW02      AS----------------------------------------------ITSQLIPLMLE-
A0A5B9QNZ7      TE-----------------------------------------------MDSLLTLKVR-
A0A1Z8N7H5      SS----------------------------------------------------------
A0A1G2YPI3      KI-----------------------------------------------KSRLDELQDR-
A0A1U7CZ81      AR-----------------------------------------------QAAEKRKAQL-
A0A142YNY8      SK-----------------------------------------------RAHEARLKQL-
A0A1U7GLS6      SR-----------------------------------------------VAHDARLAEL-
A0A532UIN2      SL-----------------------------------------------RSKLDQLELR-
A0A0S8KNX5      AF-----------------------------------------------TANITELEQE-
A0A3D3UVZ8      AF-----------------------------------------------TGNITQLEQD-
A0A517NFU9      AQ-----------------------------------------------YNRMLDLIQK-
A0A5C5YWH4      AQ-----------------------------------------------YNRLLDLIQK-
A0A3D2TNK4      DQ-----------------------------------------------QKKLFTAQQE-
A0A7C1Y4F0      SE--------------------------------------------------LRQAETE-
A0A6I0ENW6      AL----------------------------------------------------------
A0A6L3A0B7      AL----------------------------------------------------------
A0A0J1B4A0      TE-----------------------------------------------YQQLLTLSSK-
A0A142WSB9      LV----------------------------------------------------------
M5SZR3          GL-----------------------------------------------EAMLLPLKQQ-
M5TW92          GL-----------------------------------------------EAMLLPLKQQ-
A0A2S8FKY2      AI--------------------------------------ANDPVSVKLQAELDRFEDV-
A0A517N8P6      EL-----------------------------------------------QTQLMDLRVQ-
A0A432MJP4      LA-----------------------------------------------SDYVRQLINE-
M5UQ35          SAKLE--------------------------------------------YDKMLELSSK-
A0A0S8FY64      ------------------------------------------DPAVAELYGRLTQIDLD-
A0A1N6KFT7      KELAEVKLKRSITQRMVDNLKAGRPNSEATVSEDDVAGSFKLDPNVAELYRDLKRAQLR-
L0DFG4          KELADVKLKRAMTQRLVENLKGARPNAEGKVTEDHVAGSFKLDPYVAELYRDLKRAQVR-
A0A5C5XXG1      TR-----------------------------------------------FAYLLKLNSE-
A0A7C7YUM8      VAIEESHLTIQAFELALAAIEAGDESAVARLASAQGPGGGSE---FESYLISLAELDAR-
A0A7C2AHI6      HGADETRLVASSVRAAREGLLRGDAGALARLADPKLV--------SDAQRAALAELDAE-
A0A518BJJ1      ERAGELAMQIVAVRETIQAIDDGVPGAYGFLSANSNAPGITVDPLTTGYLSEIARLEGE-
A0A518D182      ERADEARVELAALRAVLTAAEADEQGAFAGLSSSPSS-GATVDPLTLGYLAELGRLQSQ-
A0A5C5WTY6      IE-----------------------------------------------ISQVLELSSE-
A0A5C5Y033      AQ-----------------------------------------------VTRLLMLNAE-
A0A5C6G1Y2      AQ-----------------------------------------------VTRLLMLNAE-
A0A354PDV6      TQ-----------------------------------------------YNNVLQLMSE-
A0A5C6FZ02      TR-----------------------------------------------FAYLLKLNSE-
M5TIT3          TQ-----------------------------------------------ITHLLQLSSE-
A0A5M6CY44      TQ-----------------------------------------------FTHLLQLNSE-
F2AXG2          TQ-----------------------------------------------ITHLLRLTSE-
M2BB46          TQ-----------------------------------------------ITHLLRLNSE-
L7CLQ6          TQ-----------------------------------------------ITHLLRLNSE-
A0A0J1B719      TQ-----------------------------------------------ITHLLKLNSE-
Q7UF18          TQ-----------------------------------------------ITHLLRLNSE-
A0A2G1W1E0      TQ-----------------------------------------------ITHLLQLNSE-
K5E235          TQ-----------------------------------------------ITHLLQLNSE-
A0A5C6FFI9      AQ-----------------------------------------------YSRLLDLLQK-
A0A5C5WDJ1      AQ-----------------------------------------------YNRLLDLIQK-
A0A5C5X547      AL-----------------------------------------------EEKFQALAKRL
A0A353FIP5      SM-----------------------------------------------LQELAGLIAQ-
A0A5B1CIK7      AE-----------------------------------------------ITHLLQLNSE-
A0A5C5WHS2      AE-----------------------------------------------ITHLLQLNSE-
A0A5C6B6G8      TQ-----------------------------------------------ITGLLRLNSE-
A0A5C5ZZN3      TQ-----------------------------------------------ITHLLQLNSE-
A0A5C5XS91      TQ-----------------------------------------------ITHLLELNSE-
A0A5C6C4E6      TQ-----------------------------------------------ITHLLELNSE-
A0A2E1VVJ1      SL-----------------------------------------------FQALQKVDAD-
A0A3M2AEL0      TM-----------------------------------------------LQELGDLKAK-
A0A2A2W9R6      SK-----------------------------------------------VNRLMELLSQ-
A0A518HKC1      SK-----------------------------------------------VNRLMGLLSQ-
A0A518L3P0      SK-----------------------------------------------VNRLMGLLSQ-
A0A255R1S0      EE-----------------------------------------------FRRLMALTTR-
A0A5B9MKP1      SA-----------------------------------------------AQRLLELTSK-
A0A0S8J591      RL-----------------------------------------------RERLYAYQEI-
M5RT57          DL-----------------------------------------------RALIADRKSM-
A0A351FYP6      ------------------------------------------------------------
A0A2E7ESJ6      LM-----------------------------------------------QDRYMALVLQ-
A0A2D5AWU0      -------------------------------------------------------LEKE-
A0A1G2YQB7      TT-----------------------------------------------ASNVANLEQV-
A0A353P687      TT-----------------------------------------------TSNVANLEQV-
A0A356EME5      ----------------------------------------------------MAETTLR-
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      KF-----------------------------------------------TREIFQLELE-
A0A3L7PEB5      KF-----------------------------------------------TREIFQLELE-
A0A1U9NL64      ------------------------------------------------------RLELR-
A0A2N1UCJ3      ------------------------------------------------------SLETE-
A0A7C4EK84      ------------------------------------------------------RLELQ-
A0A7C3F0T2      ------------------------------------------------------RLELQ-
A0A2E0X4J3      --------------------------------------------------EQVQAIEMQ-
A0A5C5YU10      AL-----------------------------------------------LNQQQELELL-
A0A517MPZ6      --------------------------------------------------KQIQDIQLQ-
A0A5C6CNV7      --------------------------------------------------NKIRDLDLQ-
A0A518K5H4      --------------------------------------------------GQIQMMEQN-
A0A5C6AA28      --------------------------------------------------GQIQSVEQS-
A0A2E9VK20      QL-----------------------------------------------DSQLIPLLLE-
A0A3D4PJK1      QL-----------------------------------------------DSQLIPLLLE-
A0A532UT69      AL-----------------------------------------------ETRLEQLQLR-
A0A355AI52      SV-----------------------------------------------EKQLLEDRAQ-
A0A354PCQ3      RV-----------------------------------------------RREYYEENRA-
A0A0S8GZ23      -T-----------------------------------------------TAILVQLQME-
A0A1I3DDV4      TK-----------------------------------------------FGKLIELQAE-
A0A2E0SMM6      RL-----------------------------------------------QDQLKADQAE-
A0A3L7SI46      KH-----------------------------------------------QDELLQDQAE-
A0A356KTN1      NL-----------------------------------------------RNRLSEAELD-
A0A5B9PJZ8      YV-----------------------------------------------ELKMLEQE---
A0A2S8G191      -L-----------------------------------------------EAEILNVEQT-
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      AL-----------------------------------------------TSSIMQYEEL-
A0A7C2FXP7      VL-----------------------------------------------TTNIVELDQA-
A0A2E3GWC6      QL-----------------------------------------------DSQLLPLLLE-
F0SLB0          QL-----------------------------------------------DSQLLPLLLE-
A0A3L7NDH9      SL-----------------------------------------------EKQLFEERTQ-
A0A1N6DAJ8      ------------------------------------------------------------
A0A532UD06      QL-----------------------------------------------RAELRRVEMD-
A0A660URN1      QL-----------------------------------------------QSELKDLELQ-
A0A517ZCB5      RM-----------------------------------------------QQELLSAQTE-
A0A225EH48      -A-----------------------------------------------RNIAIAQFEK-
A0A518INW8      RT-----------------------------------------------AALNLEHTKV-
A0A518JPH9      RA-----------------------------------------------AAINLEHTKV-
A0A5C5VEK8      RL-----------------------------------------------RNQAQDLELA-
A0A532UTJ0      -F-----------------------------------------------TNHITQADQE-
A0A432MFP3      -V-----------------------------------------------EARIAEARTR-
A0A2E2CCW9      AL-----------------------------------------------ETHLMPLLIQ-
A0A3C0AGX3      AL-----------------------------------------------ETHLMPLLIQ-
A0A518AAQ5      AL-----------------------------------------------ETHLMPLLIQ-
A0A517QBG9      AL-----------------------------------------------ETHLMPLLIQ-
A0A518FTU3      AL-----------------------------------------------ETHLMPLLIQ-
A0A517WHH5      AL-----------------------------------------------ETHLMPLLIQ-
A0A5A8BGT3      AL-----------------------------------------------ETHLMPLLIQ-
A0A2E7K7A9      AL-----------------------------------------------ETHLMPLLIQ-
A0A517PTS5      AL-----------------------------------------------ETHLMPLLIQ-
A0A6I6AH34      AL-----------------------------------------------ETHLMPLLIQ-
A0A517VTK3      AL-----------------------------------------------ETHLMPLLIQ-
A0A517WQT4      AL-----------------------------------------------ETHLMPLLIQ-
A0A517VID8      AL-----------------------------------------------ETHLMPLLIQ-
A0A517RK10      AL-----------------------------------------------ETHLMPLLIQ-
A0A518IH18      AL-----------------------------------------------ETHLMPLLIQ-
A0A5C5XLF4      TE-----------------------------------------------RQQLDSQLIP-
A0A2D5NDU9      SA-----------------------------------------------EAAILAQVEK-
A0A1P8WP26      QI-----------------------------------------------TQDLFDLEAQ-
A0A3L7V1F3      RI-----------------------------------------------NQELLDLESQ-
D5SZ21          RM-----------------------------------------------TEQLLQEQAK-
A0A286RGB6      AQ-----------------------------------------------TRDVLRPE---
A0A518CHE5      RL-----------------------------------------------QDQLKVDQAE-
A0A1V5N3W2      -L-----------------------------------------------TQRVAQLEET-
A0A3E0MY27      -V-----------------------------------------------VERLRDQEQE-
A0A7C4Z5R7      RT-----------------------------------------------RAQLSEVQDQ-
A0A2E0X9P6      KG-----------------------------------------------TQKYAETLAD-
A0A286RLF2      EV-----------------------------------------------ERKVVEDRVE-
A0A517NSK8      RQ-----------------------------------------------ETAKAEYNDY-
A0A5C5Z0D6      RQ-----------------------------------------------ETARAEYDEY-
M5UE94          RQ-----------------------------------------------ATAQAEYDEY-
A0A2E8FLY0      RV-----------------------------------------------RQQLINDQVE-
A0A3D2U1E1      RT-----------------------------------------------RQQLINDQVA-
E8R3W3          QR-----------------------------------------------DRNLLTAQVR-
A0A5C5ZM48      RE-----------------------------------------------QQMLMESRVE-
A0A5B9WF77      RI-----------------------------------------------KQVKNELDHL-
A0A518BBX8      LD-----------------------------------------------NQLFPLLLSE-
A0A1P8WN28      EL-----------------------------------------------RAKVALLETE-
A0A3B9CTT0      TL-----------------------------------------------EDKLNDEQGE-
A0A518ALT3      DI-----------------------------------------------EQQITEIKSK-
A0A3M1QRP3      TL-----------------------------------------------SAELKKAEFE-
A0A517TMV0      VQ-----------------------------------------------QSRLLDLRME-
A0A3E0MY88      NL-----------------------------------------------ERTLLQDRAT-
A0A5B9QF68      EQ-----------------------------------------------QKQILASQAE-
A0A5B9QGF0      EQ-----------------------------------------------QKQILTLQAE-
A0A5C6CK24      EQ-----------------------------------------------QKQVLAAQAE-
A0A2E3RCU8      QL-----------------------------------------------EQGLIEDIAR-
A0A1C3E6N1      RM-----------------------------------------------TEQLLQEQAK-
A0A518GJT2      RM-----------------------------------------------TEQLLQEQAK-
A0A2E8B0L9      SV-----------------------------------------------ERKLLADRAR-
A0A5Q4GFE7      QI-----------------------------------------------ERRLMEDQTR-
A0A257WS34      RF-----------------------------------------------EQQLQEYQAQ-
A0A7C4LP10      KI-----------------------------------------------EQELIADQQS-
A0A517MLW3      VL-----------------------------------------------EQKLLSDRAE-
A0A5B9QVD0      AL-----------------------------------------------EQKLLNDRAE-
A0A3A0DET7      EL-----------------------------------------------ERQVQEVEQA-
A0A3B8PNV4      RI-----------------------------------------------RQQLINDQVE-
A0A3D1DR40      RI-----------------------------------------------RQQLINDQVE-
A0A2E7RYU8      RV-----------------------------------------------RQQLINDQVE-
A0A3B8LXG8      RV-----------------------------------------------RQQLINDQVE-
A0A286RD13      AA-----------------------------------------------QARLSYLETR-
A0A2E3GWX1      RL-----------------------------------------------QQQMIEDKAK-
F0SG60          RL-----------------------------------------------QQQMIEDKAK-
A0A2E9VST2      RL-----------------------------------------------QQQLIEDEAS-
A0A356A6X2      RL-----------------------------------------------QQQLIEDESS-
A0A5C5XLM3      RL-----------------------------------------------QQQLIEDEAS-
A0A7C5FXU1      RT-----------------------------------------------DPTYTRLQAQ-
A0A3M1VCL4      RV-----------------------------------------------EQQLRSDYAE-
A0A5C5V7Z9      SQ-----------------------------------------------QKRLMETQDE-
A0A5C5YT05      SQ-----------------------------------------------QQRLMETQDE-
A0A518D7F9      QQ-----------------------------------------------RQKLLEDEQE-
A0A5C5ZIP0      DQ-----------------------------------------------QTRLFDVEAQ-
A0A518KBK3      KQ-----------------------------------------------QAKLIDLRDE-
A0A5C6AKF9      AQ-----------------------------------------------QSKLIGVRDE-
A0A6M5Z0K7      AA-----------------------------------------------DKKVSDLRER-
A0A350CI62      RI-----------------------------------------------MQEILDRQSA-
A0A4P5WQK6      RI-----------------------------------------------MQEILDRQSA-
A0A3C1X4W5      RI-----------------------------------------------MQEILDLQSH-
A0A3D3W3A7      RI-----------------------------------------------MQEILDLQSH-
A0A518DRX3      QI-----------------------------------------------ERQLIDERGQ-
A0A518DZF9      QI-----------------------------------------------ERQLIDERGQ-
A0A518AKT8      ER-----------------------------------------------ERERLEAERE-
A0A5C5ZR72      QL-----------------------------------------------RSGLRELRKT-
A0A7C5R0U3      QV-----------------------------------------------EQDLLAARTE-
A0A517TY85      QL-----------------------------------------------QDQMSAIKVK-
A0A5B9QEI7      FI-----------------------------------------------HQQMAEIKSQ-
F0SI78          QL-----------------------------------------------IPLMLEESML-
A0A517MDV3      TE-----------------------------------------------MDSLLSLKVR-
A0A518IQ30      RM-----------------------------------------------EQRLLADRAL-
A0A517LWP4      EM-----------------------------------------------EQKLLADRAL-
A0A518JNW8      EI-----------------------------------------------EQKLLSDRAL-
A0A2E7ENQ5      QL-----------------------------------------------KRELNDDYAR-
A0A7C2KUQ9      EL-----------------------------------------------NVAVYEAEHR-
A0A7C5BZF0      RM-----------------------------------------------YQTLLEDQAR-
A0A1G3AQE9      -L-----------------------------------------------EKNLVDYRAE-
A0A3L7UQT9      KL-----------------------------------------------NEELQKLRND-
A0A4P5YBU2      KL-----------------------------------------------NEELQKLRND-
A0A7C7V5U8      ML-----------------------------------------------ERELLDAQAQ-
                                                                            

A0A5S9IJB5      ------------------------------------SLVTGR------------------
A0A5S9IPR9      ------------------------------------D--LKT------------------
A0A533Q9U4      ------------------------------------FSLYSQ------------------
A0A533Q6B7      ------------------------------------ISLYSN------------------
A0A1U9NNE1      ------------------------------------VLGDQQ------------------
A0A2G2JCA2      ------------------------------------A-----------------------
A0A1G2XVR0      ------------------------------------KTMLSE------------------
A0A1G3B0P0      ------------------------------------KTMLSE------------------
A0A1E3X4X0      ------------------------------------VSNLSE------------------
A0A286U4B3      ------------------------------------YASELG------------------
A0A5C6DDS2      ------------------------------------YAGELD------------------
A0A2E3GW02      ------------------------------ES----M--LLE------------------
A0A5B9QNZ7      ------------------------------LR----E--EQS------------------
A0A1Z8N7H5      ------------------------------LK----S--LSS------------------
A0A1G2YPI3      ------------------------------LA----G--SLR------------------
A0A1U7CZ81      ------------------------------MA----K--YNS------------------
A0A142YNY8      ------------------------------EG----Q--HAD------------------
A0A1U7GLS6      ------------------------------QA----E--IEG------------------
A0A532UIN2      ------------------------------RA----D--RRR------------------
A0A0S8KNX5      ------------------------------LV----V--AKQ------------------
A0A3D3UVZ8      ------------------------------LI----I--AQQ------------------
A0A517NFU9      ------------------------------ER----G--FSD------------------
A0A5C5YWH4      ------------------------------EQ----S--LAD------------------
A0A3D2TNK4      ------------------------------LQ----N--LSM------------------
A0A7C1Y4F0      ------------------------------LK----D--ILY------------------
A0A6I0ENW6      ------------------------------ET----A--LQS------------------
A0A6L3A0B7      ------------------------------ET----A--LQS------------------
A0A0J1B4A0      ------------------------------ER----L--MAA------------------
A0A142WSB9      ------------------------------ES----R--LSQ------------------
M5SZR3          ------------------------------ER----E--LLT------------------
M5TW92          ------------------------------EQ----E--LLT------------------
A0A2S8FKY2      ------------------------------RF----T--LTE------------------
A0A517N8P6      ------------------------------AE----M--LAI------------------
A0A432MJP4      ------------------------------QQ----R--LAD------------------
M5UQ35          ------------------------------LS----F--LRL------------------
A0A0S8FY64      ------------------------------LQ----G--ALR------------------
A0A1N6KFT7      ------------------------------YD----T--AKRATRNTNDPSLKYARERKV
L0DFG4          ------------------------------YN----T--AKRATRNTNDPSLQYARDRKE
A0A5C5XXG1      ------------------------------KQ----R--LQA------------------
A0A7C7YUM8      ------------------------------LA----A--ARA------------------
A0A7C2AHI6      ------------------------------LA----R--LSG------------------
A0A518BJJ1      ------------------------------IA----S--LQH------------------
A0A518D182      ------------------------------RE----V--LAS------------------
A0A5C5WTY6      ------------------------------RQ----R--LVS------------------
A0A5C5Y033      ------------------------------RE----K--LTA------------------
A0A5C6G1Y2      ------------------------------RE----K--LTA------------------
A0A354PDV6      ------------------------------KQ----R--LTT------------------
A0A5C6FZ02      ------------------------------KQ----R--LQA------------------
M5TIT3          ------------------------------KQ----R--LSS------------------
A0A5M6CY44      ------------------------------KQ----R--LNA------------------
F2AXG2          ------------------------------KQ----R--LTS------------------
M2BB46          ------------------------------KQ----R--LTS------------------
L7CLQ6          ------------------------------KQ----R--LTS------------------
A0A0J1B719      ------------------------------KQ----R--LTS------------------
Q7UF18          ------------------------------KQ----R--LTS------------------
A0A2G1W1E0      ------------------------------KQ----R--LTS------------------
K5E235          ------------------------------KQ----R--LTS------------------
A0A5C6FFI9      ------------------------------ER----T--LVS------------------
A0A5C5WDJ1      ------------------------------EK----A--LSD------------------
A0A5C5X547      QGSGLEKSRQQYESDLAKIDDDLNFRKSLIKR----S--FKK------------------
A0A353FIP5      ------------------------------AR----A--LEE------------------
A0A5B1CIK7      ------------------------------KQ----R--LTA------------------
A0A5C5WHS2      ------------------------------KQ----R--LTA------------------
A0A5C6B6G8      ------------------------------KQ----R--LTA------------------
A0A5C5ZZN3      ------------------------------KQ----R--LSS------------------
A0A5C5XS91      ------------------------------KR----R--LSS------------------
A0A5C6C4E6      ------------------------------RQ----R--LAA------------------
A0A2E1VVJ1      ------------------------------AA----E--LAI------------------
A0A3M2AEL0      ------------------------------RI----R--LRA------------------
A0A2A2W9R6      ------------------------------RQ----V--MRA------------------
A0A518HKC1      ------------------------------RQ----V--MRA------------------
A0A518L3P0      ------------------------------RQ----V--MRA------------------
A0A255R1S0      ------------------------------RD----V--MRA------------------
A0A5B9MKP1      ------------------------------RR----V--LVT------------------
A0A0S8J591      ------------------------------VELEKED--KTR------------------
M5RT57          ------------------------------MH----RVESTA------------------
A0A351FYP6      ------------------------------------N--KSI------------------
A0A2E7ESJ6      ------------------------------QE----E--LEG------------------
A0A2D5AWU0      ------------------------------LQ----L--QRR------------------
A0A1G2YQB7      ------------------------------LI----T--AKQ------------------
A0A353P687      ------------------------------LI----T--AKQ------------------
A0A356EME5      ------------------------------EM----A--ALA------------------
L0DC26          ----------------------------------------RI------------------
A0A3L7P4E4      ------------------------------EA----L--ALQ------------------
A0A3L7PEB5      ------------------------------EE----L--ALL------------------
A0A1U9NL64      ------------------------------LA----D--LKR------------------
A0A2N1UCJ3      ------------------------------LE----N--ALI------------------
A0A7C4EK84      ------------------------------LD----L--ARE------------------
A0A7C3F0T2      ------------------------------LR----E--MKL------------------
A0A2E0X4J3      ------------------------------IV----A--EQS------------------
A0A5C5YU10      ------------------------------LM----A--EQA------------------
A0A517MPZ6      ------------------------------ID----A--LRA------------------
A0A5C6CNV7      ------------------------------IA----S--LQS------------------
A0A518K5H4      ------------------------------LI----A--QQA------------------
A0A5C6AA28      ------------------------------LV----S--QQT------------------
A0A2E9VK20      ------------------------------EQ----A--ALK------------------
A0A3D4PJK1      ------------------------------EQ----A--ALK------------------
A0A532UT69      ------------------------------LS----D--RLQ------------------
A0A355AI52      ------------------------------LD----T--LQE------------------
A0A354PCQ3      ------------------------------KMKDWEQRLQEA------------------
A0A0S8GZ23      ------------------------------LS----S--YKQ------------------
A0A1I3DDV4      ------------------------------MS----R--LNG------------------
A0A2E0SMM6      ------------------------------LK----S--KLA------------------
A0A3L7SI46      ------------------------------LQ----N--RLM------------------
A0A356KTN1      ------------------------------LA----G--LRQ------------------
A0A5B9PJZ8      ---------------------------------------LLQ------------------
A0A2S8G191      ------------------------------AV----PGIQEQ------------------
A0A2E7EGG1      ------------------------------------QALNAS------------------
A0A2E2N5A9      ------------------------------------E--VSQ------------------
A0A7C8AGA2      ------------------------------IV----I--GQQ------------------
A0A7C2FXP7      ------------------------------LI----I--ARQ------------------
A0A2E3GWC6      ------------------------------EQ----V--LLQ------------------
F0SLB0          ------------------------------EQ----V--LLQ------------------
A0A3L7NDH9      ------------------------------LE----T--MLE------------------
A0A1N6DAJ8      ------------------------------------ERVYHI------------------
A0A532UD06      ------------------------------LE----N--ARY------------------
A0A660URN1      ------------------------------LA----N--AKL------------------
A0A517ZCB5      ------------------------------LR----N--KLS------------------
A0A225EH48      ------------------------------LKTAVKE--DSP------------------
A0A518INW8      ------------------------------LGLMLREQALTA------------------
A0A518JPH9      ------------------------------LGLMLREQALTA------------------
A0A5C5VEK8      ------------------------------LM----T--EQS------------------
A0A532UTJ0      ------------------------------LI----S--MRL------------------
A0A432MFP3      ------------------------------IR----------------------------
A0A2E2CCW9      ------------------------------KN----R--LER------------------
A0A3C0AGX3      ------------------------------KN----R--LER------------------
A0A518AAQ5      ------------------------------KN----R--LER------------------
A0A517QBG9      ------------------------------KN----R--LER------------------
A0A518FTU3      ------------------------------KN----R--LER------------------
A0A517WHH5      ------------------------------KN----R--LER------------------
A0A5A8BGT3      ------------------------------KN----R--LER------------------
A0A2E7K7A9      ------------------------------KN----R--LER------------------
A0A517PTS5      ------------------------------KN----R--LER------------------
A0A6I6AH34      ------------------------------KN----R--LER------------------
A0A517VTK3      ------------------------------KN----R--LER------------------
A0A517WQT4      ------------------------------KN----R--LER------------------
A0A517VID8      ------------------------------KN----R--LER------------------
A0A517RK10      ------------------------------KH----R--LER------------------
A0A518IH18      ------------------------------KH----R--LER------------------
A0A5C5XLF4      ------------------------------LLLEEQT--ALK------------------
A0A2D5NDU9      ------------------------------LGNQRVE--LLV------------------
A0A1P8WP26      ------------------------------LQ----T--AMK------------------
A0A3L7V1F3      ------------------------------LS----D--ART------------------
D5SZ21          ------------------------------MR----T--ALE------------------
A0A286RGB6      ---------------------------------------IAA------------------
A0A518CHE5      ------------------------------LK----S--KLT------------------
A0A1V5N3W2      ------------------------------LV----M--AQQ------------------
A0A3E0MY27      ------------------------------MM-------KLI------------------
A0A7C4Z5R7      ------------------------------IN----ETLAVA------------------
A0A2E0X9P6      ------------------------------VH----D--AQS------------------
A0A286RLF2      ------------------------------LA----R--LLQ------------------
A0A517NSK8      ------------------------------LNLVMREKKLTE------------------
A0A5C5Z0D6      ------------------------------LQLVMKEKKLAE------------------
M5UE94          ------------------------------LTLVMKEKKLRE------------------
A0A2E8FLY0      ------------------------------LR----N--KSG------------------
A0A3D2U1E1      ------------------------------YR----N--DSA------------------
E8R3W3          ------------------------------LQTIKDS--MKK------------------
A0A5C5ZM48      ------------------------------SY----R--QTM------------------
A0A5B9WF77      ------------------------------ESISRKK--SDP------------------
A0A518BBX8      ------------------------------RE-------LAV------------------
A0A1P8WN28      ------------------------------LN----G--LRR------------------
A0A3B9CTT0      ------------------------------LS----V--LRR------------------
A0A518ALT3      ------------------------------PR----P--RIS------------------
A0A3M1QRP3      ------------------------------VE----S--ARD------------------
A0A517TMV0      ------------------------------LQ----K--VAP------------------
A0A3E0MY88      ------------------------------VQ----G--LLE------------------
A0A5B9QF68      ------------------------------LS----S--LSK------------------
A0A5B9QGF0      ------------------------------LS----S--LSK------------------
A0A5C6CK24      ------------------------------LS----S--LSN------------------
A0A2E3RCU8      ------------------------------LK----S--LSS------------------
A0A1C3E6N1      ------------------------------MR----T--ALE------------------
A0A518GJT2      ------------------------------MR----T--ALE------------------
A0A2E8B0L9      ------------------------------LD----T--ARD------------------
A0A5Q4GFE7      ------------------------------LE----S--LQQ------------------
A0A257WS34      ------------------------------LQ----S--LLA------------------
A0A7C4LP10      ------------------------------LQ----N--LLG------------------
A0A517MLW3      ------------------------------VM----R--LEK------------------
A0A5B9QVD0      ------------------------------LQ----T--LAA------------------
A0A3A0DET7      ------------------------------LA----S--ERA------------------
A0A3B8PNV4      ------------------------------LQ----N--KSG------------------
A0A3D1DR40      ------------------------------LQ----N--KSG------------------
A0A2E7RYU8      ------------------------------LQ----N--KSG------------------
A0A3B8LXG8      ------------------------------LQ----N--KSG------------------
A0A286RD13      ------------------------------WF----EERQRA------------------
A0A2E3GWX1      ------------------------------LRD---K--LNN------------------
F0SG60          ------------------------------LRD---K--LNN------------------
A0A2E9VST2      ------------------------------LRD---K--LNG------------------
A0A356A6X2      ------------------------------LRD---K--LNG------------------
A0A5C5XLM3      ------------------------------LRD---K--LNG------------------
A0A7C5FXU1      ------------------------------MDAVQMR--IQE------------------
A0A3M1VCL4      ------------------------------LQ----R--RLA------------------
A0A5C5V7Z9      ------------------------------LR----R--LTP------------------
A0A5C5YT05      ------------------------------LR----R--LSP------------------
A0A518D7F9      ------------------------------LR----R--VAP------------------
A0A5C5ZIP0      ------------------------------LS----R--LEP------------------
A0A518KBK3      ------------------------------LG----R--LEP------------------
A0A5C6AKF9      ------------------------------LR----R--VEP------------------
A0A6M5Z0K7      ------------------------------IQ----E--FEL------------------
A0A350CI62      ------------------------------LT----E--ARQ------------------
A0A4P5WQK6      ------------------------------LT----E--ARQ------------------
A0A3C1X4W5      ------------------------------LT----E--ARQ------------------
A0A3D3W3A7      ------------------------------LT----E--ARQ------------------
A0A518DRX3      ------------------------------LN----N--MLA------------------
A0A518DZF9      ------------------------------LN----N--MLA------------------
A0A518AKT8      ------------------------------MQ----S--LSP------------------
A0A5C5ZR72      ------------------------------VK----H--P--------------------
A0A7C5R0U3      ------------------------------LQ----S--VLP------------------
A0A517TY85      ------------------------------SR----T--KIG------------------
A0A5B9QEI7      ------------------------------PR----L--KKD------------------
F0SI78          ------------------------------LE----K-----------------------
A0A517MDV3      ------------------------------LR----E--ERS------------------
A0A518IQ30      ------------------------------LQ----S--QAK------------------
A0A517LWP4      ------------------------------LQ----S--QAK------------------
A0A518JNW8      ------------------------------LQ----S--QAK------------------
A0A2E7ENQ5      ------------------------------LE----S--IQD------------------
A0A7C2KUQ9      ------------------------------LE----T--EGA------------------
A0A7C5BZF0      ------------------------------LE----NLVTQR------------------
A0A1G3AQE9      ------------------------------WE----T--KRK------------------
A0A3L7UQT9      ------------------------------WN----D--RRN------------------
A0A4P5YBU2      ------------------------------WN----D--RRN------------------
A0A7C7V5U8      ------------------------------MK----K--IQA------------------
                                                                            

A0A5S9IJB5      -------------------------------NLGINHPQVVALKSKK-----------KV
A0A5S9IPR9      -------------------------------RYKPAHPSIKKTINNI-----------AQ
A0A533Q9U4      -------------------------------RYGMKHPKIAGLKAEL-----------DT
A0A533Q6B7      -------------------------------RYGPKHPKVVQLNTEL-----------HT
A0A1U9NNE1      -------------------------------TMVSGNPRLEQRKEIL-----------TA
A0A2G2JCA2      -------------------------------VNFKDNATYQKLQKQI-----------LA
A0A1G2XVR0      -------------------------------KYGEKHPNIANIDLQL-----------KE
A0A1G3B0P0      -------------------------------KYGEKHPNIANIDLQL-----------KE
A0A1E3X4X0      -------------------------------KYGPRHPQMVRLLTQM-----------EA
A0A286U4B3      -------------------------------RVKEDHPLVQRLKTEK-----------SL
A0A5C6DDS2      -------------------------------RVKEDYPLVQRMKAEK-----------DF
A0A2E3GW02      -------------------------------KLGEQHPKVSEVRRRT-----------EV
A0A5B9QNZ7      -------------------------------RLGSEHPRVLELRDTV-----------RD
A0A1Z8N7H5      -------------------------------DFGPAHPRIIEIQNRI-----------QT
A0A1G2YPI3      -------------------------------QMTPGHPVVIAIESDI-----------SR
A0A1U7CZ81      -------------------------------LWDERYGEIRQLVMAE-----------DA
A0A142YNY8      -------------------------------FWAQRYPEIRAQILAE-----------LE
A0A1U7GLS6      -------------------------------HWRDRYHDIRRRVLAA-----------GD
A0A532UIN2      -------------------------------QLKSSHPAVMALETEI-----------AH
A0A0S8KNX5      -------------------------------TLSPTNPEIELKAELI-----------QT
A0A3D3UVZ8      -------------------------------TLTAENPELIRKNELL-----------KT
A0A517NFU9      -------------------------------AFGAGHPLVEAVRQEI-----------EI
A0A5C5YWH4      -------------------------------AFGPGHPLVEAARQEA-----------EI
A0A3D2TNK4      -------------------------------HYGPNHPRIIELQQDV-----------RS
A0A7C1Y4F0      -------------------------------LCTEEHPSVQAIKSKI-----------DR
A0A6I0ENW6      -------------------------------NMGENHPRMREMKAAL-----------EL
A0A6L3A0B7      -------------------------------NMGENHPRMREMKAAL-----------EL
A0A0J1B4A0      -------------------------------EFGENHPSVRALRTEL-----------DN
A0A142WSB9      -------------------------------LVGDNHADLKNVRSEI-----------TT
M5SZR3          -------------------------------LFGPGHPTLASVRLRI-----------EE
M5TW92          -------------------------------LFGPGHPTLASVRLRI-----------EE
A0A2S8FKY2      ---------------------------------AAYERYRQTNSAEI-----------NA
A0A517N8P6      -------------------------------QFAANHPQRLTVEQKL-----------KA
A0A432MJP4      -------------------------------RFGADYSRVRDIEEQI-----------AR
M5UQ35          -------------------------------TLGGGHPSVREVENEI-----------ES
A0A0S8FY64      -------------------------------SFGLKHPEVVALNDER-----------EH
A0A1N6KFT7      ELESEIEDLWRQRRPLLLRQLTREMANEGDLALQKAEAELTSLAAEE-----------AS
L0DFG4          EIESEIEDLWRQRRPLLLRQLSREMADEGDQAIQKAEAELTSLEAEE-----------NS
A0A5C5XXG1      -------------------------------KFGASHPDVQDIDDEI-----------RL
A0A7C7YUM8      -------------------------------EMLASNPALIALEGSR-----------QE
A0A7C2AHI6      -------------------------------VATEDNPDVLRLEAAR-----------ED
A0A518BJJ1      -------------------------------EFLPGYPPLAQAIAAL-----------DE
A0A518D182      -------------------------------TYTVEHPERARIERAI-----------VE
A0A5C5WTY6      -------------------------------VFGSKHPKVADIEKQI-----------TL
A0A5C5Y033      -------------------------------VFGSGHPKVREINNEI-----------QL
A0A5C6G1Y2      -------------------------------VFGSGHPKVREINNEI-----------QL
A0A354PDV6      -------------------------------VFGPSHPKVKDIQDQI-----------DL
A0A5C6FZ02      -------------------------------KFGASHPDVQDIDDEI-----------RL
M5TIT3          -------------------------------VFGAAHPKVQELEGEI-----------AL
A0A5M6CY44      -------------------------------VFGPGHPKVQEIEGEI-----------EL
F2AXG2          -------------------------------VFGPGHPKVQELESEI-----------TL
M2BB46          -------------------------------VFGPGHPKVQELESEI-----------TL
L7CLQ6          -------------------------------VFGPGHPKVQELESEI-----------TL
A0A0J1B719      -------------------------------VFGPGHPKVQELESEI-----------TL
Q7UF18          -------------------------------VFGPGHPKVQELESEI-----------TL
A0A2G1W1E0      -------------------------------VFGPGHPKVQELESEI-----------TL
K5E235          -------------------------------VFGPGHPKVQELESEI-----------TL
A0A5C6FFI9      -------------------------------VYGVSHPLIKSTREEI-----------DV
A0A5C5WDJ1      -------------------------------TFGPEHPLVEAAREET-----------MI
A0A5C5X547      -------------------------------EYERENRRLQEQFEQD-----------QL
A0A353FIP5      -------------------------------KHTEKWPPLIRLRGQI-----------KK
A0A5B1CIK7      -------------------------------VFGPGHPKVQDIQGQI-----------EG
A0A5C5WHS2      -------------------------------VFGPGHPKVQDIQSEI-----------ES
A0A5C6B6G8      -------------------------------VFGPGHPKVQELENEI-----------QL
A0A5C5ZZN3      -------------------------------VFGPAHPKVQELESEI-----------TL
A0A5C5XS91      -------------------------------IFGAAHPKVLEIQNQI-----------DL
A0A5C6C4E6      -------------------------------LFGAGHPKVQEIENQI-----------AL
A0A2E1VVJ1      -------------------------------EYTDEWPALKELRERS-----------VE
A0A3M2AEL0      -------------------------------VYTDQWPELVELNQRI-----------EE
A0A2A2W9R6      -------------------------------SYGAGHPSVVALDTEI-----------AS
A0A518HKC1      -------------------------------TYGAGHPSVVALDTEI-----------AS
A0A518L3P0      -------------------------------TYGAGHPSVVALDTEI-----------AS
A0A255R1S0      -------------------------------TFGDSHPSVRSLDSEI-----------VN
A0A5B9MKP1      -------------------------------AFGMGHPSVVALDAEI-----------RA
A0A0S8J591      -------------------------------RYRDQDRLSRNMEVRV-----------EQ
M5RT57          -------------------------------AGGRNDPSYLRLEAEVEGYEASLKRAVAS
A0A351FYP6      -------------------------------DLGEGHPTIKSLKAAM-----------ES
A0A2E7ESJ6      -------------------------------RYGKDHPDVLTVRRQL-----------ER
A0A2D5AWU0      -------------------------------ERDQGDLLLAELRDEV-----------AV
A0A1G2YQB7      -------------------------------QLASTNPELARKESLL-----------SA
A0A353P687      -------------------------------HLAPTNPELARKESLL-----------NA
A0A356EME5      -------------------------------RNPSQDPQCVKLSQDL-----------ER
L0DC26          -------------------------------ARNKNDPAIKKHRDDL-----------EA
A0A3L7P4E4      -------------------------------DHGEDHPKVRSIRKRI-----------EM
A0A3L7PEB5      -------------------------------DLGEDHPKVQSIRKRI-----------EM
A0A1U9NL64      -------------------------------QVTEDHPSVIALEEKI-----------AS
A0A2N1UCJ3      -------------------------------QCSEGHPTVKALKSRI-----------EA
A0A7C4EK84      -------------------------------KLGPEHPEVRMKELAV-----------QA
A0A7C3F0T2      -------------------------------ECTDTHPGVAALEKKL-----------AE
A0A2E0X4J3      -------------------------------RWGEGHPRVEVLLTSL-----------ET
A0A5C5YU10      -------------------------------KWGDAYPTVKSIQRSL-----------DQ
A0A517MPZ6      -------------------------------TWGDGHTRVKLALQSK-----------AA
A0A5C6CNV7      -------------------------------TWGDGHPRVRIMLESR-----------EK
A0A518K5H4      -------------------------------KWGPGYPAVRLLEESL-----------AK
A0A5C6AA28      -------------------------------KWGPGYPSVRLLQDSL-----------DK
A0A2E9VK20      -------------------------------RYGSGHPDVINVRKRI-----------DL
A0A3D4PJK1      -------------------------------RYGSGHPDVINVRKRI-----------DL
A0A532UT69      -------------------------------WVTREFPAITALEAEI-----------LR
A0A355AI52      -------------------------------YYGPNHPKVIERTRKI-----------EQ
A0A354PCQ3      -------------------------------KLAARDPAIEKLN--------------RL
A0A0S8GZ23      -------------------------------RLTLKNPEIERITKSI-----------ET
A0A1I3DDV4      -------------------------------LFGPNHPTVENLRKNI-----------EI
A0A2E0SMM6      -------------------------------TLDYNHPDVVVLTNRI-----------SA
A0A3L7SI46      -------------------------------TLGPKHPTIRQLEDRI-----------QQ
A0A356KTN1      -------------------------------RFSDEWHEVRIARARR-----------DQ
A0A5B9PJZ8      -------------------------------QYGSNHPELKNVRKQI-----------AM
A0A2S8G191      -------------------------------YVGKYRDTIVELEEHV-----------RL
A0A2E7EGG1      -------------------------------SRGGTDPRIIKLNQDI-----------ES
A0A2E2N5A9      -------------------------------RYGPGHPELIAAKADL-----------DA
A0A7C8AGA2      -------------------------------TMTPENPELKQRKEVL-----------ET
A0A7C2FXP7      -------------------------------RLTATNPELRLKENLL-----------AT
A0A2E3GWC6      -------------------------------RYNDGHPDVINIRKRI-----------DI
F0SLB0          -------------------------------RYNDGHPDVINIRKRI-----------DI
A0A3L7NDH9      -------------------------------FYGPQHPKVIERTNKI-----------RK
A0A1N6DAJ8      -------------------------------ARNRSDPSLKKYRDEL-----------EA
A0A532UD06      -------------------------------HCTEDHPSVKAIQSEI-----------HR
A0A660URN1      -------------------------------HCTEDHPSIEAIRGRI-----------KY
A0A517ZCB5      -------------------------------FYGPKHPEILELQDKI-----------RI
A0A225EH48      -------------------------------LYAREKDHLAKLEEDL-------------
A0A518INW8      -------------------------------DYGDDHPLVQRVRDEL-----------AS
A0A518JPH9      -------------------------------DYGDEHPLVQRVRDEL-----------TS
A0A5C5VEK8      -------------------------------KWGDEYPTVKSIQRSL-----------DQ
A0A532UTJ0      -------------------------------ILQPENPDLKRKAELL-----------ET
A0A432MFP3      ---------------------------------NPGDPALSRLMSQR-----------QI
A0A2E2CCW9      -------------------------------DFQKNHPDLDAVNRSI------ETIINLY
A0A3C0AGX3      -------------------------------DFQKNHPDLDAVNRSI------ETIINLY
A0A518AAQ5      -------------------------------DFKKNHPDLDAVNRSI------ETIVNLY
A0A517QBG9      -------------------------------DFKKNHPDLDAVNRSI------ETIVNLY
A0A518FTU3      -------------------------------DFKKNHPDLDAVNRSI------ETIVNLY
A0A517WHH5      -------------------------------DYKKNHPDLDAVNRSI------DTIINLY
A0A5A8BGT3      -------------------------------DYKKNHPDLDAVNRSI------DTIINLY
A0A2E7K7A9      -------------------------------DYKKNHPDLDAVNRSI------DTIINLY
A0A517PTS5      -------------------------------DYKKNHPDLDAVNRSI------DTIINLY
A0A6I6AH34      -------------------------------DYKKNHPDLDAVNRSI------DTIINLY
A0A517VTK3      -------------------------------DFGENHPDLDAVNRSI------KTIVNLY
A0A517WQT4      -------------------------------DFGENHPDLDAVNRSI------KTIVNLY
A0A517VID8      -------------------------------DFQKNHPDLDAVNRSI------ETIINLY
A0A517RK10      -------------------------------DYQKNHPDLDAVNRSI------ETVINLY
A0A518IH18      -------------------------------DFQKNHPDLDAVNRSI------ETVINLY
A0A5C5XLF4      -------------------------------RYGSGHPDVINVRKRI-----------DL
A0A2D5NDU9      -------------------------------ELQPEHWRVAALDRDI-----------AA
A0A1P8WP26      -------------------------------SYGAKHPTIIDLQNQI-----------AT
A0A3L7V1F3      -------------------------------RYGENHSKIKALTENI-----------QL
D5SZ21          -------------------------------SYGPNHPKVMELRDAI-----------QA
A0A286RGB6      -------------------------------RYGNRYVQEL-----------------AD
A0A518CHE5      -------------------------------TLDYNHPDVMVLTNRI-----------QS
A0A1V5N3W2      -------------------------------TLAPTNPEIEQQTKTL-----------EA
A0A3E0MY27      -------------------------------KNPDRSEVMKRLREQI-----------AE
A0A7C4Z5R7      -------------------------------ARGLKEPTLQPLIKQR-----------EA
A0A2E0X9P6      -------------------------------ALNERKREVQEELSSA-----------RR
A0A286RLF2      -------------------------------EFGNNHPRVQALQQRI-----------AA
A0A517NSK8      -------------------------------NFGDDHPTVVSIREQI-----------TM
A0A5C5Z0D6      -------------------------------KFSEGHPQVVSIREQI-----------DL
M5UE94          -------------------------------KFSDGHPQIVSLREQI-----------EM
A0A2E8FLY0      -------------------------------EFGPNHPAIQRLVARI-----------RD
A0A3D2U1E1      -------------------------------ELGPNHPRMQMLSARI-----------KA
E8R3W3          -------------------------------FRNTQDPSYKKLETELRYREIDFLRLQNE
A0A5C5ZM48      -------------------------------RRPEQSREYRDLNAGL-----------QD
A0A5B9WF77      -------------------------------SRKAAQTQLSKLEKQY--YDLWETKKGQI
A0A518BBX8      -------------------------------DFGPDHPKLKMLRDRI-----------QL
A0A1P8WN28      -------------------------------HFGSGHSDIIRREQQL-----------VG
A0A3B9CTT0      -------------------------------HYGSGHPEIISRTSKI-----------QL
A0A518ALT3      -------------------------------DTWEKDPDYLRVNALL-----------IE
A0A3M1QRP3      -------------------------------QFGESHPTMVRLRRQV-----------DF
A0A517TMV0      -------------------------------FYGPAHPQVATLQQQV-----------AG
A0A3E0MY88      -------------------------------NLGPNHPRVKEMTEKI-----------RM
A0A5B9QF68      -------------------------------FYGPNHPRILDLQNRI-----------AN
A0A5B9QGF0      -------------------------------FYGPNHPRILDLQTSI-----------AN
A0A5C6CK24      -------------------------------FYGPNHPRILDLQKSI-----------AN
A0A2E3RCU8      -------------------------------DFGPSHPKIIEIQNRI-----------QT
A0A1C3E6N1      -------------------------------SYGPNHPKVIELRDAI-----------QA
A0A518GJT2      -------------------------------SYGPNHPKVMELRDAI-----------QS
A0A2E8B0L9      -------------------------------YLGPTHPEVQELVRNI-----------RN
A0A5Q4GFE7      -------------------------------HYGRAHPKVIELMQQI-----------QA
A0A257WS34      -------------------------------KLGPAHPEVQALEERI-----------AA
A0A7C4LP10      -------------------------------KLGPAHPDVVQLESKI-----------AA
A0A517MLW3      -------------------------------HLGPTHPSMVALQGEI-----------SN
A0A5B9QVD0      -------------------------------HYGPTHPEIQQLNAEI-----------AN
A0A3A0DET7      -------------------------------RWGEGHPRVKLLRQSL-----------AE
A0A3B8PNV4      -------------------------------EYGPNHPLIQKLTARI-----------RD
A0A3D1DR40      -------------------------------EYGPNHPLIQKLTARI-----------RD
A0A2E7RYU8      -------------------------------EYGPNHPLIQKLTTRI-----------RD
A0A3B8LXG8      -------------------------------EYGPNHPLIQKLTTRI-----------RD
A0A286RD13      -------------------------------AQGEKAPSAQRIQEEM-----------ET
A0A2E3GWX1      -------------------------------KLGPNHPEVQELQQRI-----------DG
F0SG60          -------------------------------KLGPNHPEVQELQQRI-----------DG
A0A2E9VST2      -------------------------------KLGPNHPEILELKERV-----------KA
A0A356A6X2      -------------------------------KLGPNHPEVLELQERV-----------KA
A0A5C5XLM3      -------------------------------KLGPNHPEVLELQERV-----------KA
A0A7C5FXU1      -------------------------------LARTAQPEIA-------------------
A0A3M1VCL4      -------------------------------FLGPNHPRILSLRDRI-----------RA
A0A5C5V7Z9      -------------------------------HYGPNHPRVVSLTEQA-----------AA
A0A5C5YT05      -------------------------------HYGPNHPQIKELTEQV-----------AA
A0A518D7F9      -------------------------------FLAENNPTVTALNERI-----------AA
A0A5C5ZIP0      -------------------------------FYGPAHPEVVALSTQA-----------QA
A0A518KBK3      -------------------------------FYGPSHPQVATLKSQI-----------DS
A0A5C6AKF9      -------------------------------FYGPSHPQVVTLRSQI-----------EA
A0A6M5Z0K7      -------------------------------RAAPTTTARGMFQQPL-----------AE
A0A350CI62      -------------------------------KYGAKHARIRALETEL-----------AV
A0A4P5WQK6      -------------------------------KYGAKHARIRALETEL-----------AV
A0A3C1X4W5      -------------------------------KYGARHARIRALEAEL-----------QV
A0A3D3W3A7      -------------------------------KYGARHARIRALEAEL-----------QV
A0A518DRX3      -------------------------------HYGEAHPKVIALRNSI-----------VS
A0A518DZF9      -------------------------------HYGEAHPKVIALRNSI-----------VS
A0A518AKT8      -------------------------------YLGPNNPRMLELKARI-----------DG
A0A5C5ZR72      ----------------------------------QSNRDYMALSERV-----------RQ
A0A7C5R0U3      -------------------------------YLGPAHPRVRQLQEQI-----------AR
A0A517TY85      -------------------------------DSWSSDPEYLSLEAAA-----------KE
A0A5B9QEI7      -------------------------------VTWEEDPQYIQLQEQA-----------KN
F0SI78          --------------------------------LGEQHPKVSEVRRRT-----------EV
A0A517MDV3      -------------------------------RLGDAHPKVQDLQDAV-----------QD
A0A518IQ30      -------------------------------HFGPVHPKIQMLQQKI-----------AD
A0A517LWP4      -------------------------------HLGPVHPTIQMLQQKI-----------AD
A0A518JNW8      -------------------------------HLGPVHPKIQMLQQKI-----------AD
A0A2E7ENQ5      -------------------------------YYGSNHPTFIEVRQSI-----------LK
A0A7C2KUQ9      -------------------------------RLGDANQRMAELRAEVEHRKRLRAMRERD
A0A7C5BZF0      -------------------------------GYGWAHPEVLALQEKI-----------RR
A0A1G3AQE9      -------------------------------NLGDNHPELIALEDKI-----------RV
A0A3L7UQT9      -------------------------------VLGDNNPDLLELAQRI-----------RA
A0A4P5YBU2      -------------------------------VLGDNNPDLLELAQRI-----------RA
A0A7C7V5U8      -------------------------------HLGPSHPDYQATRERI-----------RE
                                                                            

A0A5S9IJB5      IEERLT------------------------------------------------------
A0A5S9IPR9      VKKQIF----------------------------------------------------HY
A0A533Q9U4      MRDNIM----------------------------------------------------KE
A0A533Q6B7      MRNHII----------------------------------------------------KE
A0A1U9NNE1      LKTRLD----------------------------------------------------QR
A0A2G2JCA2      DKEDLA----------------------------------------------------KL
A0A1G2XVR0      IENRIK----------------------------------------------------LE
A0A1G3B0P0      IENRIK----------------------------------------------------LE
A0A1E3X4X0      IKDKID----------------------------------------------------FE
A0A286U4B3      IEQEIK----------------------------------------------------DE
A0A5C6DDS2      IEQQIN----------------------------------------------------SE
A0A2E3GW02      MRTLLS----------------------------------------------------QE
A0A5B9QNZ7      VEQFLE----------------------------------------------------AK
A0A1Z8N7H5      TKQYIE----------------------------------------------------YH
A0A1G2YPI3      SKAQIA------------------------------------------------------
A0A1U7CZ81      SFAASA------------------------------------------------------
A0A142YNY8      GRPTPT------------------------------------------------------
A0A1U7GLS6      GPMAAS------------------------------------------------------
A0A532UIN2      VKAQIA------------------------------------------------------
A0A0S8KNX5      LKAHLE----------------------------------------------------ER
A0A3D3UVZ8      LKKHLE----------------------------------------------------DR
A0A517NFU9      TRRFIS----------------------------------------------------SN
A0A5C5YWH4      TRQFIA----------------------------------------------------KN
A0A3D2TNK4      LDQYIN----------------------------------------------------NY
A0A7C1Y4F0      INKELE------------------------------------------------------
A0A6I0ENW6      AEGSLR----------------------------------------------------QR
A0A6L3A0B7      AEGSLR----------------------------------------------------QR
A0A0J1B4A0      MRRFVD----------------------------------------------------ES
A0A142WSB9      ILSAYR-------------------------------------------SQGIVAPTIEK
M5SZR3          AKNFYKTLEKEYEEHHVAIREYADEAVDVGGYRKWKDASGTMEVSARLISEEESKVTLER
M5TW92          AKNFYKTLEKEYEEHHVAIREYADEAVDVGGYRKWKDASGTMEVSARLISEEENKVTLER
A0A2S8FKY2      IETSLK----------------------------------------------------ER
A0A517N8P6      TEKALR----------------------------------------------------EL
A0A432MJP4      VQQVAA----------------------------------------------------DS
M5UQ35          LKQYVA----------------------------------------------------KQ
A0A0S8FY64      VLSGLR----------------------------------------------------EA
A0A1N6KFT7      LYETLK----------------------------------------------------ES
L0DFG4          LYETLK----------------------------------------------------ES
A0A5C5XXG1      VRKFID----------------------------------------------------ES
A0A7C7YUM8      LVAALV----------------------------------------------------EQ
A0A7C2AHI6      LLARLA----------------------------------------------------SE
A0A518BJJ1      LRAKVR----------------------------------------------------DS
A0A518D182      LRARLT----------------------------------------------------QN
A0A5C5WTY6      TKQFLF----------------------------------------------------DQ
A0A5C5Y033      VEDFVR----------------------------------------------------KS
A0A5C6G1Y2      VEDFVR----------------------------------------------------KS
A0A354PDV6      VKNFLD----------------------------------------------------EK
A0A5C6FZ02      VRKFID----------------------------------------------------ES
M5TIT3          VKQFLQ----------------------------------------------------DK
A0A5M6CY44      VKQFLQ----------------------------------------------------DN
F2AXG2          VKEFLQ----------------------------------------------------DQ
M2BB46          VKEFLQ----------------------------------------------------DQ
L7CLQ6          VKEFLQ----------------------------------------------------DQ
A0A0J1B719      VKEFLQ----------------------------------------------------DQ
Q7UF18          VKEFLQ----------------------------------------------------DQ
A0A2G1W1E0      VKEFLQ----------------------------------------------------DQ
K5E235          VKEFLQ----------------------------------------------------DQ
A0A5C6FFI9      IERFVA----------------------------------------------------AN
A0A5C5WDJ1      TRQFID----------------------------------------------------AN
A0A5C5X547      AYELDW----------------------------------------------------RR
A0A353FIP5      LRTNIS----------------------------------------------------NA
A0A5B1CIK7      VKEFLQ----------------------------------------------------SN
A0A5C5WHS2      VKAFLQ----------------------------------------------------EN
A0A5C6B6G8      VKQFLQ----------------------------------------------------DN
A0A5C5ZZN3      VKQFLQ----------------------------------------------------DN
A0A5C5XS91      VKEFLQ----------------------------------------------------DK
A0A5C6C4E6      VKQFLQ----------------------------------------------------EK
A0A2E1VVJ1      LRGSIR----------------------------------------------------DN
A0A3M2AEL0      LEGRLL----------------------------------------------------LA
A0A2A2W9R6      IEKFTP----------------------------------------------------QE
A0A518HKC1      IQKFAP----------------------------------------------------QE
A0A518L3P0      IQKFSP----------------------------------------------------QD
A0A255R1S0      LRKYVD----------------------------------------------------NF
A0A5B9MKP1      FEKIGE----------------------------------------------------LS
A0A0S8J591      VNQQIA----------------------------------------------------VE
M5RT57          SRPKIT----------------------------------------------------DQ
A0A351FYP6      LNQQID----------------------------------------------------NR
A0A2E7ESJ6      YETTYP----------------------------------------------------EL
A0A2D5AWU0      LKERKR----------------------------------------------------DI
A0A1G2YQB7      LKQRLE----------------------------------------------------EL
A0A353P687      LKQRLE----------------------------------------------------EL
A0A356EME5      NKKSLE----------------------------------------------------QM
L0DC26          ARAGLA----------------------------------------------------AQ
A0A3L7P4E4      TRKYLS----------------------------------------------------NE
A0A3L7PEB5      TRKYLS----------------------------------------------------NE
A0A1U9NL64      IETDLE----------------------------------------------------ES
A0A2N1UCJ3      AQNKLA----------------------------------------------------AQ
A0A7C4EK84      LRQRLA----------------------------------------------------EQ
A0A7C3F0T2      QRQRLA----------------------------------------------------DL
A0A2E0X4J3      LQLRLA----------------------------------------------------EK
A0A5C5YU10      SGLRIE----------------------------------------------------AK
A0A517MPZ6      MEERLA----------------------------------------------------KQ
A0A5C6CNV7      LQARLD----------------------------------------------------KQ
A0A518K5H4      LRERRA----------------------------------------------------EQ
A0A5C6AA28      LRSKQA----------------------------------------------------EQ
A0A2E9VK20      VKSYYR----------------------------------------------------QM
A0A3D4PJK1      VKSYYR----------------------------------------------------QM
A0A532UT69      TKSKIA----------------------------------------------------EQ
A0A355AI52      MQGYLA----------------------------------------------------QF
A0A354PCQ3      ADEELA----------------------------------------------------RR
A0A0S8GZ23      FEKDLE----------------------------------------------------IY
A0A1I3DDV4      VEGLLK----------------------------------------------------ES
A0A2E0SMM6      AEESLN----------------------------------------------------QR
A0A3L7SI46      TQTWLS----------------------------------------------------ER
A0A356KTN1      IKLQLQ----------------------------------------------------SE
A0A5B9PJZ8      VDSMRM----------------------------------------------------QE
A0A2S8G191      RKDQIV----------------------------------------------------KG
A0A2E7EGG1      LESTLE----------------------------------------------------SL
A0A2E2N5A9      ATASLK----------------------------------------------------TQ
A0A7C8AGA2      LKERLT----------------------------------------------------QR
A0A7C2FXP7      LQSKLD----------------------------------------------------EQ
A0A2E3GWC6      ILSYYR----------------------------------------------------KR
F0SLB0          ILSYYR----------------------------------------------------KR
A0A3L7NDH9      IEQYLD----------------------------------------------------QF
A0A1N6DAJ8      ARAELV----------------------------------------------------AQ
A0A532UD06      INKELN----------------------------------------------------EQ
A0A660URN1      IKQLLG----------------------------------------------------EK
A0A517ZCB5      TQQYLT----------------------------------------------------DQ
A0A225EH48      -RTTLE----------------------------------------------------EF
A0A518INW8      VRQYIR----------------------------------------------------EK
A0A518JPH9      VRNYIN----------------------------------------------------EK
A0A5C5VEK8      AEQRIV----------------------------------------------------QK
A0A532UTJ0      LKNHLK----------------------------------------------------QR
A0A432MFP3      LMEQYE----------------------------------------------------QL
A0A2E2CCW9      RRQGLD----------------------------------------------------IS
A0A3C0AGX3      RRQGLD----------------------------------------------------IS
A0A518AAQ5      RRQGLE----------------------------------------------------IS
A0A517QBG9      RRQGLE----------------------------------------------------IS
A0A518FTU3      RRQGLE----------------------------------------------------IS
A0A517WHH5      RRQGIE----------------------------------------------------IS
A0A5A8BGT3      RRQGIE----------------------------------------------------IS
A0A2E7K7A9      RRQGIE----------------------------------------------------IS
A0A517PTS5      RRQGIE----------------------------------------------------IS
A0A6I6AH34      RRQGIE----------------------------------------------------IS
A0A517VTK3      RKQGIE----------------------------------------------------IS
A0A517WQT4      RKQGIE----------------------------------------------------IS
A0A517VID8      RRQGLD----------------------------------------------------IS
A0A517RK10      RRQGLD----------------------------------------------------IS
A0A518IH18      RRQGLD----------------------------------------------------IS
A0A5C5XLF4      VKSYYR----------------------------------------------------QM
A0A2D5NDU9      LNSQLS----------------------------------------------------KM
A0A1P8WP26      KRNFMT----------------------------------------------------QN
A0A3L7V1F3      KKKYLE----------------------------------------------------EY
D5SZ21          KEQWMA----------------------------------------------------SR
A0A286RGB6      VQSRIK----------------------------------------------------AR
A0A518CHE5      AEDALQ----------------------------------------------------QR
A0A1V5N3W2      FKERTQ----------------------------------------------------KQ
A0A3E0MY27      AEKDLA----------------------------------------------------KR
A0A7C4Z5R7      LEAVLE----------------------------------------------------SR
A0A2E0X9P6      AERQLQ----------------------------------------------------RD
A0A286RLF2      NEAFLL----------------------------------------------------AY
A0A517NSK8      MRKFID----------------------------------------------------DK
A0A5C5Z0D6      MRQFID----------------------------------------------------EN
M5UE94          MRKFID----------------------------------------------------NN
A0A2E8FLY0      RQKWLA----------------------------------------------------DR
A0A3D2U1E1      RQQWLS----------------------------------------------------KR
E8R3W3          AREAIR----------------------------------------------------RD
A0A5C5ZM48      IVSAMA----------------------------------------------------GR
A0A5B9WF77      RERLLV----------------------------------------------------TT
A0A518BBX8      ARNFFA----------------------------------------------------RP
A0A1P8WN28      QKQRLA----------------------------------------------------NM
A0A3B9CTT0      FEQRVK----------------------------------------------------AA
A0A518ALT3      TRRSLT----------------------------------------------------AL
A0A3M1QRP3      YKQQLA----------------------------------------------------ER
A0A517TMV0      VEQYLA----------------------------------------------------SY
A0A3E0MY88      TERHLA----------------------------------------------------EY
A0A5B9QF68      SQQYVR----------------------------------------------------DY
A0A5B9QGF0      SERYVR----------------------------------------------------EY
A0A5C6CK24      SERYVR----------------------------------------------------EY
A0A2E3RCU8      TKQYIE----------------------------------------------------YH
A0A1C3E6N1      KEQWMA----------------------------------------------------SR
A0A518GJT2      KEQWMA----------------------------------------------------SR
A0A2E8B0L9      AEQHIQ----------------------------------------------------EF
A0A5Q4GFE7      GRQYLM----------------------------------------------------NY
A0A257WS34      TQNYIV----------------------------------------------------NR
A0A7C4LP10      TQRYLS----------------------------------------------------NR
A0A517MLW3      AETYLS----------------------------------------------------DF
A0A5B9QVD0      GQNYLE----------------------------------------------------NF
A0A3A0DET7      LRDKLT----------------------------------------------------KM
A0A3B8PNV4      RQKWLT----------------------------------------------------ER
A0A3D1DR40      RQKWLT----------------------------------------------------ER
A0A2E7RYU8      RQKWLA----------------------------------------------------ER
A0A3B8LXG8      RQKWLA----------------------------------------------------ER
A0A286RD13      LRKGLE----------------------------------------------------QR
A0A2E3GWX1      TNEWLE----------------------------------------------------NR
F0SG60          TNEWLE----------------------------------------------------NR
A0A2E9VST2      ARDWMN----------------------------------------------------GR
A0A356A6X2      ARDWMN----------------------------------------------------GR
A0A5C5XLM3      ARDWMN----------------------------------------------------GR
A0A7C5FXU1      -QQFAA----------------------------------------------------RY
A0A3M1VCL4      NEQYVT----------------------------------------------------QY
A0A5C5V7Z9      LQQYLS----------------------------------------------------NY
A0A5C5YT05      LQQYLS----------------------------------------------------SY
A0A518D7F9      TKQYLA----------------------------------------------------GR
A0A5C5ZIP0      IKKYLA----------------------------------------------------EY
A0A518KBK3      TQQFLA----------------------------------------------------SY
A0A5C6AKF9      TEQYLA----------------------------------------------------SY
A0A6M5Z0K7      AEKAAA----------------------------------------------------AI
A0A350CI62      KEKYLR----------------------------------------------------EF
A0A4P5WQK6      KEKYLR----------------------------------------------------EF
A0A3C1X4W5      KEKYLA----------------------------------------------------DF
A0A3D3W3A7      KEKYLA----------------------------------------------------DF
A0A518DRX3      GEQYMA----------------------------------------------------DI
A0A518DZF9      GEQYMA----------------------------------------------------DI
A0A518AKT8      IDQYLT----------------------------------------------------NY
A0A5C5ZR72      EEQSLS----------------------------------------------------EF
A0A7C5R0U3      QEAFLS----------------------------------------------------RT
A0A517TY85      ANAALE----------------------------------------------------QL
A0A5B9QEI7      VEAELK----------------------------------------------------EL
F0SI78          MRTLLS----------------------------------------------------QE
A0A517MDV3      VEQFLT----------------------------------------------------AK
A0A518IQ30      SERYLA----------------------------------------------------EY
A0A517LWP4      SERYLL----------------------------------------------------EY
A0A518JNW8      SERYLL----------------------------------------------------EY
A0A2E7ENQ5      KEEYLA----------------------------------------------------EH
A0A7C2KUQ9      LHNLWK----------------------------------------------------TN
A0A7C5BZF0      TQEFLQ----------------------------------------------------NY
A0A1G3AQE9      TEQSLL----------------------------------------------------EY
A0A3L7UQT9      HEDLVN----------------------------------------------------NY
A0A4P5YBU2      QEDLVN----------------------------------------------------NY
A0A7C7V5U8      LEGYLD----------------------------------------------------NF
                                                                            

A0A5S9IJB5      -----------------------------------------AEVLGIMQS----------
A0A5S9IPR9      AKRIIMQ-----------------------------------------------------
A0A533Q9U4      VEQICDS-----------------------------------------------------
A0A533Q6B7      VERLCNH-----------------------------------------------------
A0A1U9NNE1      REDIG-------------------------KKFEELIEEQINRSSEFQVAE---------
A0A2G2JCA2      KIDLK--------------------------------TIGKEDLEARYLAS---------
A0A1G2XVR0      TLSLITK-----------------------------------------------------
A0A1G3B0P0      TLSLITK-----------------------------------------------------
A0A1E3X4X0      VKKIISS-----------------------------------------------------
A0A286U4B3      QGWLGKA-----------------------------------------------------
A0A5C6DDS2      QGWVAKA-----------------------------------------------------
A0A2E3GW02      AGERTST----------------------------KPASARPDLLTLYMQS---------
A0A5B9QNZ7      NQALQPQ--------------------------QDSPEIRSGTLVKAYAKV---------
A0A1Z8N7H5      DAELKTQ----------------------------LDELESNQLGPLLLQM---------
A0A1G2YPI3      --------------------------------------NLDDEFSQAQLAV---------
A0A1U7CZ81      ----------------------------------AAAGSGTVATNALTIEA---------
A0A142YNY8      ----------------------------------NPVRDESIK----SIPE---------
A0A1U7GLS6      ----------------------------------GP-GEPRQK----TVQE---------
A0A532UIN2      --------------------------------------DLDAEFARAQLAV---------
A0A0S8KNX5      RQEASKAFDDLVEKEAAEAGTKQLVA----------------------------------
A0A3D3UVZ8      KQEASNAFDNLVAKESAVAGNKQLVA----------------------------------
A0A517NFU9      QPAETKV---------------------------QSRKFDAAEMLSTYTSL---------
A0A5C5YWH4      APTNAKV---------------------------ATKKLDPAEMLKTYTSL---------
A0A3D2TNK4      HSGAGDR-----------------------------LEAMGKSIPKEVVVNL--------
A0A7C1Y4F0      --------------------------------------EEAEDFAEAYVEV---------
A0A6I0ENW6      EEALLAGGEPAVAAGAVSDGSLDPAMRLKELDYLAKRGEEQAKLLRDMITT---------
A0A6L3A0B7      EEALLAGGEPAVAAGAVSDGSLDPAMRLKELDYLAKRGEEQAKLLRDMITT---------
A0A0J1B4A0      RENRPEE--------------------------DKRVEAKPADILASYYQV---------
A0A142WSB9      EDLAAVA---------------------QGAAAKSGNKKAGVDLPHVYLYI---------
M5SZR3          EDNGKRVTLATASLSGDDQRLLAKIRADRIRKHEELSEMVEMGLTQ--------------
M5TW92          ENNGKRVTLATASLSSDDQRLLAKIRADRIRKHEELSEMVEMGLTQ--------------
A0A2S8FKY2      RAHLEKLVIERIAQQQAEGDVRKNSMMTTSLKLPEVDNTIPE------------------
A0A517N8P6      QQTRNNV-------------------SPEKIDVVKRQDEAAQALLTTYVSS---------
A0A432MJP4      RR--------------------------------SVESVEVDDLILS-------------
M5UQ35          QQDKPEV-------------------------ADDEVVVSTVDMLGHYFNV---------
A0A0S8FY64      MARAVDSIHSEY------------------------------------------------
A0A1N6KFT7      KEKSIEGLKTRHETLVKTLGADAPESIEAKSQVDRATEQLGGLGKDGLQSE---------
L0DFG4          KEKAIASLREKHENLTKTLGPNSPETIQAKADVDQATEQLGGLGKDVLQSE---------
A0A5C5XXG1      NEDTVAE------------------------APFGENSVNPESLLKAYVGF---------
A0A7C7YUM8      VAGALAGARVTQRGLEALRADYTASIKTWPITERGTIRESVGTLRERVRAS---------
A0A7C2AHI6      LESAETALTELAADRDALADSYAETLGELPLEERGKVDAAVRLLEQRILGN---------
A0A518BJJ1      LRGRLTGLQRLFEDRSELAKTAALAATDLPDANARVDRAALEDLRERVERQ---------
A0A518D182      LAQRAEALAALADDRDELAATARDAAMAQSGRDLESIDAALAATRARIADH---------
A0A5C5WTY6      AKREEDS---------------SQA---------SSPTLDPEAMLKAYVGF---------
A0A5C5Y033      KEQTSPE---------------MTF---------GSQAIKPDALLRAYIGF---------
A0A5C6G1Y2      KEQTSPE---------------MAF---------GSQAIKPDALLRAYIGF---------
A0A354PDV6      KDGTSVG---------------A-----------GAGMLSPEALLKAYVGF---------
A0A5C6FZ02      NEDTVAE---------------APF---------GENSVNPESLLKAYVGF---------
M5TIT3          QDLMNPA---------------SAF---------GSSTLSPEGLLKAYVGF---------
A0A5M6CY44      EELTNPD---------------GLM---------ADTMLTPEGLLNAYTGF---------
F2AXG2          KDLTSPA---------------EMF---------GDSALTPEGLLKAYVGF---------
M2BB46          KDLTSPA---------------EMF---------GDSALTPEGLLKAYVGF---------
L7CLQ6          KDLTSPA---------------EMF---------GDSALTPEGLLKAYVGF---------
A0A0J1B719      KDLTSPA---------------EMF---------GDSALTPEGLLKAYVGF---------
Q7UF18          KDLTSPA---------------EMF---------GDSALTPEGLLKAYVGF---------
A0A2G1W1E0      KELTSPA---------------EMF---------GDSALTPEGLLKAYVGF---------
K5E235          KELTSPA---------------EMF---------GDSALTPEGLLKAYVGF---------
A0A5C6FFI9      APAALEE---------------EKS------------TMNPRTMLTTFTRL---------
A0A5C5WDJ1      RPENTAR---------------EQK------------DMDPAEMVMTYVML---------
A0A5C5X547      IEAERLR---------------ALKAQGGGTLIVGDTGENQDQLMAQFNEVD--------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      ENLAESA---------------SMF---------GESTLTATGLLKAYVGF---------
A0A5C5WHS2      DELAEPA---------------AMF---------ADSTLTPTGLLRAYVGF---------
A0A5C6B6G8      EELTNVS---------------TGF---------SDTMLTPESLLKAYIGF---------
A0A5C5ZZN3      QDLTSPT---------------SAF---------GESALTPEGLLKAYVGF---------
A0A5C5XS91      QELTNPA---------------MAF---------TDTALNPEGLLKAYVGF---------
A0A5C6C4E6      RELTTPS---------------LSF---------NESSLSPEGLLKAYVGF---------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      GDESSEK---------------KES----------EFDVPPAEILATYYTV---------
A0A518HKC1      GDEPSEE---------------KES----------DFDVPPAEILAAYYAV---------
A0A518L3P0      GDEQPDS---------------AKS----------EFDVPPAEILATYYAV---------
A0A255R1S0      RAGSEKD---------------AGEEIVETVEAGRVFDVPPSEILKTYYSV---------
A0A5B9MKP1      DAEQAGG---------------AGE---------KAFDVPPSEILGTYYAV---------
A0A0S8J591      NDRMRRA-----------------AQSDAAQKLAT-------------------------
M5RT57          LKSLAEL-----------------D---RRDTLHE-------------------------
A0A351FYP6      IKGILAG-----------------------------------------------------
A0A2E7ESJ6      VNGTI-----------------------KPSRQEL------FDYVTRYLAS---------
A0A2D5AWU0      LL----------------------------------------QYARNYKID---------
A0A1G2YQB7      KEQAS-------------------KNFDEMATMEF------KESDLLEMQS---------
A0A353P687      RQQAD-------------------KNFDEMAEKEF------KESDMLEIQE---------
A0A356EME5      RRELA-------------------TQYQVQYRTAI------SAKREADLAS---------
L0DC26          HRKLY-------------------PIVARQLQDAG------RESSGSKTTL---------
A0A3L7P4E4      LSD---------------------QIAPPAKKM---------DFLQVYIES---------
A0A3L7PEB5      LDETS-------------------STTGPAKKI---------DFLEVYVES---------
A0A1U9NL64      -------------------------------DQ---------EFASAQLAV---------
A0A2N1UCJ3      -------------------------------IE---------EFAKNYIEL---------
A0A7C4EK84      DQLT--------------------AAASSERDG---------EFAEAYRAA---------
A0A7C3F0T2      -------------------------------EK---------RLAEAQLLA---------
A0A2E0X4J3      ------------------------QAEIAENRA---------TMIAAYVDS---------
A0A5C5YU10      ------------------------RESIEAEKE---------AALRAYAFN---------
A0A517MPZ6      ------------------------LEATEERKK---------AIVSAYVET---------
A0A5C6CNV7      ------------------------QADIEKNKE---------AIVSAYVET---------
A0A518K5H4      -------------------------------QQ---------ATLNAYVDG---------
A0A5C6AA28      -------------------------------QQ---------AILNAYVDG---------
A0A2E9VK20      GIDLPTM-----------------TTKVNPATGESELVTGNDPIATYVVA----------
A0A3D4PJK1      GIDLPTM-----------------TTKVNPATGESELVTGNDPIATYVVA----------
A0A532UT69      D----------------------------------------TKFAQTQLAV---------
A0A355AI52      ----------------------------DVIGSPRSFGGDDTQLANTVANI---------
A0A354PCQ3      TAQAEFD-----------------RRLAEVQRQAE------AEQGEINRKL---------
A0A0S8GZ23      RAKAG------------------------------------EKFDEAMVRFMEQK-----
A0A1I3DDV4      QAKTQNN-----------------P---LFEKLTP------ELLLNAYTGF---------
A0A2E0SMM6      LQSTN----------------------------NEYHQQHNRKQAERLLRI---------
A0A3L7SI46      RHVVS-------------------S---AMKDVRE------RELGPKLLEM---------
A0A356KTN1      IEKIRER-----------------------------------------------------
A0A5B9PJZ8      LSSLRGE-----------------ENELQGK----------PDMVADFVER---------
A0A2S8G191      RAQWQAA-----------------N-----------------------------------
A0A2E7EGG1      RDTNR-------------------------PRIREEMKAMSGLQRQQELAM---------
A0A2E2N5A9      VSQVVSG-----------------------------------------------------
A0A7C8AGA2      QEEVA-------------------GQFEKNLEAET------AKNRKRRVAE---------
A0A7C2FXP7      IAKTG-------------------KMCDDMLAERA------TNSGKKELAA---------
A0A2E3GWC6      GIELPVN-----------------PANGKAIVGPNGQVEPGSDMISTYMTA---------
F0SLB0          GIELPVN-----------------PANGKAIVGPNGQVEPGSDMISTYMTA---------
A0A3L7NDH9      DGVAA----------------------------PREFAGDDEKFAQMISQI---------
A0A1N6DAJ8      RRKLY-P-----------------IIQQQLQDMGRDDDDSSEALLPHRISI---------
A0A532UD06      A----------------------------------------KEFADAYIEV---------
A0A660URN1      A----------------------------------------KNFADAYLEV---------
A0A517ZCB5      PRMTS-------------------E---SVKRAST------EDLGPRLLQM---------
A0A225EH48      RSKVE------------------------------------ADIRAALKRE---------
A0A518INW8      APEGIEE-----------------L---VASNLSP------TEILDAFSTL---------
A0A518JPH9      APTGLEE-----------------I---VSSGMTP------SQILTAFSTL---------
A0A5C5VEK8      EADIAKS-----------------KEMALKAYAFD-------------------------
A0A532UTJ0      EQEAS-------------------------QAFDERVTKEIAEAGHKELVA---------
A0A432MFP3      WSDLE------------------------------------PTLRAQLAAEETHPVQIVL
A0A2E2CCW9      ADNLE-------------------SGEFQVAETKD------VDFVNVYLKS---------
A0A3C0AGX3      ADNLE-------------------SGEFQVAETKD------VDFVNVYLKS---------
A0A518AAQ5      AENLE-------------------SGEFQVSKMKD------VDFVNIYLKS---------
A0A517QBG9      ADNLE-------------------SGEFQVSKMKD------VDFVNIYLKS---------
A0A518FTU3      AENLE-------------------SGEFQVSKMKD------VDFVNIYLKS---------
A0A517WHH5      ADNLE-------------------SGEFQVSKMKD------VDFVNIYLKS---------
A0A5A8BGT3      ADNLE-------------------SGEFQVSKMKD------VDFVNIYLKS---------
A0A2E7K7A9      ADNLE-------------------SGEFQVSKVKD------VDFVNIYLKS---------
A0A517PTS5      ADNLE-------------------SGEFQVSKVKD------VDFVNIYLKS---------
A0A6I6AH34      ADNLE-------------------SGDFQVSKVKD------VDFVNIYLKS---------
A0A517VTK3      ADNLN-------------------SGDFKLSNVKE------ADFVNIYLKS---------
A0A517WQT4      ADNLN-------------------SGDFKLSNVKE------ADFVNIYLKS---------
A0A517VID8      AENLE-------------------SGEFQVAKTKD------VDFVNVYLKS---------
A0A517RK10      AENLE-------------------SGDFKIAKVKD------VDFVNVYLKS---------
A0A518IH18      AENLE-------------------SGDFKIAKVKD------VDFVNVYLKS---------
A0A5C5XLF4      GIDLP-------------------TMTTKVNPVTG---------EPELVTGNDPIATYVV
A0A2D5NDU9      RSVDAEN-----------------L----------------ESYAATLLAA---------
A0A1P8WP26      PAMRM-------------------Q---AAEENSR------GYLGPKLIEK---------
A0A3L7V1F3      PRQQQ-------------------Q---EMKRLAE------TELAPRMIQY---------
D5SZ21          RQVTI-------------------D---RLKQLRM------EELTPRLLQM---------
A0A286RGB6      REEIR------------------------------------QELEQRRVRD---------
A0A518CHE5      LQSNQ-------------------S---SYHVQQN------RRQAQRLLEI---------
A0A1V5N3W2      REDLE-------------------KTFDEMVAKEL------TENSQLQLDK---------
A0A3E0MY27      EADVTLE-----------------I---EEQEIIP------PEVAQLNL-----------
A0A7C4Z5R7      RKEWE-------------------G---RLE----------AQMQEKALEE---------
A0A2E0X9P6      RDIVE-------------------------------------------------------
A0A286RLF2      QDRLR-------------------A---RLDNLNI------PELSQMLLGT---------
A0A517NSK8      AAEVGDG-----------------A---VIEKMKP------DEMLQTYVGL---------
A0A5C5Z0D6      SAKITAS-----------------E---IRERMEP------AEMLQTYVGL---------
M5UE94          SSKIQAR-----------------D---AQERITP------AEMLQTYVGL---------
A0A2E8FLY0      PKNLI-------------------K---QMQQLST------AQLTPSLIDM---------
A0A3D2U1E1      PTDIS-------------------A---QMSSLAK------DRLTPTLIDM---------
E8R3W3          LEASRLG-----------------N---RLSSSPR-SATPNDLFANATLEQ---------
A0A5C5ZM48      VEMLRSQ-----------------VMSESIGSMKPSGPSEESEA----------------
A0A5B9WF77      SGVASNG-----------------E---RGESIPE-------------------------
A0A518BBX8      TAAFAAF-----------------SGDHESAETLLSKSGSAAEAVEMHLDY---------
A0A1P8WN28      QLQLG-------------------EN--VNVGVRD------PQVGQWLIKQ---------
A0A3B9CTT0      RADLD-------------------RR--LQIGIRG------PEAGQWLMDS---------
A0A518ALT3      REHAR-------------------TELAQQQLERN------KQESEQAILS---------
A0A3M1QRP3      ERELE-------------------LAPPATVGVKR-----DDEFAGMSPRE---------
A0A517TMV0      RSDTT-------------------G---RPGGLAD------AELGPMLMGM---------
A0A3E0MY88      GERIR-------------------A---QVGTLQS------TTFGPTLTHM---------
A0A5B9QF68      RANLG-------------------N---PSNGMAE------SHLGPVVKRM---------
A0A5B9QGF0      RANLG-------------------N---QSNGMAQ------NHLGPVVKRM---------
A0A5C6CK24      RANLG-------------------K---QQNGMVQ------QHIGPVVKRM---------
A0A2E3RCU8      DAQLK-------------------T---QVDNLES------NQLGPVLLRM---------
A0A1C3E6N1      RQVTI-------------------D---RLKQLRM------EELTPRLLQM---------
A0A518GJT2      RQVTI-------------------E---RLKQLRT------EELTPRLLQM---------
A0A2E8B0L9      QANVN-------------------R---RLDGVQS------EQMAPMLLGM---------
A0A5Q4GFE7      QEMVN-------------------Q---RLAGLSD------GRLGPMLLAR---------
A0A257WS34      NVIVT-------------------E---RLKEMRS------NELAPRLLQM---------
A0A7C4LP10      NIAVA-------------------E---SIKQLSA------NELGPRLLKM---------
A0A517MLW3      QARVN-------------------G---RSSNQSG------GQFAALLGDL---------
A0A5B9QVD0      QERVN-------------------G---QVSQTSG------QQFARLLGDL---------
A0A3A0DET7      QEIVI----------------------------------------EAYVES---------
A0A3B8PNV4      PKSVV-------------------D---QMQKLSK------AQLTPSLIDM---------
A0A3D1DR40      PKSVV-------------------D---QMQKLSK------AQLTPSLIDM---------
A0A2E7RYU8      PKSVV-------------------D---QMQKLSE------AQLTPSLIDM---------
A0A3B8LXG8      PKSVV-------------------D---QMQKLSE------AQLTPSLIDM---------
A0A286RD13      RAELT-------------------P---QLVEFAREQLAKGRAVAPPTETE---------
A0A2E3GWX1      SAQVA-------------------E---GSDKINA-------ELGPRLLQM---------
F0SG60          SAQVA-------------------E---GSDKINA-------ELGPRLLQM---------
A0A2E9VST2      GQQAS-------------------Q---DSKQLTH-------DMGPQMLEM---------
A0A356A6X2      GQQAS-------------------Q---DSKQLTR-------DMGPQMLEM---------
A0A5C5XLM3      GQQAT-------------------Q---DSKQLTR-------DMGPQMLEM---------
A0A7C5FXU1      QEDLK-------------------R---ISEQLEKRRGELLEELRRRRRKA---------
A0A3M1VCL4      RAGMA-------------------Q---QLRAATE------THIKPRLRQM---------
A0A5C5V7Z9      HAASG-------------------S---RYASINN------QDLGPMIKRT---------
A0A5C5YT05      HAASG-------------------S---RYASINN------GDLGPMIKRT---------
A0A518D7F9      HVGAG-------------------E---ALGGIGD------SELGPLLISM---------
A0A5C5ZIP0      RNGAS-------------------G---RADFLGQ------EELGSMLSTM---------
A0A518KBK3      RSDAS-------------------G---RPTGLTA------AELGPFLVGM---------
A0A5C6AKF9      RSDAS-------------------G---RPTGLSR------EELGPLLIGM---------
A0A6M5Z0K7      RAERR-------------------K---ELVARNQ------KLVGENLKQLVADCEAERN
A0A350CI62      PELQR-------------------T---RTDTMTR------EVLAPRLVQY---------
A0A4P5WQK6      PELQR-------------------T---RTDTMTR------EVLAPRLVQY---------
A0A3C1X4W5      PEMQR-------------------T---RTDTMTR------DVLAPRLVQY---------
A0A3D3W3A7      PEMQR-------------------T---RTDTMTR------DVLAPRLVQY---------
A0A518DRX3      RFKAE-------------------T---QQNSIAG------QQLAPLLTSL---------
A0A518DZF9      RFKAE-------------------T---QQNSIAG------QQLAPLLTSL---------
A0A518AKT8      RTAAG-------------------Q---RIAGMTG------NELGPMMQEL---------
A0A5C5ZR72      KDKLR-------------------QSLLLSARMSR------QKSGKTLADT---------
A0A7C5R0U3      RQLPR-----------------------LLATQDP------RQLGPLLRSL---------
A0A517TY85      KATAR-------------------AESLAARRADQ------EGEQRKLLAA---------
A0A5B9QEI7      KELVK-------------------RELIALRREER------KAEQEALVGA---------
F0SI78          AGERT-------------------S---TKPASAR------PDLLTLYMQS---------
A0A517MDV3      RDAIKPL-----------------A---DSPEVRS------GTLVNAYAKV---------
A0A518IQ30      RAKMQ-------------------A---ANGPGQE------QQLGEMLLSM---------
A0A517LWP4      RAKIN-------------------A---ANGPQQE------QQLGEMLLSM---------
A0A518JNW8      RAKMN-------------------A---ANGPQQE------QQLGEMLLSM---------
A0A2E7ENQ5      -GTEG-------------------A---EIDGFQN------QQLGEMLLSS---------
A0A7C2KUQ9      PGRAL-------------------A---DATT-AG------AALGGEVRQL---------
A0A7C5BZF0      PQWIK-------------------S---RTEAISS------SELASTLSDI---------
A0A1G3AQE9      PGRIR-------------------Q---RM---QD------AGLGPMLIGL---------
A0A3L7UQT9      FQRAK-------------------M---NLTA-NS------ADLGPQLLGM---------
A0A4P5YBU2      FQRAK-------------------M---NLTA-NS------ADLGPQLLGM---------
A0A7C7V5U8      HTRVV-------------------E---RLAQIQE------HQLGPLLVDM---------
                                                                            

A0A5S9IJB5      -LKDQYYR-------YKKEEDRL------------KKLVVAQQREALIFSQK-VTQYQLL
A0A5S9IPR9      -EEEKYEN-------FKSRRAYY------------QKKLKELEEQNLAFHQK-ILMYEDI
A0A533Q9U4      -IATEYEV-------AINRETTL------------VTILEQQKNEVFALGDK-AIQYGVL
A0A533Q6B7      -ITIEYEI-------AKSNEATL------------LSLFEQQKNEVFTQGDR-SIQYGVL
A0A1U9NNE1      -LKAELAK-------VRENERRI------------REKLEGTNAELITLGKR-HLAIKDH
A0A2G2JCA2      -KEEELSHVEIRLNGLNISVTKI------------QEMLDKEMKLAKKTSGD-TFELEIK
A0A1G2XVR0      -VETDYNV-------LLASEESY------------EKAYNEQSLVVFDLNRK-ITVYRRL
A0A1G3B0P0      -VETDYNV-------LLASEESY------------EKAYNEQSLVVFDLNRK-ITVYRRL
A0A1E3X4X0      -IETKYKV-------ARAKEDSI------------RESLEKQKEEALRLNKK-AIKYGIL
A0A286U4B3      -IKAEYQE-------AVGKEKGL------------RQHLEELKRENNRLEGK-SISYKVL
A0A5C6DDS2      -IKAEYQE-------AVGKERGL------------RQRLEELKRENNELEGK-SIGYKVL
A0A2E3GW02      -LQEELRT-------NQEKLKEL------------DNLFLSERTHSSNLTMD-ENRGRVL
A0A5B9QNZ7      -IDKDLED-------IRKQIEFT------------QQQIKQDEQESVDLVDD-ELRDQQI
A0A1Z8N7H5      -AQQGLDK-------ARQKESIL------------QASLDEARFXAVAHQRD-TSHITML
A0A1G2YPI3      -SKQESLA-------AKETEDQI------------AKYYEDQRKQAVALNQQ-INKYTLL
A0A1U7CZ81      -LRARVEL-------SRHQLDTL------------NQLVLSMEIERKATQSD-TYAAERL
A0A142YNY8      -LRADVEA-------LERERKAI------------TEALAQAELETKESNSE-TYTARYL
A0A1U7GLS6      -LKDEVSE-------LESRQASL------------QKVLDEVKLESKESNSA-TYQAQFL
A0A532UIN2      -AEQQYVS-------AKKKEGQI------------AKYHNEQRKQALDLNEQ-LAQYTIL
A0A0S8KNX5      -KRSELEQ-------TRQYEKGL------------RETLSKEDTETIDLGRT-QLTIQEL
A0A3D3UVZ8      -KRSELEQ-------TREYEKRL------------QETLSQQDTQTIGIGRK-QLTIQEL
A0A517NFU9      -LSNDIAE-------LEKRKEFL------------LQESTLEMRLAKEVESD-FMKGSSM
A0A5C5YWH4      -LQNDISE-------LEKRKEIL------------LADSEVEMRMAKQVEGD-FMKGASL
A0A3D2TNK4      -LRQSTQQ-------AIEKEKQI------------RQAYQQARAEAAAYSGS-LVQFRAL
A0A7C1Y4F0      -MRLRWVT-------AKQREDDV------------RASFESQYNDAKGFGVL-AARYSLL
A0A6I0ENW6      -LEKQITD-------IAGAASEL----------------------------------KMQ
A0A6L3A0B7      -LEKQITD-------IAGAASEL----------------------------------KMQ
A0A0J1B4A0      -LQSDISE-------MEKREEQL------------LELSEKESKLAKEVETT-FLLGSSL
A0A142WSB9      -LESQLEE-------FKIREDLL------------AARRTEAEGTAKESSLF-DAADQKR
M5SZR3          -LRQELDR-------TVRTQELL------------RGIYDTEYVSAKELTDY-EIAEEEF
M5TW92          -LRQELDR-------TVRTQELL------------RGIYDTEYVSAKELTDF-EIAEEEF
A0A2S8FKY2      -LKVRIGV-------LRQQQREL------------SKEVADLEKEVRTFGRS-SVEVEMK
A0A517N8P6      -LRKKQDL-------INEDVADT------------TKRLEDVRAKALKLMEF-EGENASF
A0A432MJP4      -IEQAVAS-------VEALQQEY------------TDRFREDLEQARQILND-QAEEENI
M5UQ35          -LKSDVRE-------YEARERDL------------GSLAEVEAKAAKEVQMA-FMEGNSL
A0A0S8FY64      -----------------------------------AVLVAREQELVRVLLEE-TRVALEQ
A0A1N6KFT7      -LHDRMAS-------IEHSLKSIGSMREEYETKLKEDLVAAKQSELGLLEEE-RLH----
L0DFG4          -LRDRMTS-------IEHSLKSIGTMREEYEIKFKDDLVSAKQSELERLEEE-RLH----
A0A5C5XXG1      -LNHDMAT-------IAERKSEL------------TALANQAETDARELIEY-ELTDVVL
A0A7C7YUM8      -LAAQVRG-------LSDHIVAV------------EHTITEHDQRLGRLPQS-QLALAQA
A0A7C2AHI6      -LESRLAG-------INDDIRSI------------DARIAGVQAELAQLPEE-QRRLADP
A0A518BJJ1      -LASRLDA-------VALENDEL------------GRYVAVLEERLGNLPEQ-QRRLASP
A0A518D182      -LASRREA-------LGRQYTEL------------DRVCADLEAQLGALPEK-ERLLAAP
A0A5C5WTY6      -LRNDLAS-------HLERKTEL------------QRLVELAEEQAREFVAF-ERSDRLL
A0A5C5Y033      -IEHDIAA-------IGERRKEL------------IALTTDAESKAKELIEF-ELKDLVL
A0A5C6G1Y2      -IEHDIAA-------IGERRKEL------------IALTTDAESKAKELIEY-ELKDLVL
A0A354PDV6      -LEHDLAT-------LTQRKREL------------TILAGNAESQAKTLIDY-ELQDMVL
A0A5C6FZ02      -LNHDMAT-------IAERKSEL------------TALANQAETDARELIEY-ELTDVVL
M5TIT3          -LQHDLAT-------LSERRKEL------------TFLAADAETKAKELIEY-ELTEMVL
A0A5M6CY44      -LQNDLAA-------LAERRKEL------------GFLTADAEKKAKELIEY-ELRDLVL
F2AXG2          -LQHDLAA-------LSERRKEL------------EYLADEAGKEAQTLITY-ELNDMML
M2BB46          -LNHDLAA-------LSERRKEL------------TYLADDAGTKAKELIEY-ELRDMML
L7CLQ6          -LNHDLAA-------LSERRKEL------------TYLAADAESKAKELIEY-ELNDMIL
A0A0J1B719      -LQHDLAA-------LSERRKEL------------TYLAADAETKAKELIEY-ELTDMIL
Q7UF18          -LNHDLAA-------LSERRKEL------------TYLAADAETKAKELIEY-ELTDMIL
A0A2G1W1E0      -LNHDLAA-------LSERRKEL------------TYLAADAETKAKELIEY-ELTDMIL
K5E235          -LNHDLAA-------LSERRKEL------------TYLAADAETKAKELIEY-ELTDMIL
A0A5C6FFI9      -LKNDIAE-------YEMREAIL------------VETSSEELQLAKDVENA-FLEGNAK
A0A5C5WDJ1      -LKNDISE-------FEMRKAVL------------LSESQKEMLLAKEVEAD-FMKAGAL
A0A5C5X547      -LRSRIKK-------IIEQEAEL------------EAMSSSLRDNFKLLGKT-SADVEML
A0A353FIP5      -VEARGVA-------LKKQIVSL------------DRAISRWQGQLDALPAV-ERKLAKF
A0A5B1CIK7      -LNHDLAT-------LGEQRKEL------------NFLAADAETKAKDLIEY-ELNDMVL
A0A5C5WHS2      -LNHDMSA-------LNEQRKEL------------TFLAADAEEKAKALIEY-ELKDLVL
A0A5C6B6G8      -VNHDIAA-------LGERRKEL------------IFLSEDAETKAKELIDY-ELQDMVM
A0A5C5ZZN3      -LQHDLAA-------LAERRKEL------------TFLASDAETKAKDLIEY-ELTDMIL
A0A5C5XS91      -LNHDLAT-------LTERRKEL------------TFLAADAERKAKELIEY-ELTDMVL
A0A5C6C4E6      -LNHDLAT-------LTERRKEL------------TYLSADAERKAKELIEF-ELTDMVL
A0A2E1VVJ1      -LASRLEG-------LRSQESTL------------LTALDEYDVRLDGLPRA-QRELIRL
A0A3M2AEL0      -VQDTLAA-------LEAQQVSL------------QDTISRLRENLEELPAT-ERQLARF
A0A2A2W9R6      -LKSDISE-------FAKRESEL------------LALSEQESKLAKEVELS-FLKGTAF
A0A518HKC1      -LKSDINE-------FAKRETEL------------LALSEQESKLAKEVELS-FLKGTAL
A0A518L3P0      -LKSDINE-------FARRESEL------------LALSQQESKLAKEVELS-FLKGTAL
A0A255R1S0      -LKGDIAG-------LKKREEEL------------VAQSEQEAKVAKEVELS-MLEGTSL
A0A5B9MKP1      -LKSDLNE-------FARREAEL------------LALSDQETKLAKQVELD-FLKGASL
A0A0S8J591      ---------------AQANYEFL------------SDMLLTNRQRLTQISRD-MLQLEGL
M5RT57          -LEARLET-------QLVLENLL------------GLRYKEMLGTAGESGNK-LLELEFA
A0A351FYP6      -LELRVNS-------SLAQVREL------------QKSVDDAKAKEAKVQEE-GREYFDA
A0A2E7ESJ6      -LKQKQIQ-------LKGQYESL------------TGLFNQEEDAAKELQIL-QAKDEQF
A0A2D5AWU0      -AEIAYNE-------AKNRETSL------------DLDVTSLQEELGKTNRA-LQQIDNY
A0A1G2YQB7      -YNDKLNQ-------LSKHEQQL------------RDMLKSEDSKTIELGRK-QLAMQDV
A0A353P687      -YKYKLEQ-------ISLHQQQL------------RDMLVHEDSKTIELGRK-QLAMQDV
A0A356EME5      -KKFEIES-------RRRMEEAL------------RERYEKELKKVAPGVAD-MVSIEFE
L0DC26          -LQHRISI-------LSKLEGAM------------EDDVKRLNGRTRSITQN-SVDLFSI
A0A3L7P4E4      -LHQQKKA-------GEERLLQL------------NSLFEEEQRIAKEQLDL-QIKDKRY
A0A3L7PEB5      -LQQQKKA-------GEERLLHL------------NQLFEEEKRIAKEQLDL-QIQDKRY
A0A1U9NL64      -ARERHMA-------AKKQLDEV------------STFFEEQRAAAMDLNDQ-LAQYTIL
A0A2N1UCJ3      -LEIEYDA-------AKQKEAEL------------SASYEQYKQESQSLNIK-ATEYAII
A0A7C4EK84      -VLHALQT-------ARARQQQI------------QQAFEQQQKEAMELNSK-AAVFATL
A0A7C3F0T2      -ASRRLEA-------LKEKEAQI------------RKSFESQRQEMVDLNAQ-VAQFTRL
A0A2E0X4J3      -VKSAYEL-------LEHKYAEL------------QRSYDRQFSEAKQVSAL-ALKLASL
A0A5C5YU10      -VKERFEF-------HTNKLNGL------------RSKYQDQFEAAKESSAN-SLKLFSL
A0A517MPZ6      -VSQEHQL-------LEQKREEL------------QRSYDKQFKLAMQVNSQ-AAKLTTL
A0A5C6CNV7      -MSQEYQL-------LEQKRAEL------------QRNYDSQFKLALQVNSQ-AAKLALL
A0A518K5H4      -LRQNYEL-------LAQRRDEL------------QKAYDKQFALATEVSQQ-AAKLADL
A0A5C6AA28      -LRQDYEL-------LTQRRDEL------------QRAYDKQFALATAVSQQ-AAKLDAL
A0A2E9VK20      -LEQQQAE-------LKNRIGEL------------QKLFDRSADQAKDFAQY-EEREQTL
A0A3D4PJK1      -LEQQQAE-------LKNRIGEL------------QKLFDRSADQAKDFAQY-EEREQTL
A0A532UT69      -AEQQYLN-------AREKENEI------------ARYYDEQRQQALSLNEQ-VAEYTML
A0A355AI52      -LNQRLES-------AERQEEWL------------QKSFERAKEESIGLTSD-ISQLDIV
A0A354PCQ3      -SRDQLVT----------KIAVL------------REQYDEELTRMEQFGGT-SAELQFA
A0A0S8GZ23      -READLTKAKVQLANYQAMESEY------------SRRLVEELEQNKDMGNV-QFEIRTR
A0A1I3DDV4      -LRHDLSA-------LDQRKREL------------LTLAAEAEKNSKSLIEF-ELKDKMI
A0A2E0SMM6      -AEQKLSQ-------LKGRYTAL------------KKSYDEEEEAGRESTLV-MSMIKQK
A0A3L7SI46      -VKQRLYQ-------AGAHEQAI------------REDFEIIRSQALSLNGQ-MAQIDIM
A0A356KTN1      -LRSERDE-------KVAVEQGL------------LERDRNLREESRVFARR-SRLYESL
A0A5B9PJZ8      -VAGQIAM-------ISAQEKSL------------EESILDEQRKAAQTSVN-IERLLAL
A0A2S8G191      -FKASVDKARSEVVLLEQMEKQL------------VDSVTTFEKEAKQFGRS-SIDVEMM
A0A2E7EGG1      -LKTQLET-------QKLIVQSM------------RSNYDAMVEDISQSGGQ-TLDLKFK
A0A2E2N5A9      -IQRNYQL-------AVANEQSQ------------QALFDSNKYQIQNLSSK-EFKVREL
A0A7C8AGA2      -LKIQLEQ-------TVQYEKRI------------REKLAKQDKDTIGLGRK-QFAIDDQ
A0A7C2FXP7      -ARIQLQQ-------TAAHEKRF------------DEILSKEDTETIELGRK-QLAIQEM
A0A2E3GWC6      -LTQQQAE-------MKNRLDEL------------QKLYDESTKQAKSFARF-ESQDQSY
F0SLB0          -LTQQQAE-------MKNRLDEL------------QKLYDQSTKQAKSFARF-ESQDQSY
A0A3L7NDH9      -LDQKVSA-------AVQHETWL------------TQSFEQAKQDSIGLASE-MARLDIA
A0A1N6DAJ8      ---------------LAKLETLL------------ASDVKRLSERSASITQN-SVDLFSV
A0A532UD06      -MQLRWLA-------AKQREDEL------------MTSFESQHQAARELSVK-AAQYAVL
A0A660URN1      -MRLRWTT-------AGQREDEL------------LASFDAERKAAQDLGVK-AAEYSVL
A0A517ZCB5      -ARHRYLM-------AANQEQQL------------LAEFERERDNALQLNQQ-LAEIQIA
A0A225EH48      -IKSDIEREKQFVTYKTTLTKKL------------GEEIKRLEKELELARGA-NVQGIID
A0A518INW8      -LKNDVKE-------LTKQLAQL------------TEEAKAVRVAAKEVESE-YLEGTAL
A0A518JPH9      -LNNDIKD-------LSKRQQHL------------MEEAATVRVAAKAAESE-FLEGTAL
A0A5C5VEK8      -IKERYEF-------QTNKLNEL------------RSRYQEQFEEAKESSAN-SLKLMSL
A0A532UTJ0      -ARSKLDE-------TTVIEESL------------RQAISEEDTETITVGRK-QLTIQEL
A0A432MFP3      RAEQRLLR-------LERERQLL------------QQKLDLIELADRSESVE-QLEISFA
A0A2E2CCW9      -MEQQLKE-------LENRELEL------------TKLFTQESELAKKVGNF-QVIDQSY
A0A3C0AGX3      -MEQQLKE-------LENRELEL------------TKLFTQESELAKKVGNF-QVIDQSY
A0A518AAQ5      -MEQQLKE-------LENRETEL------------TRLFNQETELAKKVGNY-QVVDQAY
A0A517QBG9      -MEQQLKE-------LENRETEL------------TRLFNQETELAKKVGNY-QVVDQAY
A0A518FTU3      -MEQQLKE-------LENRETEL------------TRLFNQEVELAKKVGNY-QVVDQAY
A0A517WHH5      -MEQQLKE-------LENRETEL------------TRLFDQETELAKKVGNY-QVVDQAY
A0A5A8BGT3      -MEQQLKE-------LENRETEL------------TRLFDQETELAKKVGNY-QVVDQAY
A0A2E7K7A9      -MEQQLKE-------LENRETAL------------TRLFDQETELAKKVGNY-QVVDQAY
A0A517PTS5      -MEQQLKE-------LENRETAL------------TRLFDQETELAKKVGNY-QVVDQAY
A0A6I6AH34      -MEQQLKE-------LENRETAL------------ARLFDQETDLAKKVGNY-QVVDQAY
A0A517VTK3      -MEQQLKE-------LHNREQEL------------TKLFDEETELAKKIGNY-QVVDQAY
A0A517WQT4      -MEQQLKE-------LHNREQEL------------TKLFDEETELAKKIGNY-QVVDQAY
A0A517VID8      -MEQQFKE-------LENRELEL------------TKIFDQETELAKKIGNF-QVVDQSY
A0A517RK10      -MEQQLKE-------LNNRETEL------------TKLFDQETALAKNVGNF-QVVDQSY
A0A518IH18      -MEQQLKE-------LNNRETEL------------TKLFEQETALAKKVGNF-QVVDQSY
A0A5C5XLF4      ALEQQQAE-------LKNRIGEL------------QKLFDRSADQAKDFAQY-EEREQTL
A0A2D5NDU9      -LDRRVAS-------IQAERQVL------------LPLLADAEREVLAVSEH-ELEYNQL
A0A1P8WP26      -TEQRLRM-------ARQQVAQI------------GQDIRAEKTQAMELSMT-LREIQDI
A0A3L7V1F3      -LRQQMES-------NQQNEDAI------------RAQLDTEKNKAQRLGQI-LADLARN
D5SZ21          -ARQRVQH-------SQQHEASV------------SAQFDIERQNALSLNGE-LAKLEIL
A0A286RGB6      -LDEEIENLNFELSILAQQQDQL------------QKEVENVRRSAETFGKG-SIEVEFL
A0A518CHE5      -AEQKLVQ-------YEERYRAL------------KESYLSEEEKGRESTLV-MLKIKQL
A0A1V5N3W2      -AKAELEQ-------IIVQENIL------------RDTLTKENADTIDLGRK-QLAIQEQ
A0A3E0MY27      -LQNSLTA-------TQEHLAKL------------QEQSKTLQQRINELTVF-KPELERR
A0A7C4Z5R7      -TQGKLREAEQFLALQEESEKLQ------------REDVQERKAALARLHEKPSAEWESL
A0A2E0X9P6      -KKQELQS-------LATRRVKL------------AERLEEQLAELKSGGAQ-SAQLEFA
A0A286RLF2      -LRQRVNE-------LWQKEMSL------------QAQYELARQEAANLAGG-LAQLEML
A0A517NSK8      -LENDLAG-------LQREREVL------------VRRSEAELVSAKKLEEE-EMMAESL
A0A5C5Z0D6      -LKNDLSG-------IQKRREVL------------IRRSGAELILAKELEQV-EMQTETM
M5UE94          -LKNDVMG-------LQRQRQVL------------QTRSEQELKLAKQLEQA-EVQAESM
A0A2E8FLY0      -ARQRLSY-------AQSRETAL------------RQDFERENRIVSSYEFQ-MSRIKLL
A0A3D2U1E1      -SAQKLRY-------AELREQAL------------RDDFNRESQVVSSFEAL-MGRIRLL
E8R3W3          -IERSLRE-------DYEWAELL------------QQDLQQQTRLLVTHNSN-SFKIEQI
A0A5C5ZM48      -IDLRLAA-------LDLQEDYL------------RKSLEAEQRKRRDNAGG-LLEVEFM
A0A5B9WF77      -LMQQIAV-------LKTKKDKL------------TELYKKFEVTQKDSHAD-TVQAAFL
A0A518BBX8      -LNQKLDY-------LKVAEDRL------------DELYKEEYDEARKIAAY-DIKDEAF
A0A1P8WN28      -IEAEVQA-------TRQYEQSL------------KHEYSVVEADALELSGK-LAGIQVA
A0A3B9CTT0      -LQAELNS-------IQQFESSL------------QEEYNEVRAEALNISNK-LASIDFK
A0A518ALT3      -KQQEITT-------LAKKLELL------------EIRRQEHVAELEKGGAR-SAELDIV
A0A3M1QRP3      -LRWELED-------LRAELTNL------------EAHIARKQKEFTSTFES-AGALSKA
A0A517TMV0      -LDQAWRQ-------AVQREQQI------------TESFAAARAEASKQSGD-LVRVEML
A0A3E0MY88      -MEQALAS-------AWHRENQL------------RAAFAEAKEDAVRLNRD-LHEIQFL
A0A5B9QF68      -LEQSVQQ-------AWQKEQQM------------SASFEEARQEAAKHSGD-LVQLRML
A0A5B9QGF0      -LEQSVEQ-------TWQKEQQM------------SASFEEARKEAARHSGD-LVQLHML
A0A5C6CK24      -LEQSVQQ-------TWQKEQQM------------SDSFEEARQEAAKHSGD-LVQLRML
A0A2E3RCU8      -AQQGLNK-------AKQKESIL------------HASLEEARFKAVTHQRD-TAHITML
A0A1C3E6N1      -ARQRVQH-------SQQHEASV------------SAQFDIERQNALSLNGE-LAKLEIL
A0A518GJT2      -ARQRVQH-------SQQHEASV------------STQFDIERQNALALNGE-LAKLEIL
A0A2E8B0L9      -VEERLSK-------TWELEADL------------EREYVAAEASAIRLNDR-HAELSIV
A0A5Q4GFE7      -VEEQLSN-------LREHEERL------------DLQYEQAESEAVMLNDR-MAEMKMI
A0A257WS34      -AQQRLLQ-------AQARENSL------------RLQFDQAHAAALAMNSQ-LAELERI
A0A7C4LP10      -AAQRYQQ-------AAAQEEAL------------RQQFDQAHAQALALNST-LAELQRL
A0A517MLW3      -VQQKLNE-------STQHEALL------------RKEYDTLEKEVVAMNGS-LSEMLLS
A0A5B9QVD0      -VVQKLDE-------AKQHEALL------------AAEYEALEKEVVAMNGN-LSEMLLT
A0A3A0DET7      -VRQQYEL-------LDQKRSEL------------QAAYDASFAAATQASSL-LVQLNSL
A0A3B8PNV4      -SRQRLRY-------AESREVAL------------RQDFERENRTVSSYEYQ-MSRIKLL
A0A3D1DR40      -SRQRLRY-------AESREVAL------------RQDFERENRTVSSYEYQ-MSRIKLL
A0A2E7RYU8      -SRQRLRY-------AESREAAL------------RQDFERENRTVSSYEYQ-MSRIKLL
A0A3B8LXG8      -SRQRLRY-------AESRETAL------------RQDFERENRTVSSYEYQ-MSRIKLL
A0A286RD13      QIQAEIAQAELEKAVLEDELKVA------------LEQFEKEAAEAEQLGKY-SADLEAE
A0A2E3GWX1      -AKQRYQH-------AMLNEQEI------------TTRFNHEKTLAADMNQR-LVLLQMA
F0SG60          -AKQRYQH-------AMLNEQEI------------TTRFNHEKTLAADMNQR-LVLLQMA
A0A2E9VST2      -AKQRYQH-------AVTLEQDI------------YQRFMQEKQVASQMNQR-LMMLQLA
A0A356A6X2      -AKQRYQH-------AVTHEQDI------------YQRFMQEKQLASQMNQR-LMLLQLA
A0A5C5XLM3      -AKQRYQH-------AVTHEQDI------------YQRFMQEKQLASQMNQR-LMLLQLA
A0A7C5FXU1      -LDDELAEHKFRMSVLLQQQQEL------------EKEVEAARREAEQFGVR-SLDVEMM
A0A3M1VCL4      -AIRRLMV-------ALEEERSL------------VEQFEQLKKQAIELNNR-HLQMEIL
A0A5C5V7Z9      -LEQSVAQ-------AIERERVL------------SSSFDEARIEAAKQSGE-LVELDMR
A0A5C5YT05      -LEQSVAQ-------AMEQERIL------------AESFEDARVNAARQSGD-LVELDMR
A0A518D7F9      -LQQSAQQ-------LARLETQL------------TDSFEAARAHALEQSSG-LIRLSML
A0A5C5ZIP0      -LNQALAQ-------AGERERQL------------DHSFELARDEAARQSGD-FVKLEML
A0A518KBK3      -LNQAMSQ-------SVERERQL------------EEAFQVARADAARQSGD-LVKVDML
A0A5C6AKF9      -LNQALAQ-------SNERERQL------------AEAFEVARSEASRQSGD-LVKLEML
A0A6M5Z0K7      ALEQRLRD-------CQDYANGL------------NAQITNLGIDAIEVENK-RNRIARA
A0A350CI62      -LSQQILK-------LELNEKAV------------GERLAAEQAKAQKLSQT-LTELGDL
A0A4P5WQK6      -LSQQILK-------LELNEKAV------------GERLAAEQAKAQKLSQT-LTELGDL
A0A3C1X4W5      -LNQQILK-------LELNEKAV------------SERLAAEQSRAQKLSQT-LTELGDL
A0A3D3W3A7      -LNQQILK-------LELNEKAV------------SERLAAEQSRAQKLSQT-LTELGDL
A0A518DRX3      -IAQRLAE-------TRANEKQL------------LVEYQSSEAEAVSLNDR-VAALQLV
A0A518DZF9      -IAQRLAE-------TRANEKQL------------LVEYQSSEAEAVSLNDR-VAALQLV
A0A518AKT8      -LRQSIAQ-------TLEQEKQK------------EAAFVAARTEAAKQSSQ-LVELRTC
A0A5C5ZR72      -KREELEM-------LSALEASV------------REKYEAELAKVQEGGGK-NVELEFA
A0A7C5R0U3      -VQERLTA-------AQVRESKL------------MESYQVAEREAAALQDR-WSEFQLV
A0A517TY85      -KEQELAA-------WIMKRKLL------------SEKLAAHVKERESGGAQ-SAELEFK
A0A5B9QEI7      -KQQELGL-------LSKKREML------------SAKLAEQMNELKSGGAQ-SAELEFA
F0SI78          -LQEELRT-------NQEKLKEL------------DNLFLSERTHSSNLTMD-ENRGRVL
A0A517MDV3      -IEKDLED-------VTQRIVFV------------KEEIAKEESDSVDLVDD-ELRDQEI
A0A518IQ30      -IREALAE-------TQANEQQL------------EHEYALAEAEAVKLNGR-MTSLQLV
A0A517LWP4      -ISEALTE-------TQANEEQL------------EREYAIAEAEAVKLNGR-MTSLQLV
A0A518JNW8      -IGEALAE-------TQANEEQL------------EREYAIAEAEAVTLNGR-MTSLQLV
A0A2E7ENQ5      -IQGKLNT-------AIVHEQNL------------EREFQIAQNQAVEVNGK-VARVAII
A0A7C2KUQ9      --EHRLKL-------LKYQESLK------------VADLEKEQELHRGTLTS-SQALERE
A0A7C5BZF0      -LMQKVNE-------ARSLELSL------------SQQYEEAQSEAVALTGT-LARIDIL
A0A1G3AQE9      -VHHKLAE-------AQWLEATL------------QEDFQQAQNRAMEIDGQ-VARLDNL
A0A3L7UQT9      -ARQRYQL-------AMSRQHTL------------QQQFDREKSEVANHNTL-MANLIIV
A0A4P5YBU2      -ARQRYQL-------AMSRQHTL------------QQQFDREKSEVANHNTL-MANLIIV
A0A7C7V5U8      -LQKKLEL-------TRRRESLL------------RRQCEDAQRAATHLTSR-LEEIRNL
                                                                            

A0A5S9IJB5      KKKY----------NALEETYLSVKQRLGQLELDKDSQGEEENIYIASPPRIPKTPIW--
A0A5S9IPR9      NAEV----------AALRDRYNDYREKMKEYDS-QRSYQFD-ILNPIDSAGIPGRPFS--
A0A533Q9U4      KREA----------DTNRQMYETLLTRMKETNL-TEDLKTS-NIKVLDHAEVPIKPIK--
A0A533Q6B7      KREA----------DTNRQMYETLLTRIKETNL-AEDFKVS-NIRVIDYAEVPLGPYK--
A0A1U9NNE1      QEQL----------ELTKELYDAINRKIQKIEMESQRPARV-SVAYYASSVIA-------
A0A2G2JCA2      QREL----------EELSDIHRMIESRILKIRT-EQRAPS--RVALLPEIPVPTVPIE--
A0A1G2XVR0      QREA----------DSERAFYDILLKRMKESNI-AGDLQTS-NVSILDPAMEPRTPIG--
A0A1G3B0P0      QREA----------DSERAFYDILLKRMKESNI-AGDLQTS-NVSILDPAMEPRTPIG--
A0A1E3X4X0      KREA----------DTNKDLYEILLTRLKEASM-TGALKTS-NIRILDAAVVPRHPIK--
A0A286U4B3      KREV----------DANTQLYEGLLQRMKQATV-SSQIKTT-NVQIVDRAALPTRPVK--
A0A5C6DDS2      KREV----------DANTLLYEGLLQRMKEAAV-SSEIKTT-NIQVVDKAVLPTTPIK--
A0A2E3GW02      REDL----------NRTKKLYDVVLEKLQEISL-VDETSVL-TATVVNHP-SDGSEVR--
A0A5B9QNZ7      RDEL----------YATKQLQLAVIDRLRQLNV-MQSYGGF-VTEILRAP-EFGELAW--
A0A1Z8N7H5      AQNV----------SRLRRLHDAIIDQIAGVDL-RQGHGEI-QATIIKDATASGQIVS--
A0A1G2YPI3      QSDW----------EQTKKDCDILNDRMKELSV-TEDVGAL-NISILEYARPADKPSK--
A0A1U7CZ81      KADI----------ETLVEQYKHISEKFENLKF-AGTTD-V-DVGLIDAAIAVSEPTN--
A0A142YNY8      QAEI----------DSMTHDQQIVHRRLEDLKF-RTDRDMV-RVSLYDRAAVPRVPSS--
A0A1U7GLS6      QNEI----------RVMVDDERVVNRKLQELEF-STNKDMV-RVEQHDPAVPPKRPSD--
A0A532UIN2      QSDW----------EQTRRLCDILDERIKELNV-TEDVGAL-NISILEVARAADKPSE--
A0A0S8KNX5      QDGL----------LLAKEMYDTVQRRIQDLEMQRKRPARI-SVAYYADI----ARVL--
A0A3D3UVZ8      QEGL----------ESTKEAYQIVLKRIQDLELQRKRPTRI-SVHYNADI----ASIN--
A0A517NFU9      KSKL----------TRAQSRYDEVILRLQELKL-SRSYAGF-STDLLESPEVSQSAAW--
A0A5C5YWH4      RARH----------SRAQMRYDEVIRRLQELNL-SRSYAGF-STDLLASPEVSRGAAW--
A0A3D2TNK4      ERAV----------ARDEAKSDILTDKIANIDF-RQNQAPI-RATVVREPIANNNPVT--
A0A7C1Y4F0      QSEL----------SRAERICEIVDNRIKELNVTAQDVESL-RISILEVARAADRPSK--
A0A6I0ENW6      DHEI----------EHITLKYEAVQKRVEEIQS-ELISGPA-RIEPAGQVKVSSRPKN--
A0A6L3A0B7      DHEI----------EHITLKYEAVQKRVEEIQS-ELISGPA-RIEPAGQVKVSSRPKN--
A0A0J1B4A0      KANL----------DRAQARYDEVFQRLHEINL-TNDYSGF-STDLIVMPLPASVPVW--
A0A142WSB9      KDEI----------AAKQKELESVRMQIADYNQ-SRSQEGY-KVSQLSQV-RIERSLK--
M5SZR3          QSNM----------EHTRQLYDGVVAQLQAASL-SRDYGGF-KANVISPP-GFSWKVK--
M5TW92          QSNM----------EHTRQLYDGVVAQLQAASL-SRDYGGF-KANVISPP-GFAWKVK--
A0A2S8FKY2      RSEI----------ASLDEILQQLNTEIERTNI-ELR-GAP-RITLLSEAKTGTVTDK--
A0A517N8P6      LRRI----------ARYQETLDLYDTQLEKANL-PGMNSGL-HVKVLRPA-GLGMLVG--
A0A432MJP4      RAQL----------DRQQRLFNTVVDQLKQAQL-VGEYSGV-VTQTIEPPHALRKAVR--
M5UQ35          KANL----------DRAQARYDEVFQRLQEINL-TNDYTGF-STDLLVTPSPAMLPVW--
A0A0S8FY64      ARKVHVYSRLERDAERQARVFDVIVDRMREVDL-TKDVGVT-NVSFVERASPPQAPVR--
A0A1N6KFT7      -GNL----------DRQKALYNTVLDQLKQAQL-VSDYSSI-SCQVIEPPSALPYPVQ--
L0DFG4          -GNL----------ERQKALYNTVLDQLKQAQL-VSDYSSI-SCQVVDPPSALPSPVQ--
A0A5C5XXG1      RKEV----------ERNEALFDGVVQQLRDVDI-ASGLRGY-LYELLETPRI-GAKSW--
A0A7C7YUM8      IRAQ----------ETHSEIVAFLLKSEQEAQI-TAAATSA-AAVLIDPAVPPRSRSF--
A0A7C2AHI6      LRRV----------AAYGEIVRFLLKSQQEAQL-SEAATLP-SAVLIDPAKPPRFRSS--
A0A518BJJ1      MRRL----------ETHKQIAAFLLTSLQEAEI-TRASTVA-AADFIDAAAAPDLRYS--
A0A518D182      LRRL----------ETHKELTALLLKSLQEAQI-ARASALS-SADFVDRAAAPDRRYA--
A0A5C5WTY6      QNEI----------DRQRALFDGVMERVVNMNS-AGDTASF-TQEILEDP-RVGELVW--
A0A5C5Y033      QKKI----------ARHEAIFDGIVGQLQELNT-ASGLSGF-LYEFLEVP-RLGKRVW--
A0A5C6G1Y2      QKKI----------ARHEAIFDGIVGQLQELNT-ASGLSGF-LYEFLEVP-RLGKRVW--
A0A354PDV6      RKKI----------ERQEKLFDGVVQQLRELDT-ASGLSGY-VYELLETP-RPGIRSW--
A0A5C6FZ02      RKEV----------ERNEALFDGVVQQLRDVDI-ASGLRGY-LYELLETP-RIGAKSW--
M5TIT3          QKKI----------LRQEALFDGVIQQLRDLDT-ASGLSGY-LYEFLEVP-RLGVKSR--
A0A5M6CY44      QKNI----------ERQEALFDGIVTQLRELDT-ASSLSGY-LYEFLEVP-RVGEPVW--
F2AXG2          RKAI----------ARQEALFDGVVKQLHDLDT-TSELTGY-LYEILSIP-RTGEKSW--
M2BB46          RKAI----------ERQEALFDGVVQQLQNLDT-TSELTGY-LYEILTIP-RTGEKSW--
L7CLQ6          QKKI----------AREEALFDGVVQQLRELDT-AKGLTGY-LYEFLAVP-RTGEKSW--
A0A0J1B719      QKKI----------GRQEALFEGVVQQLRALDT-ASGLTGY-LYEFLAVP-RTGEKSW--
Q7UF18          QKKI----------GRQEDLFEGVVQQLRELDT-ASGLTGY-LYEFLAVP-RTGEKSW--
A0A2G1W1E0      QKKI----------GRQEDLFEGVVQQLRELDT-ASGLTGY-LYEFLAVP-RIGQKSW--
K5E235          QKKI----------GRQEDLFEGVVQQLRELDT-ASGLTGY-LYEFLAVP-RIGQKSW--
A0A5C6FFI9      KAKV----------TRAQIRYDEVIRRLQELNL-AGSYAGF-STDLLSNPEPAKSPAW--
A0A5C5WDJ1      RAIR----------SRAQSRYDQVIERLQELEL-SRSYAGF-STDLLASAEVPMNPVW--
A0A5C5X547      RGDI----------ASLEQVVSNLAAELERTRV-ESKGQSK-RIEVMAYATRAQKDDP--
A0A353FIP5      QRKA----------NAYEQIYTYLLGKEQEARI-AAGAAVE-AISIVDWAVPPLLRAS--
A0A5B1CIK7      RKKI----------ERQEALFDGVVQQLRDLDT-ASGLSGY-LYEFLEVP-RLGEKSW--
A0A5C5WHS2      QKKI----------SRQEALFDGVVQQLRDLDT-ASGLSGY-LYEFLEVP-RLGKKSW--
A0A5C6B6G8      LKKI----------DRQEALFEGVVSQLRDLDT-ASGLSGY-LYEFLELP-RIGRKVW--
A0A5C5ZZN3      QKKI----------ARQEALFDGIVQQLRELDT-ASGLSGY-LYEFLEVP-RMGVKSW--
A0A5C5XS91      QKKI----------TRQEALFEGIVQQLRDLDT-ASGLSGY-LYEFLEVP-RRGEKSW--
A0A5C6C4E6      QKKI----------TRQEALFDSIVQQLRDLDT-ASGLSGY-LYEFLEVP-RRGEKSW--
A0A2E1VVJ1      QREA----------SSHEAVYLILMQRLQEAKI-AQAATIE-QVEIIDRALPPRLRAL--
A0A3M2AEL0      SRRA----------AAFEQIYTLLLTRLQEAQI-TEAASLA-TVDVIDWAIPPDSRSR--
A0A2A2W9R6      KANL----------DRAQARYDEVFKRLQELNL-TNDYSGF-STDLLVMPAPANFPVW--
A0A518HKC1      KANL----------DRAQARYDEVFKRLQELNL-TNDYSGF-STDLLVMPVPASLPVW--
A0A518L3P0      KANL----------DRAQARYDEVFKRLQELNL-TNDYSGF-STDLLVMPVPASLPVW--
A0A255R1S0      KANL----------ERAQARYDEVFKRLQELNL-TNDYSGF-ATDLLVQPVPARFPIW--
A0A5B9MKP1      KANL----------DRAQNRYDEVFKRLQELNL-TNDYSGF-STDLLVMPVPASVPIW--
A0A0S8J591      RKQQ----------ENIEEMRAVLDKAAETVKT-YRSYEDI-KARVISQADIPKGKFS--
M5RT57          RAEL----------EREERVFDLIAERSMALTT-ESRAPG--RIVLLQPAEPTLHPVA--
A0A351FYP6      KRKL----------SNTTRMRDTILFRIMQEEV-DLDLPKTSSVEIIDKADTPLRAVR--
A0A2E7ESJ6      QNEI----------ARTQQLFEVVVKSLEEISL-VSDYEGY-NYQTLAKPTVGDKVA---
A0A2D5AWU0      ESEF----------DSIRDFSEHLKSRLNELDV-ENQTGAL-NILVIDYGRPSNTPAS--
A0A1G2YQB7      KEQL----------DSSKQMLETIQKRVGELEM-ERK-----RLARISVAYLASTAPY--
A0A353P687      KEQL----------DNSKDMYSTIQKRIGELEM-ERK-----RLARISVAYLANTAPY--
A0A356EME5      QAEL----------TRATDVLNLIEQRVVELRT-ERQAPA--RVVLFDEATPPDAPLV--
L0DC26          QEEI----------ANADEVARTIGKEVEALTV-ELQAPP--RIRLLEKAELPHTKDE--
A0A3L7P4E4      RNDI----------ARSELTFNAIVSQFKDADL-AVKAGYH-RTQVLAPATR-GYQVE--
A0A3L7PEB5      RNDI----------ARSELAFNTIMTQLKDTDL-AIKGGNY-RTQVLAPATR-GVQVE--
A0A1U9NL64      ESEY----------QQSKKLNDILDERIKELNI-TEDVGAL-NISILEVARAPKDPSK--
A0A2N1UCJ3      ETKL----------EQSKRFCEILDDRIKELNV-SEEAGAL-NISILETARPAEFATS--
A0A7C4EK84      EAEV----------RRIEKLCDILDTRIKELNL-TGNTGAL-NISILETAQVPDRPVK--
A0A7C3F0T2      RSEW----------EQAKRACEAIDDRIRQINV-NEDTGLL-NITILEVATPAGAPSS--
A0A2E0X4J3      QEAI----------ERSESENELVDEQIKEVNL-TEKVGAT-KVNIMEVALPALEPSY--
A0A5C5YU10      EETY----------ARAISDSDEVEERIKELDL-NKKVGAM-NVSIIETASAPKLPTY--
A0A517MPZ6      ENSL----------ARTVRDVDRVDEQIKGINL-TEDVGAM-NVSIMEVARASSEPTY--
A0A5C6CNV7      EESL----------ARTARLTDILDERIKEVNL-IEDVGAM-NVSILEVAGPTTVPTY--
A0A518K5H4      QEAY----------EQTSEYCDTLNKQIREVNL-SENVGAM-NVSILEVATP-GIQTF--
A0A5C6AA28      QEAH----------DRTARMCDILDERIKEVNL-SEEVGAM-NVSILEVAGP-GMQTF--
A0A2E9VK20      SDEL----------KRIKSLHDIVANRVEVLSL-APDEGYQ-LTQISPSRAEPDI-----
A0A3D4PJK1      SDEL----------KRIKSLHDIVANRVEVLSL-APDEGYQ-LTQISPSRAEPDI-----
A0A532UT69      QSDW----------EQTKKLCDILNERIKELDV-TEETGAL-NISVLELARPANAPSE--
A0A355AI52      ETDL----------NWLRQLRNTLLNQIASVDI-RQENGGV-RTTVVREPVVAERPVS--
A0A354PCQ3      QEEL----------AVSNSVLMKLRDRVAAIRT-ERRQDG--AVRTLTLATPPSSPVTAL
A0A0S8GZ23      QAEM----------ARDQSEYNLVLERIDDIEI-KRQRPA--RITISDEASTGPP-----
A0A1I3DDV4      QAEM----------TRKQTLYDSIVEQLREMDT-AAGLSGY-IHEVLEEPQAGEEVW---
A0A2E0SMM6      ETDQ----------ERILHQHDTLLQKIREVDL-D-DRAEV-LAKIVKKPEISRDPIS--
A0A3L7SI46      EMDL----------KRMRLYYDLILEQMKKIDI-GADSG-L-KISVPTVAKVVPSAVA--
A0A356KTN1      KNEV----------DANRTFYEEFASRLKDLLH-AAPLAVA-NARIIDRAKGAWRVR---
A0A5B9PJZ8      QRER----------DRLELYSDNTIDKLGEVEV-LKDFKWR-KMSELNPASVAEQVA---
A0A2S8G191      RTEI----------DSLEGILSRLGHEIENTKI-EL-KSDS-RVTFFQDAQPPKSKN---
A0A2E7EGG1      QAEL----------NRKQQVFDSISERAAQIAT-EM-YAPS-RVELVQKATTPEVPVQ--
A0A2E2N5A9      ALEV----------EANRALYDTFLVRLKETAA-TADQNSV-NVHVVDRAMVPEEPVK--
A0A7C8AGA2      KAQL----------ARSQEMYDAVNKRIDEIQL-ERKRPAR-ISVAYQASSVPA------
A0A7C2FXP7      QEQL----------ALTKETYGAIRRRIQELNM-EKKRP----ARISVAYKAEVIPIT--
A0A2E3GWC6      KEDL----------QRIRSLHDVVTRRIEELSL-AHDEG-----YQLQQISPSQAELD--
F0SLB0          KEDL----------QRIRSLHDVVTRRIEELSL-AHDEG-----YQLQQISPSQAELD--
A0A3L7NDH9      DHDL----------RWLRELRNTILNQIASVDL-RQEHGGV-KMSVVREPLVPSKPVS--
A0A1N6DAJ8      QEEI----------ANADEIARTIGKEVEALTV-ELQAPP--RIRLLEKAELPRTKDE--
A0A532UD06      QSEL----------NRAERICEILDNRIKELNV-TEDTGAL-NISVLEVARPARNPSE--
A0A660URN1      QSEL----------KRTERLCDILDNRIKELNV-TEDVGAL-NISILEVAYPAIHPSR--
A0A517ZCB5      ELEI----------QRMRTYDDVLLDAITNIDL-NKDNH-L-RTAVISEPQVNPVPVS--
A0A225EH48      LGDL----------GPLKEQRAAMEKERLDLDL--LDRSDS-RIQLRQPAVVSQLLNI--
A0A518INW8      KAKM----------TRAQQRYDVVMERLQELEL-TSDYAGY-TIDLLSPPGPGSLVW---
A0A518JPH9      KAKM----------TRAQQRYDVIMGRLQELEL-TSDYAGF-TIDLLSPPGVGGQIW---
A0A5C5VEK8      QEAY----------ERAVSQADVVEQRIKELDL-TT-QAPV-NVSIIETASVAPDPSY--
A0A532UTJ0      QETL----------EFNKETYASVVRRIQDLEL-QRDRPK--RISVYYHADVANI-----
A0A432MFP3      MTKL----------KQYQAMEQQVQRRLEVLRF-ESRPAD--TITVIDPATPGLMLSN--
A0A2E2CCW9      NEEI----------AQLKSQRDNIFKQLLVERV-SQGNSGY-MLTQLAPVKDELVI----
A0A3C0AGX3      NEEI----------AQLKSQRDNIFKQLLVERV-SQGNSGY-MLTQLAPVKDELVI----
A0A518AAQ5      NEEI----------AQLKSQRESIFKQLLLEKV-AKGNSGY-TMTQLSPVKDELVI----
A0A517QBG9      NEEI----------AQLKSQRESIFKQLLLEKV-AKGNSGY-TMTQLSPVKDELVI----
A0A518FTU3      NEEI----------AQLKSQRESIFKQLLLEKV-AKGNSGY-TMTQLSPVKDELVI----
A0A517WHH5      NEEI----------AQLKSQRESIFKQLLLEKV-AKGNSGY-TMTQLSPVKDELVI----
A0A5A8BGT3      NEEI----------AQLKSQRESIFKQLLLEKV-AKGNSGY-TMTQLSPVKDELVI----
A0A2E7K7A9      NEEI----------AQLKTQRESIFKQLLLEKV-AQGNSGY-TMTQLSPVKDELVI----
A0A517PTS5      NEEI----------AQLKTQRESIFKQLLLEKV-AQGNSGY-TMTQLSPVKDELVI----
A0A6I6AH34      NEEI----------AQLKTQRESIFKQLLLEKV-AQGNSGY-TMTQLSPVKDELVI----
A0A517VTK3      NEEI----------AQLKSQRDNIFKQLLVEKV-SQGNSGY-TLTQLSPVKDVLVI----
A0A517WQT4      NEEI----------AQLKSQRDNIFKQLLVEKV-SQGNSGY-TLTQLSPVKDVLVI----
A0A517VID8      NEEI----------SQLKSQRDNIFKQLLVERV-SQGNSGY-ILTQLAPVKDELVI----
A0A517RK10      NEEI----------AQLKSQREDIFKQLLLEKV-SQGDAGY-TLTQLAPVKDELVI----
A0A518IH18      NEEI----------AQLKTQREEIFKQLLVEKV-SQGDGGY-TLTQLAPVKDELVI----
A0A5C5XLF4      SDEL----------KRIKSLHDIVANRVEVLSL-ASDEGYQ-LTQISPSRAEPDI-----
A0A2D5NDU9      NSRA----------ERTKQTLDNAYAQLQRINI-DPDSGKT-VAHVLDYAEPNEAKLA--
A0A1P8WP26      NREI----------ERRHEYRASLTDKMDLIDL-TGDTF-I-RTEISSPPRVNQLPVS--
A0A3L7V1F3      EREN----------LRLSERIQEYQNQVDGIGI-NKDKM-V-ITSIPRKPTLSTRPVN--
D5SZ21          QMDT----------KRLRAFYDLVLERIRGIDL-GKDKG-I-RTAVVGEPKVNPRPVH--
A0A286RGB6      RAEV----------ELARKTLQTIAEERNRLAI-ELRAKP--RITVVQRAEVPRVADS--
A0A518CHE5      ETHQ----------TRIMAQHDTLLQKIREVDL-D-DRASV-LAKTVKKPEISRYPIS--
A0A1V5N3W2      QDQL----------ALNQELYETIRRRIQELEV-ERKRPAR-ISVAYNASSLPL------
A0A3E0MY27      KDEL----------ERLESVSNELGLRLQKLQL-ELSVQKP-KVSLRGEATVPAMYDS--
A0A7C4Z5R7      RGEV----------ARAETSLQRVGAEMQALKM-EP-PLPA-RVNLMEKAEPPQTNSR--
A0A2E0X9P6      KAEL----------AREEKVFELIAARKLALQT-ELDAPD--RITLKQSAAVPARPLN--
A0A286RLF2      KNDI----------TGLRELYGGLVRRITSLDL----AGDL-RASVITEPRENRSPVS--
A0A517NSK8      KLEL----------VRKQALYEKMSDTLSELNF-VRDYAGF-DTDVIGDADIQEQSSW--
A0A5C5Z0D6      RREV----------LRRQELFKDTQDTLKELNF-VRDYAGF-STDVIGDAETQRRPSW--
M5UE94          RRDL----------ERRQAIFDDTQSTLKELNF-VRDYAGF-STDVIGDAESQERPAW--
A0A2E8FLY0      NFDL----------ARKRELAVALIDQINRTDL-GKERGGL-RTKIVSQPKAAKSPVT--
A0A3D2U1E1      NFDL----------ARKRELAIALATRISRTDL-GKERGGL-RTKIVSQPKVAKAPVS--
E8R3W3          KEEL----------NTADRISELLSNRIEEMRV-ELDAPP--RITLINPADAVRIVGD--
A0A5C5ZM48      RAEL----------TLAEEMQQEVASRITRMQV-ESQAID--RVELLREGEIEQTPVV--
A0A5B9WF77      NTEL----------ANLTTAGQQIERRLLQLKF-TQDKSAV-TIPRIDRAKAPRDSFNN-
A0A518BBX8      RKEI----------DQTQQLYDSIITRLQDAGL-VTQSGGY-EAKIIAPPELGEQVW---
A0A1P8WN28      EREV----------ETLRELHSSLLKRLNSINP-DHGSGAF-KVAPLSDPRIPKFAVY--
A0A3B9CTT0      EREI----------ESLTELRSSLLNRLNSIKI-SENATHF-KVAVLSDAMVPRTPSL--
A0A518ALT3      KSEL----------EREQNVFELISARKLALET-ER-GAPT-RASLMHTASPPRLSIE--
A0A3M1QRP3      LREL----------QTMREQYEQIRRTRQQQEI-ERFAPAS-IRKIADARPSGAADVDKR
A0A517TMV0      QREI----------NRIEEHNKLSYEKMQSIDL-QQVSAPI-QTTIVEEPLPSERPAS--
A0A3E0MY88      EREI----------GQLSNLYGALADRIASVDL-AKDQGDI-RSEIIKEPAASRVPVS--
A0A5B9QF68      EREV----------TRLEAQYDLLFEKISTVNM-RQMQAPI-QATVVREPVPDRVPVS--
A0A5B9QGF0      EREV----------TRLEAQYDLLFEKISTVDM-RQMQAPI-QATVVREPVPDRVPVS--
A0A5C6CK24      EREV----------TRLEAQYDLLFEKISTVDM-RQMQAPI-QATVVREPVPDRVPVS--
A0A2E3RCU8      EQNV----------MRLRRLHDAIIDQIASVDL-RHGEGEI-RATIIKEAAASGQIVS--
A0A1C3E6N1      QMDT----------KRLRAFYDLVLERIRGIDL-GKDKG-I-RTAVVGEPKVNPRPVH--
A0A518GJT2      QMDT----------KRLRAFYDLVLERIRGIDL-GKDKG-I-RTAVVGEPKVNPRPVH--
A0A2E8B0L9      ESQV----------QRLSNVHDMLLDRIANVDL-NSEGGDV-RVSMVNEPKANERPVS--
A0A5Q4GFE7      EHDL----------ARMRNLHDTLLNRIANIDI-GHSRSDV-RVAVVSEPKASDRPVS--
A0A257WS34      ESDV----------KRMRTYYDHVLDRIKDIDL-GADDG-L-RIRVVSEPRVNEQPVS--
A0A7C4LP10      ENEV----------SRIRKYYDTILDQMKNVDF-GADNS-L-RVRIVSEPKVLLFPVS--
A0A517MLW3      QREV----------DRLSRAYDALLEKIHGVDL-GQDQAAV-RVAVIGKPKALIAAVS--
A0A5B9QVD0      QREV----------ERLNRSYDTLLEKIHGVDL-GSDQAAV-RVAVIGDPKAGMGAVA--
A0A3A0DET7      QEAY----------ERTANMCDILDERIKEVNL-TEEFGAM-NVSILEVAGPATIPSY--
A0A3B8PNV4      NFDL----------ARKRELSVALIDQINRTDL-GKERGGL-RTKIVSHPKAAKLPVT--
A0A3D1DR40      NFDL----------ARKRELSVALIDQINRTDL-GKERGGL-RTKIVSHPKAAKLPVT--
A0A2E7RYU8      NFDL----------ARKRELSVALIDQINRTDL-GKERGGL-RTKIVSHPKAAKLPVT--
A0A3B8LXG8      NFDL----------ARKRELSVALIDQINRTDL-GKERGGL-RTKIVSHPKAAKLPVT--
A0A286RD13      RAEV----------ERLKAIAARMGDELERWNI-ELAAPPR-VRVLEEASTPRISNIN--
A0A2E3GWX1      ERDL----------ARLQSDYDMLRERINALDL-NQ-QTSL-RTRITKHAEPNPAPVS--
F0SG60          ERDL----------ARLQSDYDMLRERINALDL-NQ-QTSL-RTRITKHAEPNPAPVS--
A0A2E9VST2      ERDL----------SRLQNDYDMMRDRINTIDL-NK-QSSL-RTRITKHAEPNRIPVT--
A0A356A6X2      ERDL----------SRLQSDYDMMRDRINTIDL-NK-QSSL-RTRITKHAEPNRTPVT--
A0A5C5XLM3      ERDL----------SRLQSDYDMMRDRINTIDL-NK-QSSL-RTRITKHAEPNRTPVT--
A0A7C5FXU1      RAEA----------RVLENLLQRIGDERQKLAI-ELRSRP--RITLIQRATPPAVPDQ--
A0A3M1VCL4      SLEL----------NRLRSLNDLFLERIKELDL-GSDSGAL-KTEVVSHPKVVPQPVS--
A0A5C5V7Z9      SREV----------ERLESLHDVLFEKIAAVDI-HQVQAPI-RASIVEEPLPEETPVS--
A0A5C5YT05      KREV----------ERLESLHDVLFEKIAAVDI-HQVQAPI-RASIVEEPLPEETPVS--
A0A518D7F9      ERDV----------ARLEKLHDVLFEKLETVDT-HQLQAPV-RVTVIEEAMPNERPVS--
A0A5C5ZIP0      SREV----------ERLEKLHDLLFNKIATVDI-RQVQAPI-RATIVQEPLPSDRPSS--
A0A518KBK3      DREV----------ERLEKLHDLLFEKIATVDI-HQVQAPI-RATIVEEPLPSDLPAS--
A0A5C6AKF9      NRDV----------ARLEKQYDAVCDKISAIDM-TQVQAPI-RATIVQEPLPADRPAS--
A0A6M5Z0K7      EQFL----------GMIWEQKERLTLEIQGDKT-TKSIARK-RVREVAPAEKGEILNK--
A0A350CI62      DRQI----------EHLYDQQKSLQSQSDGIGL-NKDTF-L-STKVSSRPTVPIRPVS--
A0A4P5WQK6      DRQI----------EHLYEQQKSLQSQSDGIGL-NKDTF-L-STKVSSRPTVPIRPVS--
A0A3C1X4W5      DRQI----------EHLYEQQSSLQSQSDGIGL-NKDTF-L-STKVSSRPTVPIRPVS--
A0A3D3W3A7      DRQI----------EHLYEQQSSLQSQSDGIGL-NKDTF-L-STKVSSRPTVPIRPVS--
A0A518DRX3      DNEV----------QRLRRLHETLLNQISKIDI-NQNQSDV-RVAVVGEPLANENPVS--
A0A518DZF9      DNEV----------QRLRRLHETLLNQISKIDI-NQNQSDV-RVAVVGEPLANENPVS--
A0A518AKT8      ERDL----------VRLENLHDSLIDRLDSADI-YQSQGPI-QAVVVEDPLPELKPVS--
A0A5C5ZR72      KSEL----------AREAKVFEMIASRKLALQ--TESKAPA-RVEVMDEVMSSNVPEE--
A0A7C5R0U3      QHDL----------ELLRKLHDTLVNRLAQLDL-TREQADV-RLAVVNPPVVPREPVS--
A0A517TY85      KSEL----------EREESVFELIAARKLALQ--TEQRAPE-RVFLMQVAEPPSMALE--
A0A5B9QEI7      KAEL----------EREESVFELIAARKLALQ--TEQRAPT-RVTLMQSASPPHIAIE--
F0SI78          REDL----------NRTKKLYDVVLEKLQEISL-VDETSVL-TATVVNHPSDGSEVRL--
A0A517MDV3      RDEL----------FATKQLQLAVIDRLRQLNV-MQGYGGF-VTEILRAPEFGEL-VW--
A0A518IQ30      ENEL----------QRLRNWHDTLLNQIANIDL-QTEGGDI-RVSVVGEPVASPNAVA--
A0A517LWP4      ENEL----------QRLRNWHDTLLNQIANIDL-QTEGGDI-RVSVVGEPVASPGAVA--
A0A518JNW8      ENEL----------QRLRNWHDTLLNQIANIDL-QTEGGDI-RVSVVGEPVASPGAVA--
A0A2E7ENQ5      EHDL----------RMLRELHDTLRNRIANLDI-RQDQAEV-RMAVVSEATASDSPVH--
A0A7C2KUQ9      MAEV----------SRKQGLYESAVQRLSELDI-EGRAPG--RINVQSYADEPSEPYN--
A0A7C5BZF0      AREV----------EWLRNLRQALLQRITDIDL-QQKGREV-RAFVISEPKMNPTPVS--
A0A1G3AQE9      DREV----------ERLRRLHDVLCDRINDLDL-SREGQQI-CATLLDEPRVNRTPVS--
A0A3L7UQT9      EMER----------NRLQANDESLLKQIEKLQL-V-SGEGI-KVDLNKLPKAGKLPSS--
A0A4P5YBU2      EMER----------NRLQANDESLLKQIEKLQL-V-SGEGI-KVDLNKLPKAGKLPSS--
A0A7C7V5U8      QRQM----------DQLWAQQDWLLQQIEDIRL-KREGADM-RAVVVTEPERIDQPVS--
                                                                            

A0A5S9IJB5      PKTLYILVGAFLFS-CFSGLGLCFALEFLDNSVKGKDQLEKMMQRPVLGLIAEGKKNKKS
A0A5S9IPR9      PNRTQNYLVGTFLG-VMLGVIFVFLIEFLDQSIKTVEEVQQLTPARIMGFIPFISPKIFM
A0A533Q9U4      PKKALNILLGIIAG-LGCGVGIAFVMEYMDNTIRTQEDVEKYLKTSLLGIVGHIPLDKKD
A0A533Q6B7      PNKSINTLVGIITG-LACGVGIAFLMEYMDKTIKTQEDVKKYFGTVLLGIVGHIPQKKKD
A0A1U9NNE1      KDKRQKLAIVAVLGSICCGGFLGVMIDRSDKRMRTPTDLNKSLSTRIIGTTVCPTEVKRS
A0A2G2JCA2      KLPYKNMLMIFMVG-LAAPFGLAVLKEALTVKVSGREQLELQSNTPVLAEISQLPK----
A0A1G2XVR0      ASRNSQIMKGVMIG-LALGIGLAFFLDYLDNTVKSTEDVENYLGVTLLGLVERAKQSK--
A0A1G3B0P0      ASRNSQIMKGVMIG-LALGIGLAFFLDYLDNTVKSTEDVENYLGVTLLGLVERAKQSK--
A0A1E3X4X0      PRVKLNIILAIIVG-LTLGVGLAFFLDYLDRTLSTPEDVERYLQVPLLGAVGRIEMDKQK
A0A286U4B3      PKKRLNVFLSMVVG-LVMGTGIAFFLEYLDNTIKSADDVEKHLNATVLGVLEKVEVER--
A0A5C6DDS2      PKKKLNVLLSMIVG-LTLGTGIAFFLEYLDNTIKSADDVEKHLKSTVLGVLEKVAVDK--
A0A2E3GW02      LKVFNYAGMGGMGG-LAIGMLVGLLLEYSDKRFRSPEEMMQMLGVPILGHIPEMPASQKR
A0A5B9QNZ7      PILPLVLAAGLCFG-SLLGGGLALLVDLGDRSFRSTADIETATGAPMLGAIGAMKFRR--
A0A1Z8N7H5      PKISRIIVCWILGT-LGIGFVLVYVQDTIDDRFRTPEELSKRVGQPLIGLVRAL------
A0A1G2YPI3      PEKAKYMAMALVMG-LMLGGGLGLLRDFMDQTLHSAEDISAVLSMPVLGVVPSMSRRESV
A0A1U7CZ81      NKRIKYVVIVPSVI-LCLVLGLFALLEVKAERVADPDALSTRVQSEVFSLPPLPMVRASN
A0A142YNY8      SKRIKLMAAAPMGI-MALVLGIFSLLEVKAERVGDPDQLSTRVQSEVYSLPPIPMSRSPR
A0A1U7GLS6      DKRLKLMAAVPVGV-LAVLIGLFSLLEIKAERVGNPDALSTRVQSEVYSLPPIPMARSPR
A0A532UIN2      PEKAACLAKALIMG-FMLGIGLALLRDWMDHRLHSAEEISAVLNLPILGVVPSMPR----
A0A0S8KNX5      DKRVKYSAALVFTA-LVCGMGLAHLRDKADQSLRTPDDVAKRIGIRIIGTTTSLHTVKPA
A0A3D3UVZ8      DKRVKYSVALVFGS-LVCGMGLAYLRDKADQSLRTPDDVAKRIGIRIIGTTTSLNTVKPA
A0A517NFU9      PKLPIIAAIGLFLG-MTLGLLLAVGSELMDSTFSDVADLERTVGAPAIAHVPRFNLRKLR
A0A5C5YWH4      PKLPIICALGLFLG-AMLGLALAITTELLDSTFSDVHDLERTLGAPAIAHVPRFNTRDLK
A0A3D2TNK4      PQIRLIAAVCLLGG-TCVGVVMAYAQDVLADRFNSPEELTLQLGVPVLAMVKKL------
A0A7C1Y4F0      PQKAKVMAMALALG-LLMGGGLAFLRDWLDFRLRSSEEVSAILGIPVLGVVPKMGASKVL
A0A6I0ENW6      DRRPLFSGVLVFGW-LAAGLALAYFRAAMDPSMSEVSDVTNTVQVPFLGQMPRFAPG---
A0A6L3A0B7      DRRPLFSGVLVFGW-LAAGLALAYFRAAMDPSMSEVSDVTNTVQVPFLGQMPRFAPG---
A0A0J1B4A0      PSRTKIAALGILAG-GMLGLALALLAEMTDRTFHDPAEVERIVGASILAHVPRLKESALK
A0A142WSB9      QVLKVFGACGLL-G-LISVFALAYVREWYDTSVRSVDEVRQLTGAHVLGIVPHFQKRNQN
M5SZR3          PEALIVFPMAIFVG-TFFGFGLACLAELANRTFRTSDEISKHLMLPVIGRIALARVSAKP
M5TW92          PEALIVFPMAIFVG-TFFGFGLACLAELANRTFRTSDEISKHLMLPVIGRIALARLSAKP
A0A2S8FKY2      KKPIMITAAAALAG-FVLPGGLLLLRDFRKKHLSDLPTTRDELGLELLGTIPRLPRGIVR
A0A517N8P6      PLLSRALVMGGFLG-LVAGGALAFLWDWSERTFRSPDEISTLLGLPILAHLPVILTPSKR
A0A432MJP4      PRVLLTLCMALMSG-LVLGTMAALAADGLDSRVRSLDEVRSMLGSRILGVIPRLSKAEL-
M5UQ35          PAKSKIAAIGILLG-AMLGAALAMIAELLDRTFKNPEEVERVVGAPILAHLPLLKTSKLK
A0A0S8FY64      PNKQVNLILGALLG-VLLGVGLAYGLEYLDDTVKTPDDVERRLNMPWLGYVPQMHSDGSR
A0A1N6KFT7      PRVKMTLLMGLMTG-LFLGIGLAYLADRLDPRIRTLDEVRKVLEFRLIGTIPKLLVDQLT
L0DFG4          PRVRMTLALGLMGG-LLLGMGLALLVDRLDPRIRTLDEVRKVLNFALIGTIPKLRSDQIS
A0A5C5XXG1      PSLPLCGLGGLMLG-VFAGLTLAVANDVRDGRFRSAAEVEETVSLPSLGRVGKLNSMRRG
A0A7C7YUM8      PRAAIFLVLGAVLG-LFLGCALAFLSHTLRSALHSEAEVEQATGLPVLGSIPDFERGRTR
A0A7C2AHI6      PRLVLSLIVASILG-LAAGLLLAFLRQNLAGCMYSAAELEEASSLPVFGAIPDFRRGRLR
A0A518BJJ1      PRIGFTLMLSSVLG-LGLGLGLAWLRESLRRSLQGPSELEAVTGLPVLTTVPDFKHGKHR
A0A518D182      PRIGFTLGLGLVAG-VLAGLALLLVREHLAESLESEGELERITGLPVLASVPDFKDGG-R
A0A5C5WTY6      PKPLLCLALGLLGG-VLVGSGVGVSREFMDQRFASVEQFETALGLQAFGVIDDL------
A0A5C5Y033      PNVPLCSLGGLVLG-LLCGMVLAVGNELRDSRFRTAQEVDEAIGLLNLGHVGQM------
A0A5C6G1Y2      PNVPLCSLGGLVLG-LLCGMVLAVGNELRDSRFRTAQEVDEAIGLLNLGHVGQM------
A0A354PDV6      PKLSICALGGLMLG-LFGGLFLSIANDLRDSRFHSAVEFEQFIGLRTLGRIGKV------
A0A5C6FZ02      PSLPLCGLGGLMLG-VFAGLTLAVANDVRDGRFRSAAEVEETVSLPSLGRVGKL------
M5TIT3          PKKSLCALGGLMLG-LFMGLSLAVANEIQDGRFRSSAELDEAIGLPRLGSVGKL------
A0A5M6CY44      PKLPLCAVGGLALG-LCGGLALAFGTDVRDRRFRSAAELDEMIGLPNLGRVGKM------
F2AXG2          PKLPLCGLGGLMLG-LFSGLFLAVANDVRDGRFRSAAELDEAIGLPSLGRVGKL------
M2BB46          PKLPLCGLGGLMLG-LFSGLFLAVANDVRDGRFRSAAELDEAIGLPSLGRVGKL------
L7CLQ6          PKLPLCGLGGLMLG-LFSGLFLAVANDVRDGRFRSAAELDEAIGLPSLGRVGKL------
A0A0J1B719      PKLPLCGLGGLMLG-LFSGLFLAVANDVRDGRFRSAAELDDAIGLPSLGRVGKL------
Q7UF18          PKLPLCGLGGLMLG-LFSGLFLAVANDVRDGRFRSAAELDEAIGLPSLGRVGKL------
A0A2G1W1E0      PKLPLCGLGGLMLG-LFSGLFLAVANDVRDGRFRSAAELDDAIGLPSLGRVGKL------
K5E235          PKLPLCGLGGLMLG-LFSGLFLAVANDVRDGRFRSAAELDDAIGLPSLGRVGKL------
A0A5C6FFI9      PRLPIVLVLGSFLG-FFLGIATGISAELLDTTFRDVEDLETTLQASAIAHVPLFNLRKLP
A0A5C5WDJ1      PRLSIVLAIGLVNG-AILGLILVVAAETLDSTFSSVEELEGTTGAAVIAHVPRMALRDLR
A0A5C5X547      KKQIALTIGVGLAG-LFAPLILLMWRDITKQHVDDLKTMRLAIGLEHMGGIPRLPMKQLS
A0A353FIP5      PRLTLSSLAGILLG-LFLGSFFALWRESSQKKIRSTAQMEAVTGLTQWASIPDFRHGANK
A0A5B1CIK7      PKLPICGLGGLMLG-TFGGLFFAVANEFRDRRFRSAAELDEAIGLPNLGMVGKL------
A0A5C5WHS2      PKLPICGLGGLMLG-LFSGLVLAVANEVRDRRFRSASELDEAIGLPNLGMVAKL------
A0A5C6B6G8      PSLPICGLGGLMLG-LATGVFLAFANEIRDGRFRTAAELDEAIGLPSLGRVGKL------
A0A5C5ZZN3      PKLPLCALGGLMLG-LFGGLFVAVANDVRDGRFRSSAELDEAIGLLSLGRVGKL------
A0A5C5XS91      PKLSLCGLGGLMLG-LFSGLFLAVANDLRDGRFRSAAELDEAIGLTSLGRVGKL------
A0A5C6C4E6      PKMSLCGLGGLMLG-MFSGLFLAVANDLRDGRFRSAAELDEAIGLTSLGRVGKL------
A0A2E1VVJ1      PNVRANLVVGILLG-LAIGSILALARESFTRRIRSAAQLEATTQLPVLGTIPDFRRGLAR
A0A3M2AEL0      PILAMNTALGLLLG-LVAAFALGLYREGRVRKILSIAQLETATGLPQVGVIPDFRRGGTR
A0A2A2W9R6      PSKSKIAIMGVMGG-IMLGLGLAMLAELADRTFRNPGEVESVVGAPILAHMPMLRESRLQ
A0A518HKC1      PAKSKIAMMGIMGG-IMLGLGLAMLAELADRTFRNPEEVESVVGAPILAHMPMLRESKLQ
A0A518L3P0      PAKSKIAMMGIMGG-IMLGLGLAMLAELADRTFRNPEEVESVVGAPILAHMPMLPESKLQ
A0A255R1S0      PSKSKIAMAGLMAG-GMLGLALAVLAELIDRTFKNPGEVEKAAGASIIAHLPQMVESKLA
A0A5B9MKP1      PSKSKIAMMGIMGG-LMLGLGLAMLAELADRTFKDPGEVESVVGAPILAHMPMLRESKLQ
A0A0S8J591      PNPALNLPLGLVVG-LMVGIIAAFFFEYLNTTIRMPRDIEDGLGLPVLGFVPAMSPKFKD
M5RT57          SFPLRNMAIAAFLS-GCLPFGLALLWELSTKPISDVDQLTSNTTQTTVSEVAKLPVRTIS
A0A351FYP6      PNVPLNISLGVIVG-LILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIPQNVGSLMD
A0A2E7ESJ6      PLLLKVMPIAALFG-VVVGFGIAYLVDVADKAFRTPDEVASLMRLPVIGHVPLIDPEKIP
A0A2D5AWU0      PDRVSMMAYALAGGVGL-AFAIVMLRSFSDKKMRIIGELPHVLNVNVVGVMPRLKGPRS-
A0A1G2YQB7      QDRRMQFSIALMMAGCVSGMGLALLTNKLDVRLKTPDDM-KRIGVRIIGT----------
A0A353P687      QDRRMQYSLAITMGSLVFGLGLALITNKLDLRLKTPDDITKRIGVRIIGT----------
A0A356EME5      EIPLAKMGLAAMVAFCV-PFGLALGWERIVRRISGAEDLEHETNLAVIGEIARLPERSTK
L0DC26          IRQIKMAGMAGCGAFAL-TLLGISLWETRARRIDSAADVIQCLGMNLFGTLPILPRRSR-
A0A3L7P4E4      PNFQKCIIVGSVAGIAV-GLLLGLLVEAADKSFRSPDDISQTLRLPIVGISPQIQLGRRD
A0A3L7PEB5      PNFQKTMIMGSALGVLV-GLLLGFLVEAADKSFRSPDDISQTLRLPIVGISPQIQLGRRD
A0A1U9NL64      PQKARVAAMALVLGLMA-GGGLALLRDFMDKRIRGAEEITALLGLPVLGVIPLMSKRKS-
A0A2N1UCJ3      PKKAPTLAASLILGLLF-GLALAITRERLDWRLRSAEEISMVLATPVLGIVPSMSDKGKK
A0A7C4EK84      PHKSRVAGMALVLGLML-GIAAALAVEWTDQRLRTPEDVRSVLDLRVVGSVPRMSAKLA-
A0A7C3F0T2      PNRQRTMAMALLVGLMV-GIGLAVALDWMDQRIHSADDVTNTLGLPILGMIPQMSAKQE-
A0A2E0X4J3      PSRPKFLAAGVMLGSLM-GFGLGWLRNLLDHRLKSADEIGEALQLPLVGAIPLAPGVKN-
A0A5C5YU10      PSRAKFLGAGVMLGALS-GFGLAWLRDMLDHRLKSVDEIQELLQLQVFGAVRRQLGKIG-
A0A517MPZ6      PIPARFLAIGALLGGLT-GFGLAWLRDLMDHRLKSIEEIAATLQLPVLGALPLSAGKDD-
A0A5C6CNV7      PNRTRFLGVGGLLGGLV-GFGLAWLRNLMDHRLKSIDEIAQVLQLPVLGALPLSSERAND
A0A518K5H4      PGRRKTLSLGLAFGSML-GFGLAWLRSMLDQRLKSIEEIASVMQLPVIGAVPLMAGSRGR
A0A5C6AA28      PDRPKTLSLGLAFGAML-GFGLAWLRNLLDHRLKSIEEIASVMQLPIVGAVPLVTGARSR
A0A2E9VK20      KHVIKIVGGCLVMT-LMSTYAFLFLREMRDTSVKSLADLRAIVDTPILGTLPSIAN--PA
A0A3D4PJK1      KHVIKIVGGCLVMT-LMSTYAFLFLREMRDTSVKSLADLRAIVDTPILGTLPSIAN--PA
A0A532UT69      PQKTRYMATALLAG-LMLGGGLALARDWMDQTLRSGDEISALLRMPVLGAVPAMLG----
A0A355AI52      PKLSLTILAVLTGG-LASGIGIIFVIDTLDDRARSPEELQAELNLPTLATIGILEE----
A0A354PCQ3      PVKHMGMAASAAMM-VPFLFGLLW-----ELRMRRITDSSMCGELSVIGEIARLPS----
A0A0S8GZ23      VTKREKLLAALAIGALALGISFALLMGKIDKTIYDPEDIERCIGVPMIGTTSDLTH----
A0A1I3DDV4      PALNICVAGGMFLG-LCLGVLVAICNDQFDNRFRTPSEIDSALGVPVIAQVGKITR--SR
A0A2E0SMM6      PNKVRTALFSLIMG-ISLGVGVIVVLEALDDRFRSADEIKYHLNLPVLAMVRRMEE----
A0A3L7SI46      PKISTTVFLCTLFG-LMSGMAIIYVIDVLDDRFRSPDELQTQLGLPMLAMIREMEA--LD
A0A356KTN1      PSHSRNVILGLLFG-FGLGAVIALIFERLSDRLRTLKDAVNALGIPVLGVVPHQRE----
A0A5B9PJZ8      PSLPLCLGGGLFLG-TLLGFLFAGVKEMAEKTFRSSEDIAAILGSRVIGHVGLFQRVRPR
A0A2S8G191      PRSFAKIGMFGFAG-MMIPVAGFVFWDLRSQRINAPSDISKNLRINVLGAIPFVPR----
A0A2E7EGG1      NLPWKMLLVSVLAS-ISLPFGLFLIWERTLKRVTSSEQLQVDNNLPVVGEIACLPE---K
A0A2E2N5A9      PNRPLIVAVAGLIA-LFFVAGTGVVKDVLNDTFTTTEDIENKLNIPVLGIVPLVQQ----
A0A7C8AGA2      QGKRRKLAAALGFGGLALGAILALLLDKADKSLHDPKDVVRRVGVRIIGTTTSPRN----
A0A7C2FXP7      DKRIKLTLAALMGA-FALSFMAALLRDKADTSLTCPDDIVKRVGVKIIGTTTCTKH----
A0A2E3GWC6      FKRILKIVGGITIMLLVATYGLLFLLALRDTTIKSLADVRSLFEAPILGTLPSVTN--PQ
F0SLB0          FKRILKTVGGITIMLLVATYGLLFLLALRDTTIKSLADVRSLFEAPILGTLPSVTN--PQ
A0A3L7NDH9      PNLLLTLVAVLVGG-GAVGIGMIVVVDVLDDRIRSPEDLQTFAGLSLLTMMGSLED---E
A0A1N6DAJ8      IRQIKMAGMAGCGA-FALALVGVSFWEFRSRRVDSAADVIKSLGMNLFGTLPSLPQ-RSR
A0A532UD06      PQKRKIMATALALG-LVFGTCLAFLRDWIDYRLRSCEEISSVLHIPVLGVIPEISE--GQ
A0A660URN1      PQKAKIMMAALVLG-LMLGFALALVRDWMDYRLRSADEISAVLGLPVLGVVPTILP--EQ
A0A517ZCB5      PRLTVVAMLCLIIG-TGGGLATVYLMDIIDDRFRSPDQLRSELGLPILAMIRKLPP--LA
A0A225EH48      QKKILCGIAAFFAGFLLIALAVAFL-EWRSRRVDSVDQVVNELGLRVIGTIPAFPS----
A0A518INW8      PVLAKILLNGGLAG-LLVGGLLAFWAEHADQTFRDPSDLQHSLNASVIAHVPRFVV--TR
A0A518JPH9      PKLSKILMNGALAG-LLVGGLLAFWAEYADQTFRDPSDLERSLNANVIAHVPRFQV--TR
A0A5C5VEK8      PSRPKFLGAGVMLG-ALCGFGIAWLRDMLDHRLKSVDEIQEVLQLQVFGAMKRQMG----
A0A532UTJ0      NDKRIKLSVAVIFGALVCGMGLAYLRDKADLSLRTPDDVAKRIGIRIIGTTTSLHT----
A0A432MFP3      KRDKFLALTPLAM--LGLVLGLVTLVELRSGRVGGTEELSGRLAAEVFA-VPPLPTTRDA
A0A2E2CCW9      KRQLKFLMAGAAGG-LGLILAFSYFREMRDTTMKSVDEIRNQLHLPILGEVPCFAD----
A0A3C0AGX3      KRQLKFLMAGAAGG-LGLILAFSYFREMRDTTMKSVDEIRNQLHLPILGEVPCFAD----
A0A518AAQ5      KRQLKFLMAGGAAG-LGLVLALSYFREMRDTTIRTVDEIRNQLHLPMLGEVPQFTE----
A0A517QBG9      KRQLKFLMAGGAAG-LGLVLALSYFREMRDTTIKTVDEIRNQLHLPMLGEVPQFTE----
A0A518FTU3      KRQLKFLMAGGAAG-LGLVLALSYFREMRDTTIKTVDEIRNQLHLPMLGEVPQFTE----
A0A517WHH5      KRQLKFLMAGGAAG-LGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTE----
A0A5A8BGT3      KRQLKFLMAGGAAG-LGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTE----
A0A2E7K7A9      KRQLKFLMAGGAAG-LGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTE----
A0A517PTS5      KRQLKFLMAGGAAG-LGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTE----
A0A6I6AH34      KRQLKFLMAGGAAG-LGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTE----
A0A517VTK3      KRQLKFLLAGGAVG-LGLVLAISFFREKQDTTLKSVDEIRNQLHLPVLGEVPTFDE----
A0A517WQT4      KRQLKFLLAGGAVG-LGLVLAISFFREKQDTTLKSVDEIRNQLHLPVLGEVPTFDE----
A0A517VID8      KRQLKFLMAGTAAG-LGLILAFAYFREMRDTTMKSVNEIRNQLHLPVLGEVPSFAE----
A0A517RK10      KRQLKFLMAGGAVG-LGLVLAISYFREMRDTTVKSVDEIRNQFHLPILGEVPAFAE----
A0A518IH18      KRQLKFLIAGGAVG-LGLVLAISYFREMRDTTVKSVDEIRDQLHLPILGEVPTFAE----
A0A5C5XLF4      KHVIKIVGGCLVMT-LMSTYAFLFLREMRDTSLKSLADLRAIVDTPILGTLPSIANPAKN
A0A2D5NDU9      SGQPIRLPTGILLG-LLAGIALAWFQGMLDTRVRTAEELQRRLPVPILASMPQTQA--AP
A0A1P8WP26      PRPVIVGFLSIFFG-TAGGLGIIWVLDIMDDRFRAPEELKLQLDTQILTMVPALEQ--FS
A0A3L7V1F3      PRLAITGILSLMLG-SIAGLGIIWVLDIMDDRFRTPEELKLQLDTQVLSMIPRMEE--LQ
D5SZ21          PKLSLTVAVSLMAG-ISLGLALVYLADLLDDRFRSPEETSLQLGAPVLSFIPSLPT--YD
A0A286RGB6      DRRIQLAIMGGLAG-FILPGAVLLWWDVRRKPVNTAHELPHAVGVDVWGTIPLVPTRALQ
A0A518CHE5      PNKIRTAMFSLILG-IAMGIGVIVVLEALDDRFRSPDEIKYHLNLPVLAMVRKMEE--TT
A0A1V5N3W2      PSKRIKLMGAALFGALAAGIFLAFVRDKADKNLYTPEDLARTVGVAVVGTTSQLNY--RD
A0A3E0MY27      SNRDRYTVLAALAG-FGLAIVGVSLYEFQFRRLSSAHDMTEGLGMTVMGDVPLLSE--RP
A0A7C4Z5R7      -DKTLRLAGAAGVGVFGLVFLAVAFLEYRARRITSPEEVLQGVGMNVVGNVPLVPE--VA
A0A2E0X9P6      PIPYELLLVVCAAS-LATPFAVGALREVSVRRIATADDLERETALNLLGEVTRFPM--RP
A0A286RLF2      PSLPRVLIMVILGG-LTLGMFVVYVMDVLDDRFRSVEEIQWQLRAPVLSIIREMPP--RE
A0A517NSK8      PDPKIVLPLGMIAG-LALGVMLAFIADLCDTTFADPEDVEKTLGAPVLAHVNRFAPIRRK
A0A5C5Z0D6      PNPLIVLALGIFAG-GLLGFGTALLADVMDTTFVDPDDVQHTLGAPVLAHVPRFEPFKRK
M5UE94          PRPLIVLALGIFAG-GMFGMGMALLADLMDTTFVDPDDVQATLGAPVLAHVPRFDPIKRK
A0A2E8FLY0      PRLLVVALCALTTG-LGLGLGLIYVLDYFDDRFRSPDELQLQTNLSVLAMVGELPA--AD
A0A3D2U1E1      PRLLIVAFAAIVGG-LGSGLGLIYVLDYFDDRFRSPEELQVQAGLPVLAIVGELPPGNAE
E8R3W3          PTKRLKLSGMIGAGVFFASLVGIALLEFYSNRVDNLNVLGASMGMNVIGAIPTLPR--QT
A0A5C5ZM48      -GMPWKKMAAAALGCWFLPFAVALIAERSLRRVCDVRSLEAHANAPVLCEIARLPS--RP
A0A5B9WF77      KRLKFMAIVPVVV--LGALLGLFLLLEIRAERVVNPDSLSSRVQSEVYA-LPPIPR--QR
A0A518BBX8      PMAIIIFPVAGLLG-IMSGLGLVYLVDMADTSFRTSQEIQRRLGLPIVGLIPFIAA--PK
A0A1P8WN28      PVLTNTLVMFCVAA-VALALGVIYVIDLMDDRLRSPEEVRDELGLNVLGIIRKLPQ--HE
A0A3B9CTT0      ESLNSRLIFYCVLA-VMAAMGVIYVLDLMDDRLRTPEDVQDELGLPVLGIIRRLPE--EQ
A0A518ALT3      PIPFKLLAIACLSA-LIAPLGLATVREVVVKRVCNADELANETQLPLLGEVACLPV--RK
A0A3M1QRP3      PKLSLAAVFGAAFAGLLAGLARAYFTGALFEVEGLHDRTVSQAG-PLLGPLPLVRD--PR
A0A517TMV0      PQLRMVLAASLLGG-LVLGVGVVYTQDLLDDRFGSPEEMAHQLGCRVLSVVRELQP--LA
A0A3E0MY88      PRLKTVAAACLFSG-LVIGGVVIFVLDTLDDRFRSPEDVTMRLGAPTLAMVAQLDM--TH
A0A5B9QF68      PQIRFLVFFCLASG-TAVGAVIVYVQDVLDDRFSSPEELTAQLGVPVLAMVRNLTP--LP
A0A5B9QGF0      PQIRFLVFICLASG-IAVGTAIVYVQDILDDRFSSPEELTSQLGVPVLAMVRNLTP--LP
A0A5C6CK24      PQIRFLVFICLASG-TAVGTVIVYVQDVLDDRFSSPEELTAQLGVPVLAMVRNLSP--LP
A0A2E3RCU8      PRLSRVIVFWFLAT-IGIGFALVYVQDTIDDRFRTPDEMSKRVGYPIISLVRALPE--LG
A0A1C3E6N1      PKLSLTVAVSLMAG-ISLGLALVYLADLLDDRFRSPEETSLQLGAPVLSFIPTLPT--YD
A0A518GJT2      PKLSLTVAVSLMAG-ISLGLALVYLADLLDDRFRSPEETSLQLGAPVLSFIPTLPT--YD
A0A2E8B0L9      PRLALTGILSLIGG-LGIGCALVYVMDLVDDRFRSPDELRDQLGVPVLAMVRRLTV--AG
A0A5Q4GFE7      PKLPLVAMLCLVGG-LGIGLALVYVIDVLDDRFRSPEELQQQLGAPVLAMIRELAT--PA
A0A257WS34      PKLSTTGILCLFLG-TTLGLGVIYLRDAIDDRFKSPDELQAQLGLPVLAMIRQMPQ--PE
A0A7C4LP10      PKLSSTGLLALALG-TVVGLGLIYVLDAIDDRFKSPDELKWLLGLPVLAMIRQIRE--TG
A0A517MLW3      PRLRLVVLAAGFFS-TLLSVGLVYIADLRDDRFASLEEAERQTRTEILAVVEKLET--YG
A0A5B9QVD0      PRLKVTAALALMLA-MGISVGLVFFLDLRDDRFASLDDIERQTQTEILAVVEKLEP--HG
A0A3A0DET7      PSRARFLAVGLMLG-GVVGFGLAWLRELLDHRLKSVDEISEVVQLPVFGVVPQSSA--SA
A0A3B8PNV4      PRLLVVALCALACG-LGAGLGMIYILDVLDDRFRSPEELRLQLDVPVLALVGEMPV--TD
A0A3D1DR40      PRLLVVALCALACG-LGAGLGMIYILDVLDDRFRSPEELRLQLDVPVLALVGEMPV--TD
A0A2E7RYU8      PRLLVVALCALACG-LGGGLGVIYILDVLDDRFRSPEELRLQLDVPVLALVGEMPV--TD
A0A3B8LXG8      PRLLVVALCALACG-LGGGLSVIYILDVLDDRFRSPEELRLQLDVPVLALVGEMPV--TD
A0A286RD13      DKYRLVSFLGLMAF-LGTGAAVV-LLDFFLRPVSSAYQISYGLGLPVLGDLPLIER----
A0A2E3GWX1      PRLTLTLAMSIVAG-MGLGALTVLLMDLLDDRFHSPDELKSQLGAPVLAMVRELPM--LD
F0SG60          PRLTLTLAMSIVAG-MGLGALTVLLMDLLDDRFHSPDELKSQLGAPVLAMVRELPM--LD
A0A2E9VST2      PKLTSTLMLSIFAG-LFLGATTVLLLDLLDDRFHSPDELKRELGAPVMAMVRSLPA--LP
A0A356A6X2      PKLTNTLLLSILAG-LFFGATTVLLLDLLDDRFHSPDELKRELGAPVMAMVRSLPT--LP
A0A5C5XLM3      PKLTSTLMLSILAG-LFFGATTVLLLDLLDDRFHSPDELKRELGAPVMAMVRSLPS--LP
A0A7C5FXU1      ERRVQLTVLASLGG-MALPIVGILWWDVRRRRVNTSEELSQNLGVEVLARIPYVPA--RA
A0A3M1VCL4      PRLVLVALVALTLG-TTTGLGMIYVLDSIDDRFRSPEELQLQLGAPVLAIVRKLQQ--LE
A0A5C5V7Z9      PRFASLFGSAILGG-LALGAVIVFVRDQLDDRFTSPDEMSAQLELPVLSVVRTLNP--LP
A0A5C5YT05      PRFARLFGSALVGG-VLLGAGIVFIRDQLDDRFASPDEMSQQLELPVLSVVRTLNP--LP
A0A518D7F9      PQLRLVVLASLCGG-LAVAAGVVYAQDLLDDRFGSPEEMSRELGLPILSIVRQLNP--TG
A0A5C5ZIP0      PQLKLVLVASLLSG-LAIGLGLIYVQDLMDDRYGSPDEMALQLGCQVLALVRQLQP--IA
A0A518KBK3      PQLRLVLVASLMAG-LCLGVGLVYVQDLLDDRFGSPEEMAMQLGCRVLAVIRELPL--RT
A0A5C6AKF9      PQLRMVLMASLLGG-LCLGIGVVYVQDLLDDRFGSPEEMALQLGCPVLAVVRDLPA--RS
A0A6M5Z0K7      FGRHIEAAGGGVFG-VLFGLLTISVLDHRRNRIHSPADVSKGLRLRVIGALPKLSG--AQ
A0A350CI62      PRLPIAVLLSLLIG-TGTGLAVIWVLDIMDDRFRTPEELKLHLETQVLSMIPRMTE--LP
A0A4P5WQK6      PRLPIAVLLSLLIG-TGTGLAVIWVLDIMDDRFRTPEELKLHLETQVLSMIPRMTE--LP
A0A3C1X4W5      PRLPIAVLLSLLIG-TGTGLAVIWVLDIMDDRFRTPEELKLHLDTQVLSMIPRMSE--LP
A0A3D3W3A7      PRLPIAVLLSLLIG-TGTGLAVIWVLDIMDDRFRTPEELKLHLDTQVLSMIPRMSE--LP
A0A518DRX3      PNLKMTVLLSLLIG-LGGGAALVYGIDLLDDRFRSPEEMVEQLGAKLLAAIRPLSL--TE
A0A518DZF9      PNLKMTVLMSLLIG-LGGGAALVYGIDLLDDRFRSPEEMVEQLGAKLLAAIRPLSL--TE
A0A518AKT8      PRIKTVFLMSVLSG-LIVGVSLAYIQDALDDRFNSPEELTAQLGVPVLTLVQRLEP--LV
A0A5C5ZR72      AIPWKQLFVACAMS-MVVPYGVVVLREMALRRVTDSDQIYQDTNLRILGEISSFPK--RK
A0A7C5R0U3      PRAGTVFPMALAAG-LLVGLLSAYALELLDDRFRTPDQIEEQLQLPLLSVIGQLAA--TP
A0A517TY85      PIPYKYLLVACLAS-MLAPLGLAVAYEALLRRISSTDQLTKESLLPVIGEVARFPR--RR
A0A5B9QEI7      PIPYKYLLLASLVS-LVTPLGLAIAYEFLAKRISTPEQLTNESSLPLLGEVAQFPR--QR
F0SI78          KVFNYAGMGGM--GGLAIGMLVGLLLEYSDKRFRSPEEMMQMLGVPILGHIPEMPA--SQ
A0A517MDV3      PIIPLVLIAGLCFG-SMTGGGLGLLIDLGDRSFRSTKEIESAVGAPMLGAVGTMKF--RR
A0A518IQ30      PQLKVIGLLSLFAG-CGIGIAIAYITDLLEDHFQSPDELEEQVGVSVIAMIQSLNG--SG
A0A517LWP4      PRLRIIGVLSIFAG-CAIGIAIAYVTDLLEDRFQSPDELQEQVGVSVIAMIQSLNG--SG
A0A518JNW8      PRLKVIGLLSIFAG-CGIGIAIAYITDLLEDRFQSPDELQEQVGVSVIAMIQSLNG--SG
A0A2E7ENQ5      PRLLTVLATVIVSG-LSLGIGLAYVLDVLDDRFRSVDELKDQLNVAVLAIVRQLSP--TS
A0A7C2KUQ9      ARRSLLLTAMAICGAAALALAAAYVRVSLDQAVQGVSDLKGPFETPFLGCVPLLRD--PQ
A0A7C5BZF0      PNWQFVLLGALGAG-VALGLAVVYVVDILDDRFRSIEELQLLTGTPVLATVRDLSI--PE
A0A1G3AQE9      PNLARTVLAVLTLG-LGLGLGAVYILDILDDRFRSREEMQSVLGVPALAIVQELKM--NQ
A0A3L7UQT9      PRLVLVVAVCFILG-IGGGLGLIYILDLLDDRFRSPDELRMQLGVPVLAMVRAMEP--TG
A0A4P5YBU2      PRLVLVVAVCFILG-LGGGLGLIYILDLLDDRFRSPDELRMQLGVPVLAMVRAMEP--TG
A0A7C7V5U8      PSLRRVVLMVLIAG-LGTGLLAVYVLDILDDRFRSAEEMQAQLRAPVLAMVRQLAP--AT
                                                                            

A0A5S9IJB5      QYPEVLALS---------------------------------------------------
A0A5S9IPR9      GKTTHVVEEKE-------------------------------------------------
A0A533Q9U4      TDFTELIAHSS-------------------------------------------------
A0A533Q6B7      ARTMQLITYNL-------------------------------------------------
A0A1U9NNE1      ELSERL------------------------------------------------------
A0A2G2JCA2      ------RRTMS-------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      RRSEQPTPASG-------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A2E3GW02      RKRNKSGDTVP-------------------------------------------------
A0A5B9QNZ7      ------NKQLS-------------------------------------------------
A0A1Z8N7H5      -------PELS-------------------------------------------------
A0A1G2YPI3      TDRGR-------------------------------------------------------
A0A1U7CZ81      KLNGPAEDDQI-------------------------------------------------
A0A142YNY8      RLGAPGDDDQI-------------------------------------------------
A0A1U7GLS6      RLGAPGEDDQI-------------------------------------------------
A0A532UIN2      ------RLSIA-------------------------------------------------
A0A0S8KNX5      LLPERI------------------------------------------------------
A0A3D3UVZ8      LLPEQI------------------------------------------------------
A0A517NFU9      KLLNK-DSGVQ-------------------------------------------------
A0A5C5YWH4      SKTRS-GSLIQ-------------------------------------------------
A0A3D2TNK4      -------DALN-------------------------------------------------
A0A7C1Y4F0      PMRGH-KPSVP-------------------------------------------------
A0A6I0ENW6      ------TDALS-------------------------------------------------
A0A6L3A0B7      ------TDALS-------------------------------------------------
A0A0J1B4A0      KKVKE-GSGIS-------------------------------------------------
A0A142WSB9      --SAMAHTGIS-------------------------------------------------
M5SZR3          QLD---PEEMD-------------------------------------------------
M5TW92          QLD---PEEMD-------------------------------------------------
A0A2S8FKY2      KPKAL-SHNLG-------------------------------------------------
A0A517N8P6      QLKKSSGNDLF-------------------------------------------------
A0A432MJP4      ------AETTE-------------------------------------------------
M5UQ35          RHVRP-GSVVS-------------------------------------------------
A0A0S8FY64      EGLVSLAQHAI-------------------------------------------------
A0A1N6KFT7      LMG----EVGL-------------------------------------------------
L0DFG4          LMG----EIGL-------------------------------------------------
A0A5C5XXG1      VRG---------------------------------------------------------
A0A7C7YUM8      IKGLNRGQRSL-------------------------------------------------
A0A7C2AHI6      VRG--AGDGYL-------------------------------------------------
A0A518BJJ1      VAK--ATTDFI-------------------------------------------------
A0A518D182      VAT--RTKDFV-------------------------------------------------
A0A5C5WTY6      --SGI-ELSTS-------------------------------------------------
A0A5C5Y033      --SAI-DQGIA-------------------------------------------------
A0A5C6G1Y2      --SAI-DQGIA-------------------------------------------------
A0A354PDV6      --NSM-RQGVK-------------------------------------------------
A0A5C6FZ02      --NSM-RRGVR-------------------------------------------------
M5TIT3          --NSI-NQGVA-------------------------------------------------
A0A5M6CY44      --MSI-NQGVN-------------------------------------------------
F2AXG2          --NSI-NQGIK-------------------------------------------------
M2BB46          --NSI-NQGIK-------------------------------------------------
L7CLQ6          --NSI-NQGIK-------------------------------------------------
A0A0J1B719      --NSI-NQGIK-------------------------------------------------
Q7UF18          --NSI-NQGIK-------------------------------------------------
A0A2G1W1E0      --NSI-NQGIK-------------------------------------------------
K5E235          --NSI-NQGIK-------------------------------------------------
A0A5C6FFI9      IPSPD-QTPLA-------------------------------------------------
A0A5C5WDJ1      KAANV-KSMLD-------------------------------------------------
A0A5C5X547      GKNGKDDKKDS-------------------------------------------------
A0A353FIP5      IEAAKGKEHFL-------------------------------------------------
A0A5B1CIK7      --NSI-RDGIS-------------------------------------------------
A0A5C5WHS2      --NSI-REGIS-------------------------------------------------
A0A5C6B6G8      --NSI-DMGIR-------------------------------------------------
A0A5C5ZZN3      --NSV-KQGVT-------------------------------------------------
A0A5C5XS91      --ESI-KKGVS-------------------------------------------------
A0A5C6C4E6      --NSM-KKGVA-------------------------------------------------
A0A2E1VVJ1      SQRAR-GKVFL-------------------------------------------------
A0A3M2AEL0      SKHSR-ARDYL-------------------------------------------------
A0A2A2W9R6      KQAIK-DSEIS-------------------------------------------------
A0A518HKC1      KQAIK-DSAIS-------------------------------------------------
A0A518L3P0      KQAIK-DSDIS-------------------------------------------------
A0A255R1S0      KQAKV-GSKIS-------------------------------------------------
A0A5B9MKP1      KRVIK-GSAIS-------------------------------------------------
A0A0S8J591      FATRSLISHLD-------------------------------------------------
M5RT57          IGSRQTK-----------------------------------------------------
A0A351FYP6      EG----------------------------------------------------------
A0A2E7ESJ6      KLPGCNIEPIM-------------------------------------------------
A0A2D5AWU0      ---RARTGRIV-------------------------------------------------
A0A1G2YQB7      ---TTSKEKIK-------------------------------------------------
A0A353P687      ---TTSRDKIK-------------------------------------------------
A0A356EME5      AGKTTSRRMAQ-------------------------------------------------
L0DC26          ---ILGSGDAE-------------------------------------------------
A0A3L7P4E4      RTNPIDPAIVT-------------------------------------------------
A0A3L7PEB5      RTNPIDPAIVT-------------------------------------------------
A0A1U9NL64      ---MAERGRRV-------------------------------------------------
A0A2N1UCJ3      D--NGNKGQKV-------------------------------------------------
A0A7C4EK84      ---FSQRGRQV-------------------------------------------------
A0A7C3F0T2      ---LSDRGQVV-------------------------------------------------
A0A2E0X4J3      ---RAEAGMML-------------------------------------------------
A0A5C5YU10      ---REELGKLV-------------------------------------------------
A0A517MPZ6      ---RHETGRVV-------------------------------------------------
A0A5C6CNV7      RKGRSAIGTVL-------------------------------------------------
A0A518K5H4      EGDRSVGGRLV-------------------------------------------------
A0A5C6AA28      EGERNIGGRIV-------------------------------------------------
A0A2E9VK20      KNLQAARETGL-------------------------------------------------
A0A3D4PJK1      KNLQAARETGL-------------------------------------------------
A0A532UT69      ------ERSGR-------------------------------------------------
A0A355AI52      -EDFEDGIGLE-------------------------------------------------
A0A354PCQ3      -----GTRSYK-------------------------------------------------
A0A0S8GZ23      ------VEKKL-------------------------------------------------
A0A1I3DDV4      DKRKKGRMIVD-------------------------------------------------
A0A2E0SMM6      ------TGGYA-------------------------------------------------
A0A3L7SI46      ------GSGLD-------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A5B9PJZ8      KDSPFSNVAPE-------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      SITHELDDDID-------------------------------------------------
A0A2E2N5A9      ------AQGAQ-------------------------------------------------
A0A7C8AGA2      ------VDKLL-------------------------------------------------
A0A7C2FXP7      ------VSRPL-------------------------------------------------
A0A2E3GWC6      KNLEMARQTGT-------------------------------------------------
F0SLB0          KNLEMARQTGT-------------------------------------------------
A0A3L7NDH9      ADRDEEGSGLE-------------------------------------------------
A0A1N6DAJ8      GFRSGEAENVR-------------------------------------------------
A0A532UD06      RSTITRGREIWLKLKSIFADISRTAYSRTVPGEPKGKAKPGAQPIMAQVRAYRALRATGT
A0A660URN1      NIAIHSGKALL-------------------------KFKSGASRIWRTIQAGISSDAAGV
A0A517ZCB5      ------DSGLS-------------------------------------------------
A0A225EH48      ------KSSLR-------------------------------------------------
A0A518INW8      ------KEKKA-------------------------------------------------
A0A518JPH9      ------KEKKA-------------------------------------------------
A0A5C5VEK8      ------RLGRE-------------------------------------------------
A0A532UTJ0      ------VKPAL-------------------------------------------------
A0A432MFP3      ERARLEGPGYD-------------------------------------------------
A0A2E2CCW9      ------SDAAV-------------------------------------------------
A0A3C0AGX3      ------SDAAV-------------------------------------------------
A0A518AAQ5      ------TPAHV-------------------------------------------------
A0A517QBG9      ------TPAHV-------------------------------------------------
A0A518FTU3      ------KPAHV-------------------------------------------------
A0A517WHH5      ------EPAHM-------------------------------------------------
A0A5A8BGT3      ------EPAHM-------------------------------------------------
A0A2E7K7A9      ------EPAHM-------------------------------------------------
A0A517PTS5      ------EPAHM-------------------------------------------------
A0A6I6AH34      ------EPAHM-------------------------------------------------
A0A517VTK3      ------SVSID-------------------------------------------------
A0A517WQT4      ------SVSID-------------------------------------------------
A0A517VID8      ------SEAVV-------------------------------------------------
A0A517RK10      ------SEAAM-------------------------------------------------
A0A518IH18      ------SEAAM-------------------------------------------------
A0A5C5XLF4      -----LQAARE-------------------------------------------------
A0A2D5NDU9      KETDAPTTTWD-------------------------------------------------
A0A1P8WP26      ------GEGFN-------------------------------------------------
A0A3L7V1F3      ------GEGFA-------------------------------------------------
D5SZ21          ------GNGLD-------------------------------------------------
A0A286RGB6      MLPEENGRSRR-------------------------------------------------
A0A518CHE5      ------GYAID-------------------------------------------------
A0A1V5N3W2      ------KIGLR-------------------------------------------------
A0A3E0MY27      -WRLPGMSGID-------------------------------------------------
A0A7C4Z5R7      RRNLVPPQGER-------------------------------------------------
A0A2E0X9P6      ------VASRL-------------------------------------------------
A0A286RLF2      ------GEGVE-------------------------------------------------
A0A517NSK8      ------RNEPA-------------------------------------------------
A0A5C5Z0D6      ------RKDPP-------------------------------------------------
M5UE94          ------RKDPP-------------------------------------------------
A0A2E8FLY0      ------GPGLA-------------------------------------------------
A0A3D2U1E1      ------TKGLD-------------------------------------------------
E8R3W3          NSSRSISKPND-------------------------------------------------
A0A5C5ZM48      -----NSSGRR-------------------------------------------------
A0A5B9WF77      ------AIGAS-------------------------------------------------
A0A518BBX8      TKGSGEDAQID-------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      -------VGTR-------------------------------------------------
A0A3M1QRP3      ------SATAE-------------------------------------------------
A0A517TMV0      ------SHGLQ-------------------------------------------------
A0A3E0MY88      ------QTGVE-------------------------------------------------
A0A5B9QF68      ------GEGME-------------------------------------------------
A0A5B9QGF0      ------GEGMD-------------------------------------------------
A0A5C6CK24      ------GEGME-------------------------------------------------
A0A2E3RCU8      ------GKGIE-------------------------------------------------
A0A1C3E6N1      ------GNGLD-------------------------------------------------
A0A518GJT2      ------GNGLD-------------------------------------------------
A0A2E8B0L9      ------NEGAE-------------------------------------------------
A0A5Q4GFE7      ------TAGLQ-------------------------------------------------
A0A257WS34      ------GEGIQ-------------------------------------------------
A0A7C4LP10      ------GTGIQ-------------------------------------------------
A0A517MLW3      ------EYGAE-------------------------------------------------
A0A5B9QVD0      ------ETGPQ-------------------------------------------------
A0A3A0DET7      ------DRALA-------------------------------------------------
A0A3B8PNV4      ------ELGLS-------------------------------------------------
A0A3D1DR40      ------ELGLS-------------------------------------------------
A0A2E7RYU8      ------EPGLS-------------------------------------------------
A0A3B8LXG8      ------EPGLS-------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A2E3GWX1      -----VETGLE-------------------------------------------------
F0SG60          -----VETGLE-------------------------------------------------
A0A2E9VST2      -----HTHGLE-------------------------------------------------
A0A356A6X2      -----HTHGLE-------------------------------------------------
A0A5C5XLM3      -----HTHGLE-------------------------------------------------
A0A7C5FXU1      ------LLGPK-------------------------------------------------
A0A3M1VCL4      ------GTGVA-------------------------------------------------
A0A5C5V7Z9      ------GVGLD-------------------------------------------------
A0A5C5YT05      ------GTGLD-------------------------------------------------
A0A518D7F9      ------GERLE-------------------------------------------------
A0A5C5ZIP0      ------GSGIQ-------------------------------------------------
A0A518KBK3      ------GVGLE-------------------------------------------------
A0A5C6AKF9      ------GVGLE-------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      ------GEGFE-------------------------------------------------
A0A4P5WQK6      ------GEGFE-------------------------------------------------
A0A3C1X4W5      ------GEGFD-------------------------------------------------
A0A3D3W3A7      ------GEGFD-------------------------------------------------
A0A518DRX3      ------THGAQ-------------------------------------------------
A0A518DZF9      ------THGAQ-------------------------------------------------
A0A518AKT8      ------GDGLQ-------------------------------------------------
A0A5C5ZR72      ------VAANP-------------------------------------------------
A0A7C5R0U3      ------ESGLD-------------------------------------------------
A0A517TY85      ------VGAAP-------------------------------------------------
A0A5B9QEI7      ------VATTQ-------------------------------------------------
F0SI78          KRRKRNKSGDT-------------------------------------------------
A0A517MDV3      ------HRGMD-------------------------------------------------
A0A518IQ30      ------EAGGQ-------------------------------------------------
A0A517LWP4      ------EAGGQ-------------------------------------------------
A0A518JNW8      ------EAGGQ-------------------------------------------------
A0A2E7ENQ5      ------ATGVD-------------------------------------------------
A0A7C2KUQ9      ------RPS---------------------------------------------------
A0A7C5BZF0      ------DPGLE-------------------------------------------------
A0A1G3AQE9      ------NSGID-------------------------------------------------
A0A3L7UQT9      ------GTGAD-------------------------------------------------
A0A4P5YBU2      ------GTGAD-------------------------------------------------
A0A7C7V5U8      ------GSGLE-------------------------------------------------
                                                                            

A0A5S9IJB5      ---------------------------------------TRSPV----------------
A0A5S9IPR9      ----------------------------------------NTNV----------------
A0A533Q9U4      ---------------------------------------PKHSI----------------
A0A533Q6B7      ---------------------------------------PKYPI----------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ---------------------------------------PGNST----------------
A0A1G2XVR0      -------------------ENKDANLELLTSEA------PKSVF----------------
A0A1G3B0P0      -------------------ENKDANLELLTSEA------PKSVF----------------
A0A1E3X4X0      --------------LGGIADDNVFVPELFVHRK------SKSNI----------------
A0A286U4B3      --------------------DEVENFDTILHEL------PKSTF----------------
A0A5C6DDS2      --------------------DEVQNFDLISHEL------PMSTF----------------
A0A2E3GW02      ---------------------I--DPTLVNYHR------PNSRI----------------
A0A5B9QNZ7      ---------------------RLISPELVVYHR------PESPQ----------------
A0A1Z8N7H5      ---------------------GEGLKKVSAFSD------PVSVF----------------
A0A1G2YPI3      ----------------------------KTYLD------SKSNW----------------
A0A1U7CZ81      ---------------------DRFIQRLDHLRF------AVCGD----------------
A0A142YNY8      ---------------------ERFIQRLDHLRF------AVCGD----------------
A0A1U7GLS6      ---------------------DRFIQRLDHLRF------AVCGD----------------
A0A532UIN2      ---------------------DRGQKVHKD---------SDSPV----------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      ---------------------P----SLVCSYA------PRSTE----------------
A0A5C5YWH4      ---------------------P----SLVTFHA------PRSAE----------------
A0A3D2TNK4      ---------------------GENLETIHTHAC------PNAPE----------------
A0A7C1Y4F0      ---------------------PVPIAAIDVPAG------EATASSDLAPVAAQDAEQAAT
A0A6I0ENW6      ---------------------D-----------------TSPML----------------
A0A6L3A0B7      ---------------------D-----------------TSPML----------------
A0A0J1B4A0      ---------------------A----MIPTFHL------PRGTE----------------
A0A142WSB9      ---------------------P----QVVYLHH------PGSRE----------------
M5SZR3          ---------------------DSLDRSLCTYFR------PISVE----------------
M5TW92          ---------------------DSLDRSLCTYFR------PISVE----------------
A0A2S8FKY2      ---------------------PYEDQVRDS---------SDSVA----------------
A0A517N8P6      ---------------------PHTDQIVTVLHH------PHAPC----------------
A0A432MJP4      ---------------------P----GLVVHQR------PGSLT----------------
M5UQ35          ---------------------P----MIVAFHA------PRSSE----------------
A0A0S8FY64      ---------------------Q----HATD---------SS-------------------
A0A1N6KFT7      ---------------------V----SHAM---------PRSVW----------------
L0DFG4          ---------------------V----SHAM---------PRSVW----------------
A0A5C5XXG1      --------------------------LIAG---------ELSPN----------------
A0A7C7YUM8      ---------------------P----MRDA---------PGGPQ----------------
A0A7C2AHI6      ---------------------A----MLSN---------PGSPV----------------
A0A518BJJ1      ---------------------A----LRDD---------PHGVV----------------
A0A518D182      ---------------------A----MRDD---------PSGPV----------------
A0A5C5WTY6      ---------------------P----KATG---------NAKGS----------------
A0A5C5Y033      ---------------------G----LVAT---------DGSSE----------------
A0A5C6G1Y2      ---------------------G----LVAT---------DGSSE----------------
A0A354PDV6      ---------------------G----LIAT---------ELTPD----------------
A0A5C6FZ02      ---------------------G----LIAG---------ELSPN----------------
M5TIT3          ---------------------G----LIAT---------ELSPN----------------
A0A5M6CY44      ---------------------G----LISA---------ELSPD----------------
F2AXG2          ---------------------G----LIAT---------ELSPD----------------
M2BB46          ---------------------G----LIAT---------ELSPD----------------
L7CLQ6          ---------------------G----LIAT---------ELSPD----------------
A0A0J1B719      ---------------------G----LIAT---------ELSPD----------------
Q7UF18          ---------------------G----LIAT---------ELSPD----------------
A0A2G1W1E0      ---------------------G----LIAT---------ELSPD----------------
K5E235          ---------------------G----LIAT---------ELSPD----------------
A0A5C6FFI9      ---------------------P----SLVTAHC------PRSAE----------------
A0A5C5WDJ1      ---------------------P----SLMTFHS------PRSPE----------------
A0A5C5X547      ---------------------K----LQRA-------------L----------------
A0A353FIP5      ---------------------A----LLDA---------PDSRV----------------
A0A5B1CIK7      ---------------------G----LIAV---------ENSPN----------------
A0A5C5WHS2      ---------------------G----LIAA---------ENSPN----------------
A0A5C6B6G8      ---------------------G----LVSA---------ELSPD----------------
A0A5C5ZZN3      ---------------------G----LIAT---------ELSPD----------------
A0A5C5XS91      ---------------------G----LIAT---------GESPD----------------
A0A5C6C4E6      ---------------------G----LIAT---------GESPD----------------
A0A2E1VVJ1      ---------------------A----LLHD---------PESAA----------------
A0A3M2AEL0      ---------------------P----LRDE---------PDSPT----------------
A0A2A2W9R6      ---------------------P----MVAAFHV------PRATD----------------
A0A518HKC1      ---------------------P----MIAAFHV------PRATD----------------
A0A518L3P0      ---------------------P----MVAAFHI------PRATD----------------
A0A255R1S0      ---------------------P----MITTFHQ------PRGID----------------
A0A5B9MKP1      ---------------------P----MVASFHL------PRAVD----------------
A0A0S8J591      ---------------------------------------SRSGP----------------
M5RT57          ---------------------------------------AMSIF----------------
A0A351FYP6      ---------------------------------------DESPH----------------
A0A2E7ESJ6      ----------------------------CTVHK------PKSPQ----------------
A0A2D5AWU0      ------------------------------EEQ------PGSSA----------------
A0A1G2YQB7      ------------------------------ESM------WPRQL----------------
A0A353P687      ------------------------------KAM------WPRQL----------------
A0A356EME5      ------------------------------KLR---------LY----------------
L0DC26          ------------------------------HRR------WGSML----------------
A0A3L7P4E4      ------------------------------IHR------PRSQS----------------
A0A3L7PEB5      ------------------------------IHR------PRSQS----------------
A0A1U9NL64      ------------------------------ALN------PSSPV----------------
A0A2N1UCJ3      ------------------------------HLE------PKSSI----------------
A0A7C4EK84      ------------------------------HLD------PMSQV----------------
A0A7C3F0T2      ------------------------------ELE------PTSHA----------------
A0A2E0X4J3      ------------------------------VNA------PRAAF----------------
A0A5C5YU10      ------------------------------HLQ------PRSTS----------------
A0A517MPZ6      ------------------------------LTH------PRSMA----------------
A0A5C6CNV7      ------------------------------LTH------PRSTA----------------
A0A518K5H4      ------------------------------ALQ------PRSTA----------------
A0A5C6AA28      ------------------------------ALQ------PRSVA----------------
A0A2E9VK20      ------------------------APMLYYYHD------PGSPE----------------
A0A3D4PJK1      ------------------------APMLYYYHD------PGSPE----------------
A0A532UT69      ------------------------ARGQKVHLD------PDSPA----------------
A0A355AI52      ------------------------TVHMWNI--------SDDAA----------------
A0A354PCQ3      ---------------------------------------GRRIF----------------
A0A0S8GZ23      ---------------------------------------LLEQV----------------
A0A1I3DDV4      ---------------------------------------AQAPE----------------
A0A2E0SMM6      ------------------------IDAVQTHVN------PNSVE----------------
A0A3L7SI46      ------------------------AIVT--YAK------PDSLE----------------
A0A356KTN1      -----------------------DEVELLALRE------SRSVY----------------
A0A5B9PJZ8      ---------------------------LIALHQ------PSNQN----------------
A0A2S8G191      ------------------------SVLVNSSRNSKKQEYWKNLI----------------
A0A2E7EGG1      ---------------------------------------QLGLF----------------
A0A2E2N5A9      -------------------------LARMYSEG------NNPLF----------------
A0A7C8AGA2      ---------------------------------------LARQL----------------
A0A7C2FXP7      ---------------------------------------LAQQL----------------
A0A2E3GWC6      ------------------------SPMLYYYHD------PASPE----------------
F0SLB0          ------------------------SPMLYYYHD------PASPE----------------
A0A3L7NDH9      ------------------------STHM--HKS------NDDAA----------------
A0A1N6DAJ8      ---------------------------------------WKSML----------------
A0A532UD06      KAQPFAVGASSPNKDETTTEEQALEEQALVEFGQVVHFKPRSIA----------------
A0A660URN1      ETKTVSAVPRSED-----TAQGALDTKAIAERGQRVHLAPKSHV----------------
A0A517ZCB5      ------------------------SLYP--FSK------PNAVE----------------
A0A225EH48      ------------------SGDAGQAQNWRFVLN---------------------------
A0A518INW8      ------------------AKQSAISPLCRTVFA------PHSVE----------------
A0A518JPH9      ------------------AKQSSLSPLCRTVFA------PHSVE----------------
A0A5C5VEK8      ------------------------ELGKLVHLQ------PRSTS----------------
A0A532UTJ0      ---------------------------------------LPEQI----------------
A0A432MFP3      ------------------------------------------PK----------------
A0A2E2CCW9      ------------------D-ESEFAPALWYYYR------PASRE----------------
A0A3C0AGX3      ------------------D-ESEFAPALWYYYR------PASRE----------------
A0A518AAQ5      ------------------D-DSQFDSALWYYYR------PASRE----------------
A0A517QBG9      ------------------D-ESQFDSALWYYYR------PASRE----------------
A0A518FTU3      ------------------D-ESQFDSALWYYYR------PASRE----------------
A0A517WHH5      ------------------D-DSQFDSALWYYYR------PASRE----------------
A0A5A8BGT3      ------------------D-DSQFDSALWYYYR------PASRE----------------
A0A2E7K7A9      ------------------D-DSQFDSALWYYYR------PASRE----------------
A0A517PTS5      ------------------D-DSQFDSALWYYYR------PASRE----------------
A0A6I6AH34      ------------------D-DSQFDSALWYYYR------PASRE----------------
A0A517VTK3      ------------------DSECEFDRALWYYYR------PSSKE----------------
A0A517WQT4      ------------------DSECEFDRALWYYYR------PSSKE----------------
A0A517VID8      ------------------D-DSEFAPALWYYYR------PASRE----------------
A0A517RK10      ------------------D-DSDFDPALWYYYR------PASRE----------------
A0A518IH18      ------------------D-DSEFDPALWYYYR------PASRE----------------
A0A5C5XLF4      ------------------T-GLAPMLYY--YHD------PGSPE----------------
A0A2D5NDU9      ---------------------------------------NEHEF----------------
A0A1P8WP26      ------------------------SVLC--HVK------PNSTE----------------
A0A3L7V1F3      ------------------------AVMC--HSK------PHSKE----------------
D5SZ21          ------------------------SVHA--FVA------PHESS----------------
A0A286RGB6      ------------------------------YQR------WRALF----------------
A0A518CHE5      ------------------------AVQT--HVN------PNSVE----------------
A0A1V5N3W2      -----------------------------------------QQL----------------
A0A3E0MY27      ------------------------------PIS------LQGMM----------------
A0A7C4Z5R7      ------------------------------NRT------WHTIL----------------
A0A2E0X9P6      ------------------------RSLPAWHHR------EMIVF----------------
A0A286RLF2      ------------------------VLEV--VAD------PNSPA----------------
A0A517NSK8      ------------------F-EIDSSVYA--FHR------PRSPE----------------
A0A5C5Z0D6      ------------------L-KIDSSIRV--YHQ------PRSPS----------------
M5UE94          ------------------F-EIDSSIRV--HHQ------PRTPA----------------
A0A2E8FLY0      ------------------------SVPT--FSE------PNGVE----------------
A0A3D2U1E1      ------------------------AVQT--FAE------PNGSE----------------
E8R3W3          ------------------------RQVV-----------WEGML----------------
A0A5C5ZM48      ------------------S-EYRLEQALRVFEESTNVLATTIRW----------------
A0A5B9WF77      ---------------------------------------GPDDQ----------------
A0A518BBX8      ------------------A-AIDMTLCA--HLR------PRSVH----------------
A0A1P8WN28      ------------------------VDQARIYVNDF----PQTTH----------------
A0A3B9CTT0      ------------------------LSQCKIYLEKF----AQTVQ----------------
A0A518ALT3      ------------------------HQLMAPNQH------DLLVY----------------
A0A3M1QRP3      ---------------------------------------EFTVQ----------------
A0A517TMV0      ------------------------AVQM--FAK------PQATE----------------
A0A3E0MY88      ------------------------AVHT--HVD------PNSPE----------------
A0A5B9QF68      ------------------------TVHT--HTL------PHAVE----------------
A0A5B9QGF0      ------------------------TVHT--YKL------PHAVE----------------
A0A5C6CK24      ------------------------TVHT--HKL------PHSVE----------------
A0A2E3RCU8      ------------------------KVSA--YND------PASVF----------------
A0A1C3E6N1      ------------------------SVHA--FVA------PHESS----------------
A0A518GJT2      ------------------------SVHA--FVA------PHESS----------------
A0A2E8B0L9      ------------------------SLQV--HVA------AGAVE----------------
A0A5Q4GFE7      ------------------------AIQV--HVS------PESVE----------------
A0A257WS34      ------------------------QVLT--FVK------PSAAE----------------
A0A7C4LP10      ------------------------QVLT--YAR------PDSAE----------------
A0A517MLW3      ------------------------AIQM--HVA------PSTRS----------------
A0A5B9QVD0      ------------------------AIQM--HVD------PSARV----------------
A0A3A0DET7      ------------------------GQLV--LQA------PRSSV----------------
A0A3B8PNV4      ------------------------SVRM--LSE------PNSTD----------------
A0A3D1DR40      ------------------------SVRM--LSE------PNSTD----------------
A0A2E7RYU8      ------------------------SVRM--LSE------PNSTD----------------
A0A3B8LXG8      ------------------------SVRM--LSE------PNSTD----------------
A0A286RD13      ------------------------PIMRWMSRNGHMPETMRSVL----------------
A0A2E3GWX1      ------------------------SIYT--HTK------PNSVE----------------
F0SG60          ------------------------SIYT--HTK------PNSVE----------------
A0A2E9VST2      ------------------------SIFT--YTK------PNSVE----------------
A0A356A6X2      ------------------------SIFT--YTK------PNSVE----------------
A0A5C5XLM3      ------------------------SIFT--YTK------PNSVE----------------
A0A7C5FXU1      ------------------------ASSP--RARVWRGMLTESAK----------------
A0A3M1VCL4      ------------------------SVLT--FAK------PNGVE----------------
A0A5C5V7Z9      ------------------------AVHM--HVD------GNSVE----------------
A0A5C5YT05      ------------------------AVHM--HVD------ANSVE----------------
A0A518D7F9      ------------------------AVHM--FRD------GNSPD----------------
A0A5C5ZIP0      ------------------------SVQM--FAK------PQAVD----------------
A0A518KBK3      ------------------------KVQM--FSQ------PQATE----------------
A0A5C6AKF9      ------------------------KVQM--FAQ------PQGAE----------------
A0A6M5Z0K7      ------------------------------SAS------LARSL----------------
A0A350CI62      ------------------------AVMC--HVR------PHSRE----------------
A0A4P5WQK6      ------------------------AVMC--HVR------PHSRE----------------
A0A3C1X4W5      ------------------------AVMC--HVR------PHSRE----------------
A0A3D3W3A7      ------------------------AVMC--HVR------PHSRE----------------
A0A518DRX3      ------------------------AVQV--HVN------PTAVE----------------
A0A518DZF9      ------------------------AVQV--HVN------PTAVE----------------
A0A518AKT8      ------------------------SLHT--HMC------PNASD----------------
A0A5C5ZR72      ------------------------QMLPRRLRR------EMYVF----------------
A0A7C5R0U3      ------------------------EFIA--QQR------QDSAD----------------
A0A517TY85      ------------------------V-IAGPPSK------EMFVF----------------
A0A5B9QEI7      ------------------------AQIAAPQQR------QMFVY----------------
F0SI78          ------------------V-PIDPTLVN--YHR------PNSRI----------------
A0A517MDV3      ------------------K-TLSPELVV--YHR------PDSSD----------------
A0A518IQ30      ------------------------NLHM--FTN------PKSAE----------------
A0A517LWP4      ------------------------NLHM--FTN------PKSAE----------------
A0A518JNW8      ------------------------NLHM--FTN------PKSAE----------------
A0A2E7ENQ5      ------------------------SLQV--HVA------PNDVA----------------
A0A7C2KUQ9      -------------------------------EQ------EQAAQ----------------
A0A7C5BZF0      ------------------------VLPA--YAN------PNSAE----------------
A0A1G3AQE9      ------------------------QLPT--YAS------PNAAE----------------
A0A3L7UQT9      ------------------------AVLC--HAK------PNGVE----------------
A0A4P5YBU2      ------------------------AVLC--HAK------PNGVE----------------
A0A7C7V5U8      ------------------------CLQV--YAH------PDAAE----------------
                                                                            

A0A5S9IJB5      ------------------------------------------------------------
A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ETRDAVEGDRRTPSELESVRWVQRMSKKAGRSARGTTVGGASWDKSKTPVASAAEKPDIV
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      ------------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      ------------------------------------------------------------
A0A5C5ZZN3      ------------------------------------------------------------
A0A5C5XS91      ------------------------------------------------------------
A0A5C6C4E6      ------------------------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7C4Z5R7      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      ------------------------------------------------------------
A0A7C5R0U3      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7C2KUQ9      ------------------------------------------------------------
A0A7C5BZF0      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
                                                                            

A0A5S9IJB5      --------------AESFRSLRTTL-----SFSIEKNST-----FFVTSPVPGDGKSFCA
A0A5S9IPR9      --------------AEAFRAISTSI--FF-AEEQTKNKT-----FVITSALAQDGKTTIF
A0A533Q9U4      --------------TEALKGIRTSI--IF-SHPDKPKKV-----ILVTSSAPSEGKSLIS
A0A533Q6B7      --------------TESIKRIRTSI--MF-SHPDNPKKT-----LLISSAIPSEGKTLLT
A0A1U9NNE1      --------------ADDYRTIRANI----SMLEEENQHI-----LAVTSSQPKDGKTTFS
A0A2G2JCA2      ------VSTSLRMYEESIDSLRTNI--ML-PNNSDDIKV-----IVVSSACSREGKTSVA
A0A1G2XVR0      --------------SETIRNIRTGI--ML-STTDTPHKS-----LLITSTKQGEGKSFIA
A0A1G3B0P0      --------------SETIRNIRTGI--ML-STTDTPHKS-----LLITSTKQGEGKSFIA
A0A1E3X4X0      --------------AEAIRNIRTNI--IF-TATDTPRKL-----IMIASANPDEGKTFFV
A0A286U4B3      --------------AEAVRNVRTGI--ML-SSADNPKRI-----MLVTSTTPSEGKTFVA
A0A5C6DDS2      --------------AEAVRNVRTGI--ML-SSTDNPKKI-----ILVTSTTPGEGKTFVA
A0A2E3GW02      --------------AEAYRLIRGTL--LL-TMGGERARV-----IQFTSPDPGDGKSTTC
A0A5B9QNZ7      --------------AEAYRHLRTAL--MF-SPGGKDLRL-----LQMTSPNPGDGKTLTT
A0A1Z8N7H5      --------------VESFRTLRTSL-----TLSGVDSTR-----IAFTSSEPGDGKTTVI
A0A1G2YPI3      --------------AEAYRTIRTAV--FF-GAPKDEAKT-----ILVTSPMPADGKTTLA
A0A1U7CZ81      ------------------------------HPEVGLGRC-----VLITSAIGGEGKTTLA
A0A142YNY8      ------------------------------HPEVGLGRC-----VLISSAVGGEGKTTLA
A0A1U7GLS6      ------------------------------HPDVGLGRC-----VLISSAVGGEGKTTLA
A0A532UIN2      --------------AEAYRTIRTAV--FF-GAPKNQAKT-----ILVTSPAPADGKTTLV
A0A0S8KNX5      --------------IGDYQTIRANL--GL-LGGEGIPKK-----LVITSPGMKEGKTTFA
A0A3D3UVZ8      --------------VGDYQTIRANL--KL-LGGRGIPKK-----LVVTSPGMKEGKTTFS
A0A517NFU9      --------------SEVYRVARTAL--MV-TNRKDDVRT-----IMMTSPQPGDGKSTTI
A0A5C5YWH4      --------------SEVYRVARTSL--MV-ANRKTNVRT-----MMMTSPQPGDGKSTTI
A0A3D2TNK4      --------------TEAFRTLRTVL-----SLSEQNCER-----ILISSSEPGDGKTTIS
A0A7C1Y4F0      RRGQKVHLESKSVVAEAYRTIRTAV--FF-GAPKEGAKT-----ILITSPAPGDGKSTLA
A0A6I0ENW6      --------------QESIRMIRTAL--LE-RCSVRQGYT-----VLITSPNVGTGKTTFA
A0A6L3A0B7      --------------QESIRMIRTAL--LE-RCSVRQGYT-----VLITSPNVGTGKTTFA
A0A0J1B4A0      --------------AETFRVLRTSL--LF-LTKSQSKKV-----FLLTSPSPSDGKSTTI
A0A142WSB9      --------------SEAYRSLRTTL--FF-STRETGEKV-----IQVCSAEPGDGKSTTT
M5SZR3          --------------SESYRALRTTL--FF-HNRSREQSV-----IQVTSACPGDGKSTVA
M5TW92          --------------SESYRALRTTL--FF-HNRSREQSV-----IQVTSACPGDGKSTVA
A0A2S8FKY2      --------------ATVLR-----------RSLSEQCQV-----LLISSAMPREGKSSLT
A0A517N8P6      --------------SEAVRSVRTSL--FPVAGAPPEYQV-----LQITSALPGDGKSTVA
A0A432MJP4      --------------AEAYRALRTGL--EF-VRRERDVRV-----IVVCSPSPGDGKSTVT
M5UQ35          --------------AETFRVLRTGI--IF-RCKSEGKRA-----FMITSPSPADGKSTMI
A0A0S8FY64      --------------TEAFRSIRTNI--YF-SGQRGEMKT-----LMVTSAAPQDGKTVFA
A0A1N6KFT7      --------------AEAYRSVRTSL--EF-LRRSRQVQL-----ILVTSAHSGDGKTTTA
L0DFG4          --------------AEAYRSVRTSL--EF-LRRSRQVQV-----ILVTSSHSGDGKTTTA
A0A5C5XXG1      --------------AEALRLGRTML--LPKIKSRD-MRS-----IGVTSSMQGDGKSTIT
A0A7C7YUM8      --------------AEAYRSIRASL--RQALDGDGALKT-----LACTSCFQGEGKTVTN
A0A7C2AHI6      --------------GEAYRSIRSNL--KFALEPDSVLRT-----VAVTSSAPGEGKTTTN
A0A518BJJ1      --------------AEAYRSLRANL--RFAVGDVNALRT-----MAATSCAPGEGKSTTN
A0A518D182      --------------AEAYRSLRASL--RFAVGDLGQMRT-----LAVTSSAPGEGKSTTN
A0A5C5WTY6      --------------RETFRLTRTIL--AQ-SIQSRGIHS-----MGITSPTPGDGKSTMV
A0A5C5Y033      --------------SEAFRLGRTIL--LP-DIKSKKVRS-----IGFTSSMQGDGKSTIV
A0A5C6G1Y2      --------------SEAFRLGRTIL--LP-DIKSKKVRS-----IGFTSSMQGDGKSTIV
A0A354PDV6      --------------AEAIRMMRTLL--LM-DVKSKKLQT-----IAMTSPMQGDGKSTVI
A0A5C6FZ02      --------------AEALRLGRTML--LP-KIKSRDMKS-----IGVTSSMQGDGKSTIT
M5TIT3          --------------AEAFRLGRTVL--LP-EIRSGKLRT-----IGFTSSMQGDGKSTVA
A0A5M6CY44      --------------AEAFRLGRTMM--LM-DIKAGKLKT-----IGFTSPLQGDGKSTIM
F2AXG2          --------------AEAFRLGRTVL--LP-DIRSGKVRA-----IGFTSPMQGDGKSTVV
M2BB46          --------------AEAFRLGRTVL--LP-DVRNGNVRA-----IGFTSPMQGDGKSTVV
L7CLQ6          --------------AEAFRLGRTVL--LP-DIRKENVRA-----IGFTSPMQGDGKSTVV
A0A0J1B719      --------------AEAFRLGRTVL--LP-DIRSGSVRT-----IGFTSPMQGDGKSTVV
Q7UF18          --------------AEAFRLGRTVL--LP-DVRNGNVRA-----IGFTSPMQGDGKSTVV
A0A2G1W1E0      --------------AEAFRLGRTML--LP-DIRNGNVRA-----IGFTSPMQGDGKSTVV
K5E235          --------------AEAFRLGRTML--LP-DIRNGNVRA-----IGFTSPMQGDGKSTVV
A0A5C6FFI9      --------------AEVYRVARTSL--MI-RADGSDTKV-----LMMSSPHPGDGKSTTI
A0A5C5WDJ1      --------------AEIFRVGRTSM--MI-ANRKGSVQT-----IMVTSPQPGDGKSTTI
A0A5C5X547      --------------SESVRGIVAQL--IR-RKASENQNC-----IMVSSATAGEGKTTAS
A0A353FIP5      --------------AEAYRGLRANL--TF-AAKRNEIKS-----LAITSASQGEGKSTTI
A0A5B1CIK7      --------------AEAFRLGRTVL--LP-EVRSGKLRT-----IGFTSPMQGDGKSTVC
A0A5C5WHS2      --------------AEAFRLGRTVL--LP-EIRSGELRV-----LGFTSPMQGDGKSTVT
A0A5C6B6G8      --------------AEAFRLGRTVL--LP-EIRSGKLQT-----IGFTSPMQGDGKSTVT
A0A5C5ZZN3      --------------AEAFRLGRTVL--LP-DIRSGKIRT-----IGFTSPMQGDGKSTVA
A0A5C5XS91      --------------AEAFRLGRTML--LP-EIRSGALRT-----IGFTSPMQGDGKSTVV
A0A5C6C4E6      --------------AEAFRLGRTML--LP-EIRSGALRT-----IGFTSPMQGDGKSTVV
A0A2E1VVJ1      --------------AEAYRSLRASL--RF-ATGGREIRT-----MAITSAGQGEGKSTTL
A0A3M2AEL0      --------------AEAYRALRANL--RF-LAKGQAIKT-----LAITSSVQGEGKSVTT
A0A2A2W9R6      --------------AETFRFVRTSL--LF-LAKKQSKQV-----FLVTSPSPSDGKSTTI
A0A518HKC1      --------------SETFRVVRTSV--LF-LAKKQSKQV-----FLLTSPSPSDGKSTTI
A0A518L3P0      --------------AETFRVIRTSI--LF-LAKKQSKQV-----FLITSPSPSDGKSTTI
A0A255R1S0      --------------AETFRVLRTTL--LF-MAKRQSKKI-----FMITSPSPADGKSTTI
A0A5B9MKP1      --------------SETFRVVRTSV--LF-LAKKQSKQV-----FLLTSPSPADGKSTMV
A0A0S8J591      --------------AEAFRGIRTEV--ML-RSDLRQVKT-----GMVTSTSPQEGKTTVA
M5RT57          --------------EESIDSLRVGL--LL-GEKHNDIQT-----LVVTSAVHGEGKSSIS
A0A351FYP6      --------------AEAYRVLRTNI-LFA-GRKSEDQTT-----FTVVSGGAGEGKTTTM
A0A2E7ESJ6      --------------AESYRAVRTAL--YF-NSRGERHQV-----IQVTSPMPGDGKSTLA
A0A2D5AWU0      --------------AEAIRNLRTAT--TF-ALPKDSHGV-----VLVTSSVSGEGKSVTA
A0A1G2YQB7      --------------ADDYHAICINL--GL-MNNCTIPNK-----LAITSAGPQEGKSTLA
A0A353P687      --------------ADDYHSICINL--GL-MNNCTIPNK-----LVISSASPREGKSTLA
A0A356EME5      --------------EESIDSMRTFL--VL-AEEIKGARV-----LAVTSAASNEGKTSVA
L0DC26          --------------IESVDAARTAL--LH-VSRTESVRV-----VMVASALGGEGKTSLS
A0A3L7P4E4      --------------AEAFRGVRTYL--MA-ATRGEGHRI-----VLLTSPEPGDGKSTMS
A0A3L7PEB5      --------------AEAFRGVRTYL--LA-ATRGAGHSI-----VLLTSPEPGDGKSTMS
A0A1U9NL64      --------------SEAYRTVRTAV--FF-GVPKESCKT-----ILVTSPQPAEGKSTLI
A0A2N1UCJ3      --------------AEAYRSIRTSV--FF-GVPKGQART-----ILITSPAPSDGKTTMV
A0A7C4EK84      --------------AEAYRTVRTAV--LF-GLPAGAARK-----MLVTSPTPGDGKTVCV
A0A7C3F0T2      --------------AETYRTIRTAI--YF-GVPNGQARK-----IVVTSPEPGDGKTTLV
A0A2E0X4J3      --------------SEAVRTLRTSF--HF-GLGGPDVRA-----VCVTSPTAGDGKSTVA
A0A5C5YU10      --------------AEAFRTLRTAV--HF-GLAGDDCKV-----LVVTSPSPGDGKSVVT
A0A517MPZ6      --------------AESFRTLRTAI--HF-GLTRDDAKV-----IAITSPSPGDGKSVVA
A0A5C6CNV7      --------------AEAFRTLRTAI--HF-GLARDDAKI-----ICVTSPSPGDGKSTVA
A0A518K5H4      --------------AEAIRTLRTAL--YF-GIG-GESKT-----FVVTSPAPGDGKSTVA
A0A5C6AA28      --------------AEAIRALRTSL--HF-GLA-GDART-----YVVTSPAPGDGKSTVA
A0A2E9VK20      --------------AEACRSVRATF--FV-RAADVDAHI-----IQFTSSEPGDGKTTTI
A0A3D4PJK1      --------------AEACRSVRATF--FV-RAADVDAHI-----IQFTSSEPGDGKTTTI
A0A532UT69      --------------AEAYKTIRTAI--FL-GVPNGKAKT-----ILVTSPESAEGKTTMV
A0A355AI52      --------------AESFRTIRTVL-----VMGTEDSER-----IAVTSAEPGDGKTTIS
A0A354PCQ3      --------------EESIDSLRANL--FL-STRWKDTRS-----IAVVSSISGEGKSSVA
A0A0S8GZ23      --------------AEDYQTIRANL--GL-LSNGKIPHK-----MVVTSSGVREGKSTFA
A0A1I3DDV4      --------------AESFRLLRTYL--LR-EVKAGNLRT-----AMITSSQAKDGKSTIL
A0A2E0SMM6      --------------SEAFRTLRTAI-----SFNTHESRR-----LLVTSTEKSDGKTTVM
A0A3L7SI46      --------------AESFRTLRSSI-----TFSTSNTQR-----LVMTSTEPGDGKTTTL
A0A356KTN1      --------------AEAFRRARVQLNAVG-AFPSEGCGV-----LLCVSGIPREGKTLSA
A0A5B9PJZ8      --------------CEAYRSIRTSI--FF-RAQETGAKI-----IQMTSPTPGDGKSTTI
A0A2S8G191      --------------AESVGGIVARL--FR-PSATRQYRV-----VMISSALAGEGKTTLA
A0A2E7EGG1      --------------EESIDSLRTGL--VL-SQKNESIQV-----VVVSSSVAGEGKSSVA
A0A2E2N5A9      --------------TETIRTIRTKL--EM-ANTDHYSQV-----IVTTSALPGEGKSTLS
A0A7C8AGA2      --------------ADDYQAIRANL--GL-LDGDSASKI-----IVVTSPGIGDGKTTFS
A0A7C2FXP7      --------------SDDYQTIRANL--EL-LNGDDLTRI-----IAVTSPGMGEGKTTFA
A0A2E3GWC6      --------------AESCRSVRATF--FV-RASDAGARI-----IQFSSPEPGDGKTTTI
F0SLB0          --------------AESCRSVRATF--FV-RASDAGARV-----IQFSSPEPGDGKTTTI
A0A3L7NDH9      --------------SEGFRTLRTVL-----AMNGSQSQR-----IAISSSEPGDGKTTAS
A0A1N6DAJ8      --------------VESVDAARTTL--LH-VSRTESVRV-----VMVASALSGEGKTSLS
A0A532UD06      --------------AEAYRTLRTSI--FF-GVPKGGAKT-----ILVTSPAPGDGKTTLV
A0A660URN1      --------------AEAYRTIRTAV--FF-GVPKGQAKT-----IVITSPAPGDGKSTLA
A0A517ZCB5      --------------SEAFRSLRTTL-----EFSNEDTKC-----MTISSTEPGDGKTTVM
A0A225EH48      ---------------ESVNSARTML--LH-TAKTQNMQV-----LMVTSAMQGEGKTSLA
A0A518INW8      --------------SEVLTMARTSL--FV-HAGQTNDNV-----IQVTSPMPGDGKSTMT
A0A518JPH9      --------------SEVLTMARTSL--FV-HTGQTDENV-----IQVTSPMPGDGKSTMT
A0A5C5VEK8      --------------AEAFRTLRTAV--HF-GLAGDDCKV-----LVVTSPSPGDGKSVIA
A0A532UTJ0      --------------VGDYQTIRANL--GL-VGDKGIPRK-----LVITSPGMKEGKTTFA
A0A432MFP3      --------------FEQFVQQLDHL--RV-ALCGEGGQDGRGRCVLITSAVGGEGKTTLA
A0A2E2CCW9      --------------AEAFRSLRTSL--LL-KTDRSGAKV-----LQMTSAEPGDGKTTSI
A0A3C0AGX3      --------------AEAFRSLRTSL--LL-KTDRSGAKV-----LQMTSAEPGDGKTTSI
A0A518AAQ5      --------------AEAYRSLRTSL--LL-KTDRSGAKV-----LQVTSAEPGDGKTTSV
A0A517QBG9      --------------AEAYRSLRTSL--LL-KTDRSGAKV-----LQVTSAEPGDGKTTSV
A0A518FTU3      --------------AEAYRSLRTSL--LL-KTDRSGAKV-----LQVTSAEPGDGKTTSV
A0A517WHH5      --------------AEAYRSLRTSL--LL-KTDRTGARV-----LQVTSAEPGDGKTTSV
A0A5A8BGT3      --------------AEAYRSLRTSL--LL-KTDRTGARV-----LQITSAEPGDGKTTSV
A0A2E7K7A9      --------------AEAYRSLRTSL--LL-KTERNGAKV-----LQVTSAEPGDGKTTSV
A0A517PTS5      --------------AEAYRSLRTSL--LL-KTERNGAKV-----LQVTSAEPGDGKTTSV
A0A6I6AH34      --------------AEAYRSLRTSL--LL-KTDRTGARV-----LQITSAEPGDGKTTTV
A0A517VTK3      --------------AESFRSLRTSL--LL-KTDQSGAKV-----LQMTSAQPGDGKTTSI
A0A517WQT4      --------------AESFRSLRTSL--LL-KTDQSGAKV-----LQMTSAQPGDGKTTSI
A0A517VID8      --------------AEAFRSLRTSL--LL-KTDRSGAKV-----LQMTSAEPGDGKTTSI
A0A517RK10      --------------AEAFRSLRTSL--LL-KTDRSGAKV-----LQMTSAEPGDGKTTSI
A0A518IH18      --------------AEAFRSLRTSL--LL-KTDRSGAKV-----LQMTSAEPGDGKTTSI
A0A5C5XLF4      --------------AEACRSVRATF--FV-RAADVDAHI-----IQFTSSEPGDGKTTTI
A0A2D5NDU9      --------------AEAARTLRTAI--YF-GLAQIEGTS-----IQITSAEPGPGKSTIA
A0A1P8WP26      --------------AESFRGLRTNL-----EFAGGDTGR-----IVCTSTEPGDGKTTIS
A0A3L7V1F3      --------------VEAFRALRTSI-----EFSPQETNR-----LVCTSTEPGDGKTTVS
D5SZ21          --------------TEAFRTLRTAI-----QFAGDDIRR-----LVITSTEPGDGKTTVS
A0A286RGB6      --------------SESVRKVAARI--IR-ESEHERLQV-----IMVTSAVPGEGKTTLA
A0A518CHE5      --------------SEAFRTLRTAI-----SFSSHESRR-----LLVTSTEKSDGKTTVM
A0A1V5N3W2      --------------VSDYQTIRSNL--RL-LSDGEIPKI-----LVVTSPASGDGKTTLA
A0A3E0MY27      --------------DESVDSIRSLL--LH-SASCESVQV-----VMVTSANSGEGKTTIS
A0A7C4Z5R7      --------------TESVDATRTLL--LH-AAQADGTRV-----VMISSAVAGEGKTSLT
A0A2E0X9P6      --------------AESIDSLRTQL------MLTQGLGVGGVRVLAVASAGSGEGKTSVA
A0A286RLF2      --------------SESFRTLRTAL-----ALSDRPTGA-----VVVTSTQPGDGKSTVS
A0A517NSK8      --------------AEIYRVIRTSM--LM-SAKAKDQRI-----IQVTGPLPGDGKSTTS
A0A5C5Z0D6      --------------AEVFRVMRTGL--LV-EAKAKGLHV-----FQVTSPLPGDGKSTTS
M5UE94          --------------AEVFRVLRTGL--LV-AARKNGHQV-----IQVTSPLPGDGKSTTS
A0A2E8FLY0      --------------TEAFRTLRTAL-----AFSSNPTTR-----LAVTSTEPGDGKTTIL
A0A3D2U1E1      --------------NEAFRTLRTTL-----AFSSEPTAR-----LVVTSTEPGDGKTTVL
E8R3W3          --------------RESINEIRSHV--LH-ANMPTPPRV-----LLVTSSMPREGKTTLS
A0A5C5ZM48      --------------ADGFKGIRV---------------------VSVMSAMKNEGKTSLS
A0A5B9WF77      --------------IDRFIQRLDHL--RF-AVCGEPHDAEMGRCVLVTSAIGGEGKTTLA
A0A518BBX8      --------------AEAYRGLRTAL--YF-SMNAHNQNV-----VQVTSPNAGDGKSTTA
A0A1P8WN28      --------------AECFRTLKTSI-----TLSPMDTKC-----IAITSTEASEGKTTTT
A0A3B9CTT0      --------------AEAFRTLKTAV-----TLTAQQSKC-----LAVTSTDAGEGKTVTT
A0A518ALT3      --------------TESIDSLRTTL-----ALTEGVGVRDCHKTVAVCSGVSGEGKTNIS
A0A3M1QRP3      --------------SECVRMVRTAL--LQ-RLPHDRCNV-----IQITSASPGAGKTTFA
A0A517TMV0      --------------SEAFRTLRTAI-----TLGAEVSDR-----LVISSSEPSDGKTTIS
A0A3E0MY88      --------------CEAFRTLRTAL-----SFNPEETQR-----LVVSSAEPGDGKTTVL
A0A5B9QF68      --------------TEAFRTLRTAI-----SLSGVACGR-----LLISSSEPGDGKTTIS
A0A5B9QGF0      --------------TEAFRTLRTAI-----SLSGTSCER-----LLISSSEPGDGKTTIS
A0A5C6CK24      --------------TEAFRTLRTAI-----SLSGSSCDR-----LLISSSEPGDGKTTIS
A0A2E3RCU8      --------------VESFRTLRTSL-----ALSAAESTR-----LALTSSEPGDGKTTVI
A0A1C3E6N1      --------------TEAFRTLRTAI-----QFAGDDIRR-----LVITSTEPGDGKTTVS
A0A518GJT2      --------------TEAFRTLRTAI-----QFAGDDIRR-----LVITSTEPGDGKTTVS
A0A2E8B0L9      --------------SEAFRTLRTTL-----AFSGQDLQR-----IAITSSEPSDGKTTVL
A0A5Q4GFE7      --------------SEAFRTLRTTL-----AFSGSDLER-----IAITSTEPSDGKTTVL
A0A257WS34      --------------AECFRTLRSAI-----SFCAGDTHR-----LCVTSTEPGDGKTTTL
A0A7C4LP10      --------------SECFRTLRSAI-----TFCAGDTQR-----LVITSTEPGDGKTTTL
A0A517MLW3      --------------SEAFRTLRAGL-----MLNPAKPRL-----IAVSSSEPGDGKTTIS
A0A5B9QVD0      --------------SEAFRTLRAGL-----MLNPDQPRL-----IAVSSSEPSDGKTTVS
A0A3A0DET7      --------------AEAIRTLRTAL--HF-GMAGEDVKV-----LAITSPMPGDGKTTIA
A0A3B8PNV4      --------------TEAFRTLRTAL-----SFAGRPTQQ-----LVITSTEPGDGKTTVL
A0A3D1DR40      --------------TEAFRTLRTAL-----SFAGRPTQQ-----LVITSTEPGDGKTTVL
A0A2E7RYU8      --------------TEAFRTLRTAL-----SFAGRPTQQ-----LVVTSTEPGDGKTTVL
A0A3B8LXG8      --------------TEAFRTLRTAL-----SFAGRPTQQ-----LVVTSTEPGDGKTTVL
A0A286RD13      --------------IESVDQLRTIL--LH-RAERQGLKV-----VLVTSALAREGKTTLV
A0A2E3GWX1      --------------TEAFRTLRTAI-----EFASETHQR-----ISISSTEPSDGKTTVI
F0SG60          --------------TEAFRTLRTAI-----EFASETHQR-----ISISSTEPSDGKTTVI
A0A2E9VST2      --------------TEAFRTLRTSI-----EFACENHQR-----ISITSTQPSDGKTTVI
A0A356A6X2      --------------TEAFRTLRTSI-----EFACENHQR-----ISITSTQPSDGKTTVI
A0A5C5XLM3      --------------TEAFRTLRTSI-----EFACENHQR-----ISITSTQPSDGKTTVI
A0A7C5FXU1      --------------SLVARLLREN--------ESNPPRV-----IVVTSAESSEGKTTVA
A0A3M1VCL4      --------------TEAFRTLRLKL-----MFSETPAQR-----LVVSSTEPGDGKTTVL
A0A5C5V7Z9      --------------AEAFRTLRTSL-----TLRGDETER-----LVISSAEPSDGKTTVT
A0A5C5YT05      --------------AEAFRTLRTSL-----TLRGEETER-----LVISSAEPSDGKTTVS
A0A518D7F9      --------------AEAFRTLRTAL-----TLTGDVADR-----IVVSSAEPSDGKTTVS
A0A5C5ZIP0      --------------SEAFRTLRTAI-----ALGADAPDR-----LVISSAEPSDGKTTIS
A0A518KBK3      --------------SESFRTLRTAI-----TLGAEVSER-----LVITSSEPGDGKTTVS
A0A5C6AKF9      --------------SEAFRTLRTAI-----TLGAAVSDR-----LVISSSEPGDGKTTIS
A0A6M5Z0K7      --------------AESVDALRTTL--LH-LHSAPQGTV-----LMVASSGAGEGKTTLA
A0A350CI62      --------------VEPFRALRTSI-----EFSPQDTNR-----LVVTSTEPGDGKTTVS
A0A4P5WQK6      --------------VEPFRALRTSI-----EFSPQDTNR-----LVITSTEPGDGKTTVS
A0A3C1X4W5      --------------VEAFRALRTSI-----EFSTQDTNR-----LVITSTEPGDGKTTVS
A0A3D3W3A7      --------------VEAFRALRTSI-----EFSTQDTNR-----LVITSTEPGDGKTTVS
A0A518DRX3      --------------SEAFRTLRTVL-----SFGDLEGNR-----LIVTSTEPSDGKTTVI
A0A518DZF9      --------------SEAFRTLRTVL-----SFGDLEGNR-----LIVTSTEPSDGKTTVI
A0A518AKT8      --------------SEAFRTLRTSL-----SLMTDASER-----ILVSSAEPSDGKTTVS
A0A5C5ZR72      --------------AESINALRTSL-----VFAAEPDQP---LVIALTSAVSGEGKTSIS
A0A7C5R0U3      --------------AEAFRTLRTTL-----YFTARDLVS-----LAVTSAEPGDGKTTVL
A0A517TY85      --------------AESIDSLRTQL-----LLTEHLGVPGERKVVAICSAASGEGKSSLA
A0A5B9QEI7      --------------TESIDSLRTQL-----MLTEQVGQPGVDKIIAICSAASGEGKSSLA
F0SI78          --------------AEAYRLIRGTL--LL-TMGGERARV-----IQFTSPDPGDGKSTTC
A0A517MDV3      --------------AEAYRHLRTSL--LF-RPGGKELRV-----IQMTSPNPGDGKTLTT
A0A518IQ30      --------------SEAFRTLRTSL-----SLQGSDFSK-----LAITSSEPGDGKTTVI
A0A517LWP4      --------------SEAFRTLRTSL-----SLQGSDFSK-----LAVTSSEPGDGKTTVI
A0A518JNW8      --------------SEAFRTLRTSL-----SLQGSDFSK-----LAVTSSEPGDGKTTVI
A0A2E7ENQ5      --------------SESFRTLRSTL-----AFSEQGSEC-----VAISSSEPGDGKTTVL
A0A7C2KUQ9      --------------TEHVRMIRTAL--LE-RIDRQRGSA-----VLISSAGPQAGKSTLA
A0A7C5BZF0      --------------SEAFRTLRTAL-----ALAETETNL-----LAVTSAQPSEGKTTVL
A0A1G3AQE9      --------------VEAFRTLRTAL-----SLANQETHQ-----LVVSSAEPGDGKTTVL
A0A3L7UQT9      --------------TEAFRTLRTAI-----SFSDRQAQR-----IVVTSTEPGDGKTTVM
A0A4P5YBU2      --------------TEAFRTLRTAI-----SFSDRQAQR-----IVVTSTEPGDGKTTVM
A0A7C7V5U8      --------------SEAFRTLRTAL-----SLTDPPAQR-----VVVSSAEPGDGKTTVL
                                                                .     **:   

A0A5S9IJB5      ANLSVAFTQN-DAK-VLLIDADMRKSRQH-----QIWNTPRYP---GLSNLIA-----DS
A0A5S9IPR9      CNLALMMAKA-GHK-VLLIDGDLRRPRLR-----RLFELPQGE---GFTELLR-----RD
A0A533Q9U4      ANLAIVMAQT-GKK-VLLIDADLRKPTMH-----KLFKIDKSL---GLSNVLV-----KS
A0A533Q6B7      SNLGVVMAQT-GKK-VLLVDADLRNPSLH-----KTFELDESS---GLSNSLI-----NP
A0A1U9NNE1      INFAASLAQN-DRK-VLLIDGDLRKPDIA-----RILNL--PEGTTGLSDVLE-----GK
A0A2G2JCA2      CQLAISLARSSGRK-TLLIDGDMRSPDIH-----NVFEVPKSP---GLAEVLN-----RD
A0A1G2XVR0      ANLAIAFAQT-GKK-TLLVDTDFRKPRQH-----KIFGIDLKP---GLSNHFI-----GE
A0A1G3B0P0      ANLAIAFAQT-GKK-TLLVDTDFRKPRQH-----KIFGIDLKP---GLSNHFI-----GE
A0A1E3X4X0      SNLATVIAHT-GKK-VLMVDTDMRKPRLN-----KIFSVERNP---GVSNVLA-----GE
A0A286U4B3      SNLAIVIAKT-GKK-TLIVDCDFRKPRVH-----KAFNIQMMP---GLTNHIL-----GD
A0A5C6DDS2      GNLAIVIAKT-GKK-TLIVDCDFRKPRVH-----KAFNIETMP---GLSNHFV-----GE
A0A2E3GW02      SNIALATANS-GKR-TLVIDLDLRRPTVH-----KLFGLDRDV---GVSTFLT-----SD
A0A5B9QNZ7      VNLAASLGQT-GKR-VLLIDCDLRRPRVG-----KLFSLDPDNTA-GLADVLT-----GK
A0A1Z8N7H5      ANLAVVCAQS-GKK-TLLIDGDLRRPGLT-----RLLDLKSKP---GLSDLLN-----AD
A0A1G2YPI3      SNMAIAMAQA-GQR-VLILDADFRKPMQH-----RIFKLNHENR--GLSSVLA-----GA
A0A1U7CZ81      AQLAARCGHA-GHS-TLLIDADLRRGSLC-----SLLDIPEGL---GLSDVL-----KEE
A0A142YNY8      AQLAARCGHS-GHS-TLLIDADLRRGALS-----PLLDVADSK---GLSDLLM----NED
A0A1U7GLS6      AQLAARCGHS-GHA-TLLIDADVRRGALS-----PLLDVPEGA---GLSDALM----NDG
A0A532UIN2      SNLAIAMAQA-GQK-TLIIDGDFRKPMQQ-----KIFNVNHGDV--GLSSTLA-----GI
A0A0S8KNX5      INLATSIAES-GKR-VLLVDGDLRKPDVA-----RLLNLPKGAR--GLQDVLS------G
A0A3D3UVZ8      VNLATSLSES-GKK-VLLIDGDLRKPDVA-----RLLNLPKGSR--GLQDVLC------G
A0A517NFU9      SNLAISFARA-GKS-VLLIDADMRRPVIA-----GLFNVAESP---GLSDVLR-----GE
A0A5C5YWH4      SNLAVSFARA-GKK-VLLIDADMRRPVIA-----GLFGVQREP---GLSDVLS-----GT
A0A3D2TNK4      ANLSVALAQA-GHR-TLVIDADLRRPGFT-----TLMQLKGQP---GVADLLT-SPETPA
A0A7C1Y4F0      SNIAISMAQA-GQK-TLLIDADFRKPVQH-----KIFEVDDNK---GVSSVLA-----GR
A0A6I0ENW6      MLLARSLAHV-GKR-VLLVDTDIRRSSLS-----QRVNAGPRK---GLVDFLR----TGK
A0A6L3A0B7      MLLARSLAHV-GKR-VLLVDTDIRRSSLS-----QRVNAGPRK---GLVDFLR----TGK
A0A0J1B4A0      ANLAVSVAQT-GKR-VLLIDADMRRPTVA-----ANFGVERSP---GLSDLLSHDGPINP
A0A142WSB9      ANLAVALAQS-GKS-VVLIDADLRRPTVH-----DLFALPRQL---GLAEVLT-----GA
M5SZR3          GNLGVSIAQS-GKR-VLLIDADLRKPRQH-----LFFGSEIGI---GLSNMIV-----DG
M5TW92          GNLGVSIAQS-GKR-VLLIDADLRKPRQH-----LFFGSEIGI---GLSNMIV-----DG
A0A2S8FKY2      CHLAISLAQA-GRK-VVVVDFDLRRPSMH-----SIFGLPVGP---GVGDILV-----GE
A0A517N8P6      ANLAASVARA-GKR-VLLIDADLRRPTQA-----KIFGVQSEL---GLTSLIN-----GE
A0A432MJP4      SNLAIGLAQA-GRR-VLLIDCDLRKPSQD-----RIHGIDRAP---GLSEVLR-----GI
M5UQ35          VNLAASMAQT-GKR-VLLVDADMRRPTVA-----ASLGVSAEY---GLVDYLK-----GK
A0A0S8FY64      ANLATTMAQD-GKR-VLLVDADLRRPALH-----RAFELERSP---GLTNLLV-----EG
A0A1N6KFT7      SNLAISFAMA-GRK-VLLVDGDLRKPAQH-----KIFRLKGDQ---GLSHILR-----RL
L0DFG4          SNLAISFAMA-GRR-VLLVDADLRKPSQH-----KIFGLKADQ---GLSHVLR-----RL
A0A5C5XXG1      ANLAASFSQV-GLS-VLVVDGDLRRPTVH-----RYFSVAPEG---GLTDLLT-----GS
A0A7C7YUM8      ADLAIVFAKA-GRR-VLLVDCDLRKPQLH-----NIFTTQRAP---GFAEILE-----EG
A0A7C2AHI6      ANLAATFALG-GAK-VLLVDADVRRPAVH-----KTFGLEKGP---GFAEALM-----EE
A0A518BJJ1      IDIAWAFASG-GRR-VLLVDADMRRPSVH-----RYLKLDRGP---GLAEVLA-----GT
A0A518D182      IDLAWCLASP-SRR-VLLVDADLRRPSVH-----RYLGLGDQV---GLAECLT-----DE
A0A5C5WTY6      SHLSTSFIRS-GMR-VLLIDADLRRPTIH-----KLFGLPNEL---GLSQFIS-----GS
A0A5C5Y033      ANFAQAFAQV-GLN-VVVVDCDLRRPSQH-----RYLSLQDQQ---GMSEVLQ-----AK
A0A5C6G1Y2      ANFAQAFAQV-GLN-VVVVDCDLRRPSQH-----RYLSLQDQQ---GMSEVLQ-----AK
A0A354PDV6      SNLAVSFSQL-GMS-VLVMDCDLRRPSIH-----NFFSVKREN---GLVDVLA-----DE
A0A5C6FZ02      ANLAASFSQV-GLS-VLVVDGDLRRPTVH-----RYFSVAPEG---GLTDLLT-----GS
M5TIT3          ANFAVSFSQI-GLR-VLVIDADMRRPGVH-----RFFSVDKAN---GLSEVLE-----GQ
A0A5M6CY44      SNFAVSFAQV-NLK-VLVIDADLRRPTVH-----RYFSVENEL---GLSDLLE-----NE
F2AXG2          SNFAVSFSQV-GLK-VLVIDADLRRPSAH-----RYFSIGKED---GLCDVLE-----GR
M2BB46          SNFAVSFSQV-GLK-VLVIDADLRRPSAH-----RYFSIGKED---GLCDVLE-----GR
L7CLQ6          SNFAVSFSQI-GLK-VLVIDADLRRPSAH-----RYFSLGKED---GLCDVLE-----GR
A0A0J1B719      SNFAVSFSQV-GLK-VLVIDADLRRPSAH-----RYFSLGKED---GLCDVLE-----DR
Q7UF18          SNFAVSFSQV-GLK-VLVIDADLRRPSAH-----RYFSLGKED---GLCDVLE-----GR
A0A2G1W1E0      SNFAVSFSQV-GLK-VLVIDADLRRPSAH-----RYFSLGKED---GLCDVLE-----GR
K5E235          SNFAVSFSQV-GLK-VLVIDADLRRPSAH-----RYFSLGKED---GLCDVLE-----GR
A0A5C6FFI9      SNLAISFAQA-GKR-VLLIDSDLRRPVIA-----GLFGVDGGR---GLGDILM-----GE
A0A5C5WDJ1      SNMAISFAQT-GKK-VLLIDADMRRPVIA-----KLFGIDQEP---GLSDYLE-----RR
A0A5C5X547      VEISRMLARS-GQK-TVLIDFDLRRPRIH-----EIFEVDGAT---GIYDILT-----GN
A0A353FIP5      ADLAISLANS-GAT-VLLVDADLRRPSIH-----KLFSIQSNP---GLVDAIS-----GE
A0A5B1CIK7      SNFAVSFSQI-GLR-VLVIDADLRRPSAH-----RYFSVAKGA---GLCDVLE-----GR
A0A5C5WHS2      SNFAVSFSQI-GLK-VLVIDADLRRPSVH-----RYFSVAKGA---GLCDVLE-----GR
A0A5C6B6G8      SNFAVSFAQL-GLK-TVVVDADLRRPSIH-----RYFSVSKTG---GLCDVLE-----GR
A0A5C5ZZN3      SNFAVSFSQI-GLR-VLLIDADLRRPSAH-----RFFSVGREE---GLCDILN-----DR
A0A5C5XS91      SNFAVSFSQI-GLK-ILIIDADLRRPSAH-----RFFNLSKEN---GLCDLLE-----GR
A0A5C6C4E6      SNFALSFSQI-GLK-VLVIDADLRRPSAH-----RFFNLNKER---GLCDLLD-----GR
A0A2E1VVJ1      ADLAIALAQG-GKK-VLLVDADLRRPVVH-----KYFDAEVSP---GLSEVLL-----EK
A0A3M2AEL0      CDLAVALAQT-GAR-VLLVDADLRRPVVH-----RLFGFPISP---GLSDVLK-----ED
A0A2A2W9R6      ANLAVSMAQA-GKR-VLLVDADLRRPMVA-----KTFGIERSP---GLSDYLN-----HV
A0A518HKC1      ANLAVSMAQA-GKR-VLLVDADLRRPTVA-----KNFGIERSP---GLSDYLN-----HV
A0A518L3P0      ANLAVSMAQA-GKR-VLLVDADLRRPMVS-----KTFGIERSP---GLSDYLN-----RV
A0A255R1S0      ANLAVSMAQT-GKR-VLLVDADMRRPTIA-----SRFGVERGP---GLSDYLH-----GD
A0A5B9MKP1      SNLAVSMAQA-GKR-VLLVDADMRRPTID-----KVFGVERSP---GLSDYLN-----GV
A0A0S8J591      VNWAITLAQA-GNK-VLLIDGDLRKPMIH-----RAFNM--KPDR-GLSTLLS-----EK
M5RT57          SQLAVSIGRATGEP-VLLIDGDLRAPDIH-----NIFQV--SNNL-GMTSVLE-----GR
A0A351FYP6      FNLAVVFAQM-GDR-ILVVDSDLRRPSMH-----RYFKV--SNTI-GLTNLLL-----GQ
A0A2E7ESJ6      SNLAVTIAQS-GKS-VLLLDADFRRPTQH-----EVFAM--EAPEIGLASVVA-----GD
A0A2D5AWU0      SNLAFALATG-GRR-TLLIDGDLRMPSLH-----EIYGV--ENLA-GLGQVMT-----RS
A0A1G2YQB7      VNLAMNLAKI-GKK-VLLIDGDLRKPDIA-----KYLNL-DNKGK-GMHQLLA-----DF
A0A353P687      VNLATNLAKI-GKK-VLLIDGDLRKPDIA-----KYLKL-DNKGK-GMHQLLA-----DF
A0A356EME5      AQLALSLARASGKP-TLLIDGDMRAPDIQ-----EVFEV--RKSP-GLAEVLG-----GE
L0DC26          SHLATSLARA-GRR-TLLVDGDLRRPSAH-----ELFDQ--PCVP-GFCEVLR-----GE
A0A3L7P4E4      SNLAVTLAQT-GKS-VLLIDADMRRPTVK-----RLFSL--KNKM-GLSNLLG-----DV
A0A3L7PEB5      SNLAVALAQT-GKS-VLLIDADMRRPTVK-----RLFGL--KNNT-GLSELLD-----EV
A0A1U9NL64      SNLGITMAQA-GQK-TLIVDADFRRPKQH-----EVFEF--DREP-GISNILA-----GE
A0A2N1UCJ3      SNLAIAMAQA-GQK-TLIVDADFRKPMQH-----NIFGFANEVEK-GLSSILS-----GQ
A0A7C4EK84      SNLAIAMAQA-GQR-VLLLDADFRRPSQQ-----RVFGL--DQRM-GLSRVLL-----EN
A0A7C3F0T2      SNLGIAMAQA-GQR-TLIIDGDFRKPMQH-----RIFKV--ERER-GISSVLV-----GR
A0A2E0X4J3      SNLAIAMARA-GQR-TLLIDADMRKPRQH-----VTFGL--STEI-GLSTLLA-----DR
A0A5C5YU10      SNLAIATDQA-DRR-TLLIDADMRKPTQH-----TIFGV--DNTQ-GLSTALS-----ER
A0A517MPZ6      SNLALTMAQA-DQR-VLLIDADMRKPKQH-----EVFEI--QVEH-GLSSVLA-----ER
A0A5C6CNV7      SNMAIAMAQA-DQR-VLLIDADMRKPTQH-----TIFEV--TCEQ-GLSTVLT-----ER
A0A518K5H4      SNLAIAMAQA-NQR-VLLIDADMRKPTQH-----ETFGM--TPTT-GFSDVLT-----GA
A0A5C6AA28      SNLAIAMAQA-NQR-VLLIDADMRKPTQH-----EIFGV--EVES-GFAAVLS-----GV
A0A2E9VK20      SNLAISIAQA-GKR-VLLIDADLRKPMVH-----QLFGM--REDI-GLSECLS-----GE
A0A3D4PJK1      SNLAISIAQA-GKR-VLLIDADLRKPMVH-----QLFGM--REDI-GLSECLS-----GE
A0A532UT69      SNLAISMAQA-GEK-TLILDADFRNPVQHLVFDVDVFEV--NGSK-GLASLLS-----RR
A0A355AI52      SNLAIAYQQA-GKR-VLIIDADMRKPGLT-----KLIDR--RGQV-GLSDILR-----GT
A0A354PCQ3      SQLSLSIAKA-TGQTVLLVDADLRCPDQH-----RLFGL--EMGP-GFSAVLA-----GK
A0A0S8GZ23      VNLATSLAQA-GKR-VLLIDGDLRKPDIE-----RLLNL--PHDSWGLMDVLY-----GL
A0A1I3DDV4      ANLGASFAEL-GLK-VLIIDGDMRAPTIH-----RFLNM--PIDR-GLSETLQ-----GK
A0A2E0SMM6      ANLAVAFAQA-NKK-TLIVDTDMRRPGMT-----NLLEM--RKEE-GLSKLLR-----SD
A0A3L7SI46      ANLSVAFAQA-KKK-TLLIDADLRRPGMT-----QLLEL--KGPR-GLSQILR-----ET
A0A356KTN1      LNLAIASAQA-GRR-TLLIDADMRSPRVH-----RILGQ--PLEP-GLADAIE-----GK
A0A5B9PJZ8      ANLAASMAQS-GRK-VLLIDADLRKPRQH-----KYFGV--DNDY-GLTSVVY-----GQ
A0A2S8G191      GQIAYALAES-GAR-TILVDFDLRRPALD-----TAFDV--NLVP-GVTEWLS-----GE
A0A2E7EGG1      SQLAVSLARS-SGMPTLLIDGDMRSPDIH-----RIFKV--ENKP-GLVGVLS-----GE
A0A2E2N5A9      ANLAHALAQL-GK--VILIDADLRKPTLA-----KNFGR--PKGSMGLTDIIE-----NR
A0A7C8AGA2      VNLATSFAQS-GEK-VLLIDGDLRKPDIA-----EVLNL--PKGSRGLQDLLF-----GK
A0A7C2FXP7      LNLATSFAQK-GEK-VLLIDGDLRKPGIA-----QTLNI--PKELRGLQDLLF-----GK
A0A2E3GWC6      SNLAISMAQA-GKK-VLLIDADLRRPMVH-----RLFGL--REEI-GFSEVLQ-----GE
F0SLB0          SNLAISMAQA-GKK-VLLIDADLRRPMVH-----RLFGL--REEI-GLSEVLQ-----GE
A0A3L7NDH9      TNLAVAYSQA-GKR-VLLIDADMRKPGLT-----KLVGF--RSMP-GLSDILR-----GN
A0A1N6DAJ8      SHLATSLARA-GRR-TLLIDGDMRRPSAH-----ELFDQ--PCVP-GLSEVLR-----DE
A0A532UD06      SNLAIATAQA-GQG-TLVIDADLRKPRQH-----RIFEI--DHEL-GLTNVLA-----GT
A0A660URN1      SNLALTMAQA-GQR-TLVLDADFRKPVQH-----KIFEI--DHGK-GLSNVFA-----GA
A0A517ZCB5      ASLGVAFAQS-GRR-TILIDGDMRRPGLT-----RLFNL--TGHP-GLSTVLM-----SD
A0A225EH48      SQLATSMATA-GLR-TLVLDCDLRNPSLH-----KLFDS--PLTP-GCAEVLL-----QE
A0A518INW8      VNLAAAIAKA-GKR-VLLIDADLRRPTLY-----KLLGT--QNAN-GLAEYLM-----GD
A0A518JPH9      VNVAAAIAKA-GKR-VLLIDADLRRPTLY-----KLLGI--QHPK-GLAEYLM-----GD
A0A5C5VEK8      SNLAIATDQA-DRR-VLLIDADMRKPTQH-----SIFGV--DSKQ-GLSTMLR-----ER
A0A532UTJ0      VNLATSMAES-GKK-VLLIDGDLRKPDVA-----RLLNL--PKGSRGLQDVLC-----G-
A0A432MFP3      AQLAVRCAEA-GAS-TVLIDADLRRATLG-----RLFEV--PDCP-GLSDVLR-----GD
A0A2E2CCW9      SNLALAIAQT-GRK-VLIVDADLRRPTIH-----KLFGL--ANSV-GLGDVLT-----GE
A0A3C0AGX3      SNLALAIAQT-GRK-VLIVDADLRRPTIH-----KLFGL--ANSV-GLGDVLT-----GE
A0A518AAQ5      SNLAMAIAQT-GRK-VLIIDADLRRPTVH-----KLFGI--NNAV-GLGDVLA-----QE
A0A517QBG9      SNLAMAIAQT-GRK-VLIIDADLRRPTVH-----KLFGI--NNAV-GLGDVLA-----QE
A0A518FTU3      SNLAMAIAQT-GRK-VLIIDADLRRPTVH-----KLFGI--NNAV-GLGDVLA-----QE
A0A517WHH5      SNLALAIAQT-GRK-VLIIDADLRRPTVH-----KLFGI--NNAV-GLGDVLA-----QE
A0A5A8BGT3      SNLALAIAQT-GRK-VLIIDADLRRPTVH-----KLFGI--NNAV-GLGDVLA-----QE
A0A2E7K7A9      SNLALAIAQT-GRK-VLIIDADLRRPTVH-----KLFGI--NNAV-GLGDVLA-----QE
A0A517PTS5      SNLALAIAQT-GRK-VLIIDADLRRPTVH-----KLFGI--NNAV-GLGDVLA-----QE
A0A6I6AH34      SNLALAIAQT-GRK-ALIIDADLRRPTVH-----KLFGI--NNAV-GLGDVLA-----QE
A0A517VTK3      SNLALAIAQT-GRK-VLIVDADLRRPTIH-----SLFGI--VNGI-GLGDVLS-----EE
A0A517WQT4      SNLALAIAQT-GRK-VLIVDADLRRPTIH-----SLFGI--VNGI-GLGDVLS-----EE
A0A517VID8      SNLALAIAQT-GRK-VLIVDADLRRPTIH-----KLFGL--ANSV-GLGDVLS-----GD
A0A517RK10      SNLALAIAQT-GRK-VLIVDADLRRPTVH-----KLFGL--ANAI-GLGDVMA-----EE
A0A518IH18      SNLALAISQT-GRK-VLIVDADLRRPTVH-----KLFGL--SNAI-GLGDVMA-----NE
A0A5C5XLF4      SNLAISIAQA-GKR-VLLIDADLRKPMVH-----QLFGM--REEI-GLSECLS-----GE
A0A2D5NDU9      SILAIAMAKA-GHR-TLLIDGDLRKPVQS-----KRWQV--SGPG-GITSAVA-----ED
A0A1P8WP26      SNMAVAFAQS-GRR-TLIIDADMRRPGLS-----TLLDL--RDDK-GLSVILR-----ST
A0A3L7V1F3      SNLAVAFAQS-GKR-TLIIDADMRRPGLS-----TLLGL--RDDT-GLSKILR-----DS
D5SZ21          TNLAVAYAQS-GRR-TIIIDCDMRRPGLS-----KTMKL--RGSY-GLSTILR-----ND
A0A286RGB6      SQLAASLAQM-GQK-TVILDFDLRRPSLH-----EVFNL--PISP-GVSEVLR-----AE
A0A518CHE5      ANLAVAFAQS-NKK-TLIVDTDMRRPGMT-----NLLEL--RKEE-GLSKLLR-----SE
A0A1V5N3W2      INLSLSLAQT-GQK-VLLIDGDLRKPDIA-----HFLKL--PENYWGLQDVLL-----GL
A0A3E0MY27      SSLAASLGRS-GRR-TLLIDGDMRRPAVH-----RMLDL--PLDT-GLSEVLR-----GE
A0A7C4Z5R7      CQLGASLARA-GQR-TLIVDFDLRKPSLH-----ELFGL--PLTP-GIREIMR-----GE
A0A2E0X9P6      TSLAVSFAKA-TQHATLIIDADLRAPSAA-----RMLGL--PNQP-GLADVLR-----GD
A0A286RLF2      ANLALTYAHV-GKR-TLLVDGDLRRPGLT-----QLLGL--RGEP-GISEVLR-----DT
A0A517NSK8      ANLAVAFAQA-GKR-VLLIDADLRKPRVA-----KLFRL--ENTL-GLSEAIG-----GL
A0A5C5Z0D6      VNLATAFAQT-GKR-TLIIDADLRKPRVG-----RLLHL--EGSL-GLSDALR-----QS
M5UE94          VNLAMAFAQT-GKR-TLIVDADLRKPRVA-----RLLHL--SGES-GFSEALQ-----DL
A0A2E8FLY0      ANLAVAFAQS-GKK-TLLIDADMRRPGMT-----ALMDL--RGPR-GLSTVLR-----GD
A0A3D2U1E1      ANLAVAFAQS-GKR-TLLIDADMRRPGLT-----AMMDL--RGQQ-GLSSILR-----SN
E8R3W3          SYLAVSMASC-GHR-TLLVDCDFRRPMSH-----QLFGT--QKSP-GLAEIFR-----NE
A0A5C5ZM48      SQLSICLAEA-GGK-TLLIDGDLRSPDIH-----SAFDI--DPSP-GLGDVLD-----GH
A0A5B9WF77      AQLAARCGNA-GIS-TLLIDADLRRASLC-----PLLEV--PEGP-GLSDALQ-----GD
A0A518BBX8      SNLAITFAQL-GRK-TLLIDADLRKPRVH-----RLFNL--SGKK-GLVSVIR-----DG
A0A1P8WN28      VNLAASYAQT-GQR-TLLIDADMRRPGLS-----RLLEI--RGNG-GLSEVLR-----AD
A0A3B9CTT0      VNLAASFAQT-GQK-TLLIDADMRRPGLS-----RLLEV--RGNG-GLSEILQ-----AD
A0A518ALT3      TALAMSIAHA-SKMPTLIIDADLRSPDVS-----EYLDV--PSGP-GLSEVIS-----GS
A0A3M1QRP3      IMLAKSLAHI-GKR-VLLVDADLRNPSIA-----GRLGV--SG-A-GQEFLAS-----LL
A0A517TMV0      SNLAVSYAQT-GKR-TLLIDCDLRKPGLT-----ALMDL--KRMP-GVTDILT-----AG
A0A3E0MY88      SNLGTSIAQS-GKK-VLMIDADLRRPGLT-----ALFAL--KREH-GLSDVLN-----AP
A0A5B9QF68      VNLSVAMAQA-GKR-TLVIDADLRKPGFT-----SLLQL--RGRP-GLADVLT-----SG
A0A5B9QGF0      VNLSVAMAQA-GKR-TLVIDADLRKPGFT-----SLLKL--KGRP-GVADVLT-----SG
A0A5C6CK24      VNLSVAMAQA-GKR-TLVIDADLRKPGFT-----TLLKL--KGRP-GVSDVLT-----SE
A0A2E3RCU8      ANLAVVYAQS-GKR-TLLIDGDLRRPGLT-----RLLDL--KSHR-GLSDVLA-----AD
A0A1C3E6N1      TNLAVAYAQS-GRR-TIIIDCDMRRPGLS-----KTMKL--RGSY-GLSTILR-----ND
A0A518GJT2      TNLAVAYAQS-GRR-TIIIDCDMRRPGLS-----KTMKL--RGSY-GLSTILR-----ND
A0A2E8B0L9      TNLAVSYAQA-GKR-TLLIDCDLRRPGLT-----KLFQL--RGVA-GLSDILR-----GN
A0A5Q4GFE7      ANLAVSYAHS-GKR-TLVIDADLRRPGMT-----KLFEM--RSNG-GLSEILR-----GD
A0A257WS34      ANLAVAFAQA-GKK-TLLIDADLRRPGMT-----QLLGL--KGQQ-GLSHVLR-----DS
A0A7C4LP10      ANLAVAFAQA-KKK-TLLIDADLRRPGLT-----QLLEL--KGPR-GLSQVLR-----ET
A0A517MLW3      SNLAVGLAQA-GKR-TLVIDADLRKPGMT-----NLFNV--RHAK-GLSQLLV-----EM
A0A5B9QVD0      SNLATSLAQA-GKR-TLLIDADLRKPGMT-----NLFDL--RQCR-GFSQLLV-----EA
A0A3A0DET7      SNLALAMAQA-DQR-VLLIDADLRKPSQH-----TIFDL--STEK-GLATVLS-----AR
A0A3B8PNV4      ANLGVAFAQS-GKR-TLVIDADMRRPGLT-----RKLNL--KGSR-GLSTILQ-----SE
A0A3D1DR40      ANLGVAFAQS-GKR-TLVIDADMRRPGLT-----RKLNL--KGSR-GLSTILQ-----SE
A0A2E7RYU8      TNLGVAFAQS-GKR-TLVIDADMRRPGLT-----RKLNL--KGPR-GLSTILQ-----SE
A0A3B8LXG8      TNLGVAFAQS-GKR-TLVIDADMRRPGLT-----RKLNL--KGPR-GLSTILQ-----SE
A0A286RD13      AQLATSLARA-GRR-VVVVDGDLRRPRLH-----RLFRC--PLSP-GLSELAK-----NL
A0A2E3GWX1      SNTAVAFAQA-GRR-TLLIDGDMRRPGLT-----RLFDL--RGQQ-GLSSILR-----DD
F0SG60          SNTAVAFAQA-GRR-TLLIDGDMRRPGLT-----RLFDL--RGQQ-GLSSILR-----DD
A0A2E9VST2      SNTAVAFAQA-GKK-TLVIDGDMRRPGLT-----AVFAL--KGQA-GLSTILR-----DT
A0A356A6X2      SNTAVAFAQA-GKK-TLIIDGDMRRPGLT-----AVFAL--KGQA-GLSTILR-----DT
A0A5C5XLM3      SNTAVAFAQA-GKK-TLIIDGDMRRPGLT-----AVFAL--KGQA-GLSTILR-----DT
A0A7C5FXU1      GQLAIGLAQL-GHS-TLLVDFDLRRPHVD-----RFLGL--RRGP-GLAHVLR-----GE
A0A3M1VCL4      SNLAVAFAQA-GKR-TLLIDADLRRPGMT-----TLFGL--RAAP-GLSTVLR-----SE
A0A5C5V7Z9      SNLGVAFAQI-GKR-TLIIDADLRKPGMT-----SLMDL--KGQA-GVTDILL-----CE
A0A5C5YT05      SNLGVAFAQV-GKR-TLIIDADLRKPGMT-----SLMGL--KGHA-GVTDILI-----CE
A0A518D7F9      SNLAVAFAQI-GKR-TLVIDADLRKPGLT-----ALLGL--KGQP-GVTDLLT-----AR
A0A5C5ZIP0      SNLAVSYAQV-GKR-TLLIDADLRKPGMT-----ALMDL--KGKS-GVTDILT-----TS
A0A518KBK3      ANLAVSYAQT-GRR-TLVIDCDMRKPGLT-----SLLEL--KGYE-GVTDILS-----AE
A0A5C6AKF9      ANLAVSYAQT-GKR-TLVIDCDLRKPGLT-----ALLEL--KGQA-GVTDILT-----TR
A0A6M5Z0K7      TALAASLARA-RCR-TLIVDCDLRAPSLH-----RLFGV--AQTP-GVCEVLS-----RT
A0A350CI62      MNLSVAYAQS-GRR-TLVIDADMRRPGLS-----TLLGL--RDDV-GLSRLLR-----SP
A0A4P5WQK6      MNLSVAYAQS-GRR-TLVIDADMRRPGLS-----TLLGL--RDDV-GLSRLLR-----SP
A0A3C1X4W5      MNLSVAYAQS-GKR-TLVIDADMRRPGLS-----TLLGL--RDDV-GLSRLLR-----SA
A0A3D3W3A7      MNLSVAYAQS-GKR-TLVIDADMRRPGLS-----TLLGL--RDDV-GLSRLLR-----SA
A0A518DRX3      SNLGASFAQS-GKR-TLLIDCDLRKPGLS-----TLFQV--RGLP-GLSDLLR-----SS
A0A518DZF9      SNLGASFAQS-GKR-TLLIDCDLRKPGLS-----TLFQV--RGLP-GLSDLLR-----SS
A0A518AKT8      ANLAVAFAQA-GKR-TLVIDADLRRPGMT-----TLLGL--KGQA-GVADILT-----SE
A0A5C5ZR72      VALAMSFANA-SGKPTLLIDGDTRKPGVP-----DLIDL--RHGQ-GLTEVLA-----GQ
A0A7C5R0U3      VSLASSLARS-GKR-VLVIDADLRKPAMT-----RVCQL--RGRK-GLVELLS-----QE
A0A517TY85      TALAMSIAES-SKQPTLLIDADLRSPDIA-----RLLGT--PAGP-GLAELLS-----GR
A0A5B9QEI7      AALTLSIAKA-SKKPTLLIDADLRSPDVS-----SFLEV--PSQP-GIVELLG-----GE
F0SI78          SNIALATANS-GKR-TLVIDLDLRRPTVH-----KLFGL--DRDV-GVSTFLT-----SD
A0A517MDV3      TNLAVSIAQT-GKQ-VLLIDCDLRRPRLG-----TLFGL--EDEA-GLSNVLT-----GD
A0A518IQ30      ANLAVTYATA-GKR-TLLIDCDLRKPGLT-----RLFDL--RGLG-GVSQLLT-----QA
A0A517LWP4      ANLAVTYATA-GKR-TLLIDCDLRKPGLT-----RLFDM--RGLG-GVSQLLT-----QA
A0A518JNW8      ANLAVTYATA-GKR-TLLIDCDLRKPGLT-----RLFDM--RGLG-GVSQLLT-----QA
A0A2E7ENQ5      SNLGASSAQA-GKR-TLLVDADMRRPGLT-----RLFGF--RGKG-GLSDVLT-----KP
A0A7C2KUQ9      LLLAESLAQC-GKH-VLLVDTDLRNSAVS-----KRCGV--RAEP-GLVGVLT-----SK
A0A7C5BZF0      ANLAVATARA-GKR-TLLIDADLRRPGLT-----ALLNM--RGRE-GLSAVIQ-----SA
A0A1G3AQE9      ANLAVAIAQS-GKK-TLLIDADLRRPGLT-----ALMAM--RGIE-GLSSVIR-----SE
A0A3L7UQT9      SNLAVAFAQS-GKR-TLLIDADMRRPGMT-----ALLGL--KGQQ-GLSQVLR-----DE
A0A4P5YBU2      SNLAVAFAQS-GKR-TLLIDADMRRPGMT-----ALLGL--KGQQ-GLSQVLR-----DE
A0A7C7V5U8      ANLAVSYAQS-DKR-TLLIDADLRRPGLT-----ALLGL--KGFQ-GLSTVLR-----SD
                                :::* * *                      *             

A0A5S9IJB5      EVNLDDV----VQN------VDVE--NLSFLPAGV-SPP---NPI-ELVE-KERFKEIIA
A0A5S9IPR9      VS--SEEVVHKINE------------NLSCITSGK-IPA---DPY-ETIH-NSHIKELIR
A0A533Q9U4      GD-LRTV----AKE------TTIP--NVRAIACGP-IPP---NPS-ELLS-SSAMVEMLQ
A0A533Q6B7      VN-LHRV----ARV------TKVP--NLYVITSGP-PSP---NPS-ELLS-SSAMVEFLK
A0A1U9NNE1      P--FANALWYAPSA------------GFDVLGNYD-RCL---KAC-DRLS-RPEVQSNIR
A0A2G2JCA2      IP-LKDAINREWSD------------SVHLLTAGT-LMT---SPH-KLLG-TNVFDKLMK
A0A1G2XVR0      ID-YESI----IKH------VNIP--HLNIITCGL-IPP---NPS-ELLG-SHSMEKFCD
A0A1G3B0P0      ID-YESI----IKH------VNIP--HLNIITCGL-IPP---NPS-ELLG-SHSMEKFCD
A0A1E3X4X0      AS-IESC----IKD------TEIS--NLNLITSGS-VPP---NPS-EMLG-SASMEKFCD
A0A286U4B3      ND-LDSI----IKH------TAIP--NISVITCGL-IPP---NPS-EMLG-SHSMEKFCK
A0A5C6DDS2      GD-LDLI----IKP------TAIP--NLSVITCGL-IPP---NPS-EMLG-SHSMEQFCM
A0A2E3GW02      VE-WADC----IQQ------TSVP--NLDVITAGK-KNE---QYG-ELLH-NPKLASVLD
A0A5B9QNZ7      TE-LLDA----IYE------TEVP--EVSVMPSGF-RPH---NPS-ELLQ-TNEFFNLLA
A0A1Z8N7H5      DE-VSGM----ISD--YLAPTDAP--NLDVLPAGP-RRQ---NPS-ELLA-SDRLAQIFA
A0A1G2YPI3      AR-LEDA----IHQ------TEVK--GLDLLACGP-EVP---NPA-EILN-SDTFAKLLE
A0A1U7CZ81      AN-VEDV----AIP------VQGG--TFHLLCAGT-PVA---DTS-RLFQ-GRNFGMMIA
A0A142YNY8      LN-PEDL----AIP------VQGG--TFHLLSAGT-PTS---DTS-RVFQ-GRAFGMLIA
A0A1U7GLS6      LN-VEEL----AIP------VQGG--TFHLLSAGT-PTS---DTS-RLFQ-GRAFGMLIA
A0A532UIN2      TT-SGEA----IRP------TEIE--GLELLPCGA-SVP---NPS-ELLN-SDGFAQLLE
A0A0S8KNX5      VE-FEDV----VYS------IASS--GLDVLAADY-HNA--ADAY-ELLA-LPSTAHRID
A0A3D3UVZ8      VK-FEQA----VFS------VAST--GLDVLAADF-QDS--ADAY-EMLA-LPSTAKRIN
A0A517NFU9      IS-ADTA----IKP------SEIP--NLNLMANGS-PTS---DPA-ELLE-SARFSMMLS
A0A5C5YWH4      IS-ARES----IQN------TEVS--NLDLIPNGR-PTA---DPS-ELLE-SDRFGAMVA
A0A3D2TNK4      QS-APPL----IHS------TIVK--DLDVLPAGL-RRP---NPA-ELLS-SKAFIELLA
A0A7C1Y4F0      DT-IEQA----IQP------GVID--SLDVMACGP-EVP---NPS-ELLN-SDVFTETLV
A0A6I0ENW6      LT-TKDV----LFH------ADVL--GVDVIPAGD-RAS--VDDA-ERMA-NGRFGQALK
A0A6L3A0B7      LT-TKDV----LFH------ADVL--GVDVIPAGD-RAS--VDDA-ERMA-NGRFGQALK
A0A0J1B4A0      AT-LAEC----VQA------SEQD--SLTLCTSGS-RTS---EPS-ELLE-SDQWVAFLD
A0A142WSB9      IP-LESG----LKA------TPVA--NLSVLTAGI-PPE---NPA-ELLS-TSNLEGLVQ
M5SZR3          AE-PTDA----IRA------TPVH--NLWLLSAGQ-KTP---DPA-ELLT-STRFAELMA
M5TW92          AE-PTDA----IRA------TPVH--NLWLLSAGQ-KTP---DPA-ELLT-STRFAELMA
A0A2S8FKY2      AK-LADS----IRP------TDIP--NVDLLPAGI-KEQ---SVP-RSAS-TGRLDQLFA
A0A517N8P6      GQ-LADI----VVP------TDTE--DLFVLASGP-RPN---NPA-EALM-MPEFGQILD
A0A432MJP4      ST-WREV----LQP------SAAE--DLRIMTTGG-PVE---NPA-ELLM-SERFRSLVA
M5UQ35          AG-FEDV----LHP------CEQA--GLFVCTDGS-RTS---QPA-ELLE-TDRFAEFMA
A0A0S8FY64      RA-LQEI----VQQPSDGQLEGLQ--NLYVLSAGA-KTP---NPA-ELLG-SSAMARLVR
A0A1N6KFT7      LP-LSRV----VQQ------TQIE--NLDFIASGS-DVD---NPA-ELLA-SSALTDFVA
L0DFG4          LP-LSRV----VQQ------TQTE--NLDFIASGP-EVD---NPA-ELLA-SATFTDFVS
A0A5C5XXG1      MD-LDDA----IKP------TEAD--GVSVITAGA-STR---TPA-ELLQ-SEKLEELTQ
A0A7C7YUM8      AV-WRDC----IQD------VGEE--NLSLLPAGQ-TST---SPG-ELLA-SRAALNLVE
A0A7C2AHI6      AD-WREC----VHR------TELE--GLAVLCCGS-WRG---TPG-EALS-GERPAQLID
A0A518BJJ1      SE-WRDV----ARS------TDNP--LLSVIPAGV-LRA---SAG-DALG-TTKAQELID
A0A518D182      AD-WRER----RQP------SGRD--HLDVLVAGR-SRQ---VSA-DLLG-SDAMSELVD
A0A5C5WTY6      AT-LDEV----IQS------TKSD--DFKVITSGE-ISL---DSP-EWLQ-TAALEELLR
A0A5C5Y033      LP-LAEV----IQP------TEIE--NLSAISAGK-TPE---NPA-ELLQ-GVNLDKAIE
A0A5C6G1Y2      LP-LADV----IQP------TEIE--NLSAISAGK-TPE---NPA-ELLQ-GVNLDKAIE
A0A354PDV6      LE-PMEA----IRD------TDVE--NVHVLPAGA-PTS---TPA-ELLQ-SPRFDQLLE
A0A5C6FZ02      ME-LDDA----IKP------TEAD--GVSVITAGA-STR---TPA-ELLQ-SEKLEELTH
M5TIT3          LA-FEDA----VKE------TRAD--NVFVVTGGA-TSP---RPA-ELLQ-SDKLGEVLE
A0A5M6CY44      TS-IEET----IRS------TAID--NVSVMTAGS-STK---TPA-ELLQ-TSRLDEILD
F2AXG2          LE-IPES----IKV------TEAE--NVSVMTAGS-SSQ---TPA-ELLQ-SQRLDEVLA
M2BB46          LE-IPEA----IKV------TEAD--NVSVMTAGS-SSQ---TPA-ELLQ-SQRLDEVLA
L7CLQ6          LE-IPEA----IKV------TEAE--NVSVMTAGS-SSQ---TPA-ELLQ-SQRLDEVLA
A0A0J1B719      LE-ISEA----IKA------TEAD--NVFVMTSGS-SSH---TPA-ELLQ-SQRLDEVLA
Q7UF18          LE-IPEA----IKV------TEAE--NVSVMTAGS-SSQ---TPA-ELLQ-SQRLDEVLA
A0A2G1W1E0      LE-IPEA----IKA------TEAD--NVFVMTSGS-SSQ---TPA-ELLQ-SQRLDEVLA
K5E235          LE-IPEA----IKA------TEAD--NVFVMTSGS-SSQ---TPA-ELLQ-SQRLDEVLA
A0A5C6FFI9      AT-LEDS----TVA------SSVE--NLDILPHGK-ATS---VPA-ELLQ-SNRMSVLVQ
A0A5C5WDJ1      IP-FEGA----VTR------TEVA--NLDIVPNGG-PTA---EPA-ELLE-SVQLTRLLQ
A0A5C5X547      ET-LDGA----LKY------IEED--KLTVIPAGN-VES---EVY-LESY-SGMLAELFA
A0A353FIP5      SP-CEDL----AQQ-----VSSIP--NLHILPSGK-VDVGGINPG-DLLA-QEKMSEIAD
A0A5B1CIK7      AE-FADV----IKE------TDAE--NVSVITAGS-SPK---MAA-ELLQ-SEKLDEILS
A0A5C5WHS2      EQ-FKDM----IRE------TEAE--GVHVVTAGS-SPK---MAA-ELLQ-SDKLDEVIA
A0A5C6B6G8      LQ-LADV----IKD------TDAE--KVSVITAGS-SSK---MPA-ELLQ-MEKLDELLE
A0A5C5ZZN3      TP-FADA----IKE------TRAD--NVWVIPAGS-SSS---TPA-ELLQ-SSKFDEILR
A0A5C5XS91      ID-FNEA----VKE------TKVD--NVHVMPAGS-SST---SPA-EFLQ-SEELDEVLA
A0A5C6C4E6      IS-FEEA----VKE------TKAD--NVYVMPAGS-SST---SPA-EFLQ-SEELDEVLA
A0A2E1VVJ1      NP-WQDC----VHK------APVA--NLDVLPAGA-MVK---NPG-DLLA-SEGLVQLTE
A0A3M2AEL0      AS-PEKL----MHP------TNID--GLSVLTAGS-RTA---RPG-DLIA-SPAMQGFLQ
A0A2A2W9R6      VC-FSES----LHE------CEQI--NLTLCPAGS-RTS---APS-ELLE-SESIAEFIA
A0A518HKC1      VC-FSES----LHE------CEQI--NLTLCPAGS-RTS---APS-ELLE-SESFGEFIA
A0A518L3P0      VC-FSEC----LHE------CEQI--NLTLCPAGS-RTS---APS-ELLE-SDSFAEFIA
A0A255R1S0      AT-LMEC----LHH------TEQE--NLVICPSGS-RTS---SPS-ELLE-SDRFLEFIE
A0A5B9MKP1      VS-FSEC----QQD------CEQL--NLAVCPAGS-RTS---SPS-ELLE-SEQFAEFIA
A0A0S8J591      DS-----ATVYIKK------TDIE--NLHVLPGGP-IPS---NPA-ELLG-SRKMRTLVA
M5RT57          AT-LDEA----VIR------DWSD--QIHLLPAGR-LRV---NPH-QLMT-RESLNKIFN
A0A351FYP6      NT-LDEV----IQT------SESP--NLHFIPSGK-LPS---SSM-GVLN-SAKMKEFVA
A0A2E7ESJ6      AEPADAWQEIPFVP------------NLRIMACGP-RPE---NPS-ELLS-SESFANVLQ
A0A2D5AWU0      IT-TDKV----IVQ------NVAA--GLDLMPAGD-PFG---KPA-ELFE-SGLFPKLLD
A0A1G2YQB7      K--LRDL----LMH------ADTP--GLAVLTAEP-CDI---AIINKLIH-HKNLVEFIN
A0A353P687      K--LRDL----LLY------SDVP--GLSVLTAEP-CDI---SIINRLIH-HKNMVEFIN
A0A356EME5      CD-LHEA----IVP------TWTP--SVDVLPGGE-AKQ---NVH-KLVG-NGELSAILR
L0DC26          ID-IVGA----VQP------TVIS--GLSLLTAGF-SDS---DSI-QALA-SLDLRAMFD
A0A3L7P4E4      SLDVNEC----IES------VTFEGSTLDILSSGE-CPI---DPG-ERLM-SDRMESLLN
A0A3L7PEB5      PPDINEC----IQT------VSFEGSNLDILASGE-CPI---DPG-ERLM-SNRMENLLS
A0A1U9NL64      SQ-IDSV----IKN------TSID--GLDVLACGP-SIP---NAS-ELLN-SDEFGELLS
A0A2N1UCJ3      IS-LDDA----IRS------CPTD--GLFLLTSGP-EIL---NPS-ELLN-SEAFSNLLK
A0A7C4EK84      VP-LDKA----IAP------TGIE--NLDVLPCGP-PPA---NPS-ELIN-SQAFGAMLQ
A0A7C3F0T2      EP-LDAA----IHH------TEVK--CLDILPTGP-TPP---NPS-EMLN-SPAFADVLD
A0A2E0X4J3      RP-AADA----MQA------TDVD--NLTVITSGP-VPS---HPV-ELLN-NGYFADLVT
A0A5C5YU10      RP-IEEL----IVS------SEIG--TLDFLPAGP-TPS---NPL-ELLN-NDYFAEMLE
A0A517MPZ6      RP-ADEV----IQR------TEVD--TLDLLPCGS-RPT---NPV-ELLN-NGYFSELLH
A0A5C6CNV7      RP-VREL----IVS------TEVV--NLDLLPCGV-CPA---NPV-ELLN-NGFFSELLD
A0A518K5H4      VL-AIEA----VVS------GVAP--NLDLLPCGP-IPP---NPV-ELLN-NGMFSEVLE
A0A5C6AA28      TP-AIEA----VVA------TSVP--SLDLLACGR-IPA---SPV-ELLN-NGNFSEALE
A0A2E9VK20      IE-MANA----VQD------SGIE--NLHILSAGA-IPA---KPA-ELLS-SSKLHYLLG
A0A3D4PJK1      IE-MANA----VQD------SGIE--NLHILSAGA-IPA---KPA-ELLS-SSKLHYLLG
A0A532UT69      AT-LEDI----AEK------TDIK--DLDLLPCGE-QLI---NAS-EVLN-SKSFTTLLK
A0A355AI52      EE-VAEQASGLAIQ------TGSV--PVDIIPAGR-RPP---NPG-ELLL-GDRFAELLA
A0A354PCQ3      AS-LLDA----VNS------RLGN--LIHLLPAGQ-LTA---SPH-RLMS-PERLQEFMR
A0A0S8GZ23      KK-FEET----VRS------VPLS--GLDVLTADGRNPA---EAV-ELLE-KPQTAECIN
A0A1I3DDV4      TK-LDEV----IRP------TGIE--GLSVMTAGS-AVR---NPA-ELLQ-SEVFDQVLE
A0A2E0SMM6      EP-IHQCAVELIQP------SGAP--NLDILPSGG-RPV---NPS-ELLS-SNRLSDFLA
A0A3L7SI46      TP-VAECCLENIFN------LGIE--NLDVMPSGS-RPA---NPS-ELLA-SDRFNDILA
A0A356KTN1      V----EDLGERLRR------TQVE--NLWVMGAGR-CEA---NPG-ELLARDDTFHQLVW
A0A5B9PJZ8      ME-PEEA----VRV------IQPE--YLSVVTCGP-IPP---NPS-ELLT-SARFEAIIG
A0A2S8G191      VE-IQDA----IQE------TGMR--NLDIIAAGD-WGH---NSF-RELT-SNRMDAFFK
A0A2E7EGG1      CD-FEDA----VNR------EWSE--HVHVLPAGY-LDR---SPH-KLMA-NEGFKQLIA
A0A2E2N5A9      AS-LESC------I------TQVS--GVDMICAGT-AVR---DPL-SLLS-SSRFSALIE
A0A7C8AGA2      EF-TKL-----VYN------TGTV--GLDVLAADHRNVS---DAL-DLLG-KPRTGQSIE
A0A7C2FXP7      PL-AES-----VYR------IGST--GLDILAADSRNVS---DAL-NLLS-QKNTAQCIR
A0A2E3GWC6      LE-LLNA----IQP------TKIE--NLSVLSAGA-IPA---KPA-ELLS-SAKLHYLFG
F0SLB0          LE-LLNA----IQP------TKIE--NLSVLTAGA-IPG---KPA-ELLS-SAKLHYVFG
A0A3L7NDH9      QP-VSDHASACIRR------SGSV--PIDIIPAGQ-RPS---NPA-ELLL-SERFSELLS
A0A1N6DAJ8      VD-VADA----IQP------TAAG--GLWLLPAGL-CDS---DSI-QALA-CRDLRAMFD
A0A532UD06      VR-LDEA----IQP------GPVT--GLDLLSCGS-QVP---NPS-EMLN-SDVFAQMLK
A0A660URN1      IT-LDEA----IEA------GPVE--GLDILPCGP-EVP---NPS-EILN-SDTFANMLN
A0A517ZCB5      RS-VEEAIDTLPHH------TELP--NLDVLPAGP-RPA---NPV-ELLS-GDRLSMLVA
A0A225EH48      VD-VSDA----VQP------TTVP--NLWLIPAGQCSNR---VIA-ALAQ-GHPLETLFN
A0A518INW8      AG-LDEV----AVP------SEIE--RLDFISHGH-HAS---EPA-ELLE-SFALERLIA
A0A518JPH9      AS-LEEV----TVS------SEIP--GLDFICHGH-HAS---EPA-ELLE-SFALETLIA
A0A5C5VEK8      RP-VEDF----IIP------NALG--SLDFLPAGP-SPS---NPL-ELLN-NDYLIEVLE
A0A532UTJ0      -----VKFEQAVYS------MAST--GLDVLAADFDNAA---DAY-EMLA-MPATKKRIN
A0A432MFP3      AQ-LEDAL---VPI------SQVG--GCQLLPAGS-PEA---YPN-RILR-GKAFAPMLE
A0A2E2CCW9      ID-AQTA----IRE------TRVS--HLSILTAGM-LPE---NPS-EMLM-SRAFSELVN
A0A3C0AGX3      ID-AQTA----IRE------TRVS--HLSILTAGM-LPE---NPS-EMLM-SRAFSELVN
A0A518AAQ5      ID-AQTS----IRE------TRIS--NLSILTAGM-LPE---NPS-EMLM-SRRFAETVN
A0A517QBG9      ID-AQTS----IRE------TRIS--NLSILTAGM-LPE---NPS-EMLV-SRRFAETVN
A0A518FTU3      ID-AQTS----IRE------TRIS--NLSILTAGM-LPE---NPS-EMLV-SRRFTETVN
A0A517WHH5      ID-AQTS----IRE------TRIS--NLSIMTAGM-LPE---NPS-EMLM-SRRFAEMIS
A0A5A8BGT3      ID-AQTS----IRE------TRIS--NLSIMTAGM-LPE---NPS-EMLM-SRRFAEMIS
A0A2E7K7A9      ID-AQTS----IRE------TRIS--NLSILTAGM-LPE---NPS-EMLM-SRRFAEMVN
A0A517PTS5      ID-AQTS----IRE------TRIS--NLSILTAGM-LPE---NPS-EMLM-SRRFAEMVN
A0A6I6AH34      ID-AQTS----IRE------TRIS--NLSILTAGM-LPE---NPS-EMLM-SRRFAEMIN
A0A517VTK3      ID-AQTA----IRE------TRIK--DLSLMTAGT-LPE---NPS-EMLM-SKRFTHLLK
A0A517WQT4      ID-AQTA----IRE------TRIK--DLSLMTAGT-LPE---NPS-EMLM-SKRFTHLLK
A0A517VID8      ID-AQTA----IRE------TRVS--HLSILTAGM-LPE---NPS-EMLM-SRGFSELVN
A0A517RK10      ID-AQTA----IRE------TRIS--NLSIMTAGT-LPE---NPS-EMLM-SRRFIDLIK
A0A518IH18      ID-AQTA----IRE------TRIS--NLSIMTAGT-LPE---NPS-EMLM-SRRFTDLIK
A0A5C5XLF4      IE-MANA----VQD------SRIE--NLDILSAGS-IPA---KPA-ELLS-SSKLHYLLG
A0A2D5NDU9      LR-LIAA----VHE------TEVD--GLDLLAAGT-PPS---NPT-EILN-SEKFGDLIA
A0A1P8WP26      DE-FDEAVQGNLRA------TAVD--GLDVISCGP-RPV---NPA-ELLS-SERFANLLA
A0A3L7V1F3      DE-LEVSIERNLRK------SDVK--GLDVISCGP-RPV---NPA-ELLS-SERFSNMLA
D5SZ21          DS-IENSLRNNVVV------SDLA--GLDIIPAGP-RPA---NPL-ELLS-STRFSELLA
A0A286RGB6      IS-LKDV----VRP------TELE--NLFVVTAGY-WSP---HRM-AVLA-NGVIGGLFR
A0A518CHE5      EP-VDQCAVELIQP------SGSP--NLDILPSGS-RPV---NPS-ELLS-SNRLSDFLS
A0A1V5N3W2      RR-WEEA----VYT------LPEA--GVQVLTADHRNNG---QAI-DQLA-RPETAEIIR
A0A3E0MY27      AA-VEEA----IRP------SRAP--GLWVMPAGR-CDH---ESI-QSLT-KEILGATLE
A0A7C4Z5R7      AH-ASEC----WRA------SRIE--GLSVLPAG--HGD---HFR-SPLT-QEAVQLVFE
A0A2E0X9P6      LP-AVET----IAQ------VGSS--TAFLLPAGR-SQD---NPH-HLLL-GGRIKELFD
A0A286RLF2      AP-IAEAIQARLKK------NIVP--DLDVLPCGR-RPA---NPA-ELLA-GPRTAELLN
A0A517NSK8      AD-AADV----ISD------TVVD--NLWAVGSGA-VPA---NPA-ELLQ-SEDFASLLK
A0A5C5Z0D6      LD-PSKV----VQT------TVQD--NLFAVSAGS-IPE---NPS-ELLQ-SDKFAQLLN
M5UE94          CD-PTDV----VQS------TVSD--NLFAVSAGA-IPA---NPS-ELLQ-SDRFSQLIN
A0A2E8FLY0      EP-IANTATANLFA------TELG--TLDVMPAGP-RPL---NPA-ELLH-GDRFSELLA
A0A3D2U1E1      LP-PDTATQGNVFS------THLE--HLDVIPSGA-RPA---NPA-ELLH-GTRFSELLA
E8R3W3          ID-LWSA----IQT------TSFN--LLSTLAAGE-GDP---QTI-ELLN-HNLLAGLIE
A0A5C5ZM48      AS-LQQT----VVA------AEQP--GLWVLPAGK-AVS---TPH-RKLS-WLQ-ERVLA
A0A5B9WF77      VK-VDEL----IIP------VQGG--TFHLLAAGT-PVP---DAS-RIVQ-GRSFPMLIA
A0A518BBX8      AD-LDDV----IHD------TGID--GLSVIPCGP-LPE---NPA-ELLT-SPHFEELVE
A0A1P8WN28      SD-IPQMCKERVVQ------TEVP--LLEVLPCGP-RIL---NAG-MLLS-MPALADILD
A0A3B9CTT0      GG-IAELASERVTP------TDVD--GLYVLPCGP-RIL---NAG-TLLS-MPALSELLD
A0A518ALT3      VP-LNEA----IYR------VGDS--LTFVLPAGS-ERI---NPH-QVVE-GSAIPDLLR
A0A3M1QRP3      DA-QAGQTPRRDRA------TNVP--GLRVLVSSRPARL---EES-EILA-GVAPQRCLD
A0A517TMV0      GD-IAAIAERCVRR------TDLE--TLDVIPAGP-RRP---DPA-ELLL-GPNLAELLA
A0A3E0MY88      EP-VEEVATRYVRG------TGIP--DLDVLPSGP-RRP---NPA-ELLT-SRRLADLLA
A0A5B9QF68      LS-PAESAPSMVVA------TEVP--GLDVLPVGL-RRP---NPA-ELLS-SHEFVELLA
A0A5B9QGF0      LS-PSESAPSMVVE------TEVP--GLDVLPVGL-RRP---NPA-ELLS-SNEFVELLA
A0A5C6CK24      RS-PAESAPDLVVH------TEVP--GLDVLPVGL-RRP---NPA-ELLS-SNEFVELLA
A0A2E3RCU8      DP-IQEIIPGHVVP------TAAA--NLDVLPAGP-RRQ---NPS-ELLA-SDRLAQILA
A0A1C3E6N1      DS-IENSLRNNVVV------SDLA--GLDIIPAGP-RPA---NPL-ELLS-STRFSELLA
A0A518GJT2      DS-IENSLRNNVVV------SDLA--GLDIIPAGP-RPA---NPL-ELLS-STRFSELLA
A0A2E8B0L9      DE-VPAMCEERIQA------AGVD--GLDVLVCGP-KPP---NPV-ELLT-DSRFVDVIA
A0A5Q4GFE7      SP-IDAMCRPRVLP------SGIA--HLDVMPCGP-KPS---NPA-ELLS-GPRLADVLA
A0A257WS34      RP-VQESCLDNIFH------LGQE--NLDVMPSGA-RPI---NPS-ELLS-TERFSDVIA
A0A7C4LP10      AP-IADSALENIFH------LGVE--NLDVMPSGP-RPA---NPS-ELLS-SERFNDLLA
A0A517MLW3      SP-VDVV-DKYVMS------TGID--NLELIPCGA-RPL---DPA-ELLA-SNALSDIVQ
A0A5B9QVD0      NV-AATV-KSYIQP------SGIE--DLDLLPSGA-RPL---DPA-ELLS-GPRFSEVLE
A0A3A0DET7      MP-VGDA----IVR------LRES--SLEVLPCGP-LPA---NPV-ELLN-NGYFAELLE
A0A3B8PNV4      DP-IAVSAAGNLFA------TELG--SLDVIPAGP-RPT---SPA-ELLH-GGRFAELIA
A0A3D1DR40      DP-IAVSAAGNLFT------TELG--SLDVIPAGP-RPT---SPA-ELLH-GGRFAELIA
A0A2E7RYU8      EP-IGISAASNLLA------TELN--SLDVIPAGP-RPG---SPA-ELLH-GGRFAELIA
A0A3B8LXG8      EP-IGISAASNLLA------TELN--SLDVIPAGP-RPG---SPA-ELLH-GGRFAELIA
A0A286RD13      AR-PEEI----VRN------AEIE--NLYVVTAGH-CDG---EVL-EAVS-QGKLDRFLQ
A0A2E3GWX1      QT-IEESAKANMVH------TGLM--NLDIIAAGP-RPS---NPV-ELLT-SDRFAELIA
F0SG60          QT-IEESAKANMVH------TGLM--NLDIIAAGP-RPS---NPV-ELLT-SDRFAELIA
A0A2E9VST2      AS-IEESALKHITK------TRLE--NLDVISAGP-RPS---NPV-ELLT-SERFEELIG
A0A356A6X2      AT-IEESASKYITK------TRLE--NLDVISAGP-RPS---NPV-ELLT-SERFEELIG
A0A5C5XLM3      AT-IEESASKYITK------TRLE--NLDVISAGP-RPS---NPV-ELLT-SERFEELIG
A0A7C5FXU1      IS-L----EDAVQD------TEQP--LLRVLPAGA-WTD---DLL-SRIL-NGVGQEFFA
A0A3M1VCL4      EP-LQVALQGCLFQ------SGCA--GLDFIPSGP-RPS---NPA-ELLG-SPRFVDLLA
A0A5C5V7Z9      GG-VAELAERCLVK------TPLE--KLDVIPAGP-RRP---DAA-ELLS-GPNFTELLA
A0A5C5YT05      GA-IGALAERCLVK------TGLD--KLDVIPAGP-RRP---DAA-ELLS-GPNFGELLA
A0A518D7F9      GE-MSKLAPGVVRK------TDQP--GLDVIPAGP-RRP---DPA-ELLV-GPALTELLA
A0A5C5ZIP0      GD-VAAEARRCLLK------TEQP--NLDVIPAGP-RRP---DPA-ELLL-GPNFSELLA
A0A518KBK3      GN-VGLIAQRCVVR------TALE--SLDVIPAGP-RRP---DPA-ELLL-SPNFAELLA
A0A5C6AKF9      DD-VAAVAERCVLR------TALD--TLDVIPAGP-RRP---DPA-ELLL-GTNFADLLA
A0A6M5Z0K7      AR-VEAV----IRP------TAAE--CLDVLAAGEMSEA---AAA-GLAS-PGAVQRLIE
A0A350CI62      DD-LDTAIAANLRT------TVVQ--GLDVISCGP-RPV---NPA-ELLS-SERFAALLS
A0A4P5WQK6      DD-LDTAIAANLRT------TVVQ--GLDVISCGP-RPV---NPA-ELLS-SERFAALLS
A0A3C1X4W5      DD-LETAIAANLRT------TVVQ--GLDVISCGP-RPV---NPA-ELLQ-SERFAALLS
A0A3D3W3A7      DD-LETAIAANLRT------TVVQ--GLDVISCGP-RPV---NPA-ELLQ-SERFAALLS
A0A518DRX3      EP-VGAMCEQRILS------TGIP--DLDLLPCGP-KAF---DAA-ELLS-GSRIEELIA
A0A518DZF9      EP-VGAMCEQRILS------TGIP--DLDLLPCGP-KAF---DAA-ELLS-GSRIEELIA
A0A518AKT8      EP-TASIAPRHVVH------TDEP--RLDVIPAGL-RRP---NPA-ELLS-SQEFIELLA
A0A5C5ZR72      ----CTLDEALQPA------RGVA--NLQVLPAGK-SRS---DHQ-LLLQ-PQRLSQLIE
A0A7C5R0U3      GV-TCEEDPPVVSV-------APL--GIDVLPAGR-KTA---DAA-ELLQ-RDALVRLLA
A0A517TY85      ----ATLREVIHRV-------GET--EAFVLPAGK-LRG---SPH-HIFE-GVKIEGVLK
A0A5B9QEI7      ----VALEKAIHRV-------GKT--QAYVLPAGV-LKG---NPH-HLID-QAKIEKLLD
F0SI78          VE-----WADCIQQ------TSVP--NLDVITAGK-KNE---QYG-ELLH-NPKLASVLD
A0A517MDV3      TE-L----VDSIHE------TPIE--NLSVMPSGF-RPS---NPS-ELLM-GKTFFEMLE
A0A518IQ30      DT-VEPVWGNEVKA------TGIG--NLSIIPAGP-RPQ---DPT-ELFS-SSHFGELLA
A0A517LWP4      DV-VAPIWNHEVKG------TGIP--NLSIIPAGP-RPQ---DPT-ELFS-SSHFGELLA
A0A518JNW8      DV-VAPIWANEVKG------TGIP--NLSIIPAGP-RPQ---DPT-ELFS-SSHFGELLA
A0A2E7ENQ5      ND-LNELCEERIQK------TALA--GLDVLPAGP-LPT---DPS-GLLT-NRRFAEFVA
A0A7C2KUQ9      -----ATDAEAVSH------YNGT--DLDVLPAGRLGAS---HDP-ELLA-NGMIAASLK
A0A7C5BZF0      ED-LETIARANIRR------TTLE--CLDVLPCGP-RPA---NPA-ELLS-SQRFSELLA
A0A1G3AQE9      ED-IVRAAVAHIRP------SGLA--GLDVLASGP-RPS---NPA-ELLS-SQRFSELLA
A0A3L7UQT9      RP-IAASVAENLFT------QITP--GLDVIPSGS-RPS---NPA-ELLA-SERFSELLA
A0A4P5YBU2      RP-IAASVAENLFT------QITP--GLDVIPSGS-RPS---NPA-ELLA-SERFSELLA
A0A7C7V5U8      RD-VGELAAAHIRP------SGLE--GLDVLPSGP-RPS---NPA-ELLA-SPRLADLLA
                                                                            

A0A5S9IJB5      ECEQKYDYVIIDCPPIAIVADGVSVS--KVCQTGLLVVKNFKTPAKAVHIAKDVLSSNQV
A0A5S9IPR9      ELEHEYDYILIDAPPIGITTDALLLG--KKLGGLLFAITVHRTPKRMVKQLIHRMQTLDI
A0A533Q9U4      LAKEEFEWIIIDSPPILTVTDARILA--RVADGAVFVIKSNKTTKDAARKAIDHFSDMRD
A0A533Q6B7      VAREEYDWIIIDSPPLLTVTDGSILA--RMVDGIVFVLRNKKTSIAIAQKGAGCISAVHD
A0A1U9NNE1      NLCRYYDHVVIDTPPVLAFPDALLWA--RIADATILASFAGKTAADDLKEAYGRLHELNI
A0A2G2JCA2      GVRGRYRYVVLDTPPVLAASEALVMA--KQADVSLVCAMRDVSRISQVQSVVERLESVGA
A0A1G2XVR0      NVRNRFDIIIFDTPPTMTVTDAVVLS--RNVDGVVFVIKSGQTPKELTRRALLQYKNSKS
A0A1G3B0P0      NVRNRFDIIIFDTPPTMTVTDAVVLS--RNVDGVVFVIKSGQTPKELTRRALLQYKNSKS
A0A1E3X4X0      DIRKMFDYVLLDSPPIMSVTDATILA--RLTDASLLLVKTGETNRDAVKRSIAQFNDINA
A0A286U4B3      EIMDRFDTVILDTPPAMAVTDTIVLS--NMVDGIIYVIKSGKISKESARRSLHQFAGKKA
A0A5C6DDS2      EVRERFDTVIFDTPPSLAVTDTVILS--NIVDGIIYVIKSGVVAKEAAKRSLSQFAGKKG
A0A2E3GW02      ALRDKYDVIFIDSPPVLAVADATAIA--PLADSLLLVIKNSKHSRPHAKQARESLDLVGA
A0A5B9QNZ7      AVREKFDYVLLDSTPLLAVSESASIG--QRVDGVVLALRTANTSRPEAERAVQRLQSVGV
A0A1Z8N7H5      WAETKYDQILVDCPPTLVASDAVLVG--RIVDGMVLIVRPDKNRRKLVXRAXQNLTEMKI
A0A1G2YPI3      RLSNKYDRIVIDSPPVMPVTDAQILA--AICDITLLVLRAEKSTRRNCLQAKHGLLSVGA
A0A1U7CZ81      RLRQMYDLIIIDSPPVLPVPDGLIMG--RWTDGAVLASRYDISRAPQVERARRQLTNAGI
A0A142YNY8      RLRQLYDLIIIDSPPILPVPDALIMG--RWTDGVVLTSRYDVSRAPQVERARRQLDLAGI
A0A1U7GLS6      RLRQLYDLIIIDSPPILPVPDALIMG--RWTDGVVLASRFDVSRAPQVERARRQLDLAGI
A0A532UIN2      ILSDRYDRVIIDSPPVMPVTDAQILA--AICDVTLLVLRAKKSTRKTSQQAKDGLSSVGA
A0A0S8KNX5      TISKKYDHVIIDTPPALGFPDALLWA--KVGDAVILTSFAGHTTMPDLKEATDRLAQINV
A0A3D3UVZ8      AISRKYDHVIIDTPPALVFPDALMWA--KIGNAVILVSYAGHTTMPDLKEAKERLLQINV
A0A517NFU9      EMSLHFDLVLIDAPPLLAVADPAIIA--PIVDSVVMTIRVSKNGRRPVEQATKILQDIGM
A0A5C5YWH4      ELTQRYDLVLIDAPPLLAVADPAIIA--PLVDAVVLTVRVNKHARGPVEQASKILQDQGL
A0A3D2TNK4      WAESKYDRVIVDCPPVLAVSDAQIVG--RLVDGAILVVRPEKNHRRSVMRAVESFHATGC
A0A7C1Y4F0      KLTEQYDRVVVDSPPVGPVADAQILS--TVCDITVLVLRAEKSTRRQAQHARDSLLSVGA
A0A6I0ENW6      EWRGSYDFVILDSAPVLPVADARILA--GQADGTIMAVRASQTRRAEAMEALAELSAAGA
A0A6L3A0B7      EWRGSYDFVILDSAPVLPVADARILA--GQADGTIMAVRASQTRRAEAMEALAELSAAGA
A0A0J1B4A0      LARKTYDVILIDTPPLLAVADPSIVA--DEVDGVFLAVRIEKNNRTLVERATEVLTDKGI
A0A142WSB9      ELRGRYDFVLFDSPPVLAVSDPCIIA--PQADAMLLVVRLEKNNRTVLRRACEQLDAHGI
M5SZR3          QFREDYDYVIVDSGPLLAVSDPRIVM--AHTDGLLLSVRLDKTTRKQAETAREILLSLDA
M5TW92          QFREDYDYVIVDSGPLLAVSDPRIVM--AHTDGLLLSVRLDKTTRKQAETAREILLSLDA
A0A2S8FKY2      DLRKSYDFIIVDAGPVLGSPSTRFLAQPQHVDGVILSIFKDVSQVAQVDDAKRILNSFGA
A0A517N8P6      EARLQFDLIIIDTPPLLAVTDASNVA--TYADGVMVVMRIGRNIKPMSKRAITMLRMLHV
A0A432MJP4      ELRGEFDRVLIDTSPLLYVADPSIVA--PSADGVLLVLRPSEIRRAAMHRVAEVVQMMGT
M5UQ35          EARSAFDVILIDTPPLLAVADPVIVS--EHVDGCLLAVRVAKNNRTIVQRAAEILDEHGS
A0A0S8FY64      QSREQYDVVIFDSCPAMFVADAAPIA--SGCDGVVIVLKASKSRCKAADRARRQLAAVNG
A0A1N6KFT7      EIRNLYDMVVFDSSPLLAVTDPSILS--AVVDGVVLVVRPEATKRHDAERTVELLKTMES
L0DFG4          EIRNIYDMVVFDSSPLLAVTDPSILS--AMVDGVVLVVRPEATKRHDAERTVELLKTMES
A0A5C5XXG1      QLEERFDLVIFDLPPVLAVSDPLVVA--PRIDGMVLVIRAASARRDEVMNSLKRVTDAGG
A0A7C7YUM8      EMKEAYDLVVFDLPPAVVVADVAGFA--ANLDALLMVYRSGVVPGRVLTSAVNKLRQADV
A0A7C2AHI6      EFLAEYDVVLFDLPPAVVVADVEAFA--HKLDAIVLLYRAGGVPREVFQAALRRLKTSRA
A0A518BJJ1      EFTKSYDLVVFDLPPALAVADVETFA--HRLDAVLLLYRSDGLPREAVSLATTRLRQAGA
A0A518D182      EWLAEYDLVVFDLPPALVVADVEVFA--HRLDAIVLLYRAGGLPSRVVENTAKRMRASGA
A0A5C5WTY6      QT-EDFDLVLFDLPPVLAVSDAAVVL--PRLDASLLVSRVATNKRHQVINAAKRIDAAGG
A0A5C5Y033      SLSNHFDLVLVDLPPVLAVSDPAVVL--PRLDGAVLVVRVARIRREQLANALQRLQSTGA
A0A5C6G1Y2      SLSNHFDLVLVDLPPVLAVSDPAVVL--PRLDGAVLVVRVARIRREQLANAMQRLQSTGA
A0A354PDV6      ILKEKYDVVLLDLPPVLAVSDPLVVA--PKVSGVVVVFRAVTARKSEVANTLRRLSSAGA
A0A5C6FZ02      QLEERFDLVIFDLPPVLAVSDPLVVA--PRIDGMVLVIRAASARRDEVMNSLKRVTDAGG
M5TIT3          AAKTQFDLVLVDLPPVLAVSDPIVVM--PRLDGGILVVKIANVRRDEVVNTLHRVESAGG
A0A5M6CY44      ELKQEFDVILLDLPPVLAVSDPVVVL--PRIDGSVLVIRVSRARRDEVLNTMRRIRESGG
F2AXG2          VVREDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGG
M2BB46          VVKEDFDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGG
L7CLQ6          VVKEDYDLVLVDLPPVLAVSDPVVVL--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGG
A0A0J1B719      VVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGG
Q7UF18          VVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGG
A0A2G1W1E0      VVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGG
K5E235          VVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGG
A0A5C6FFI9      EARRTYDLVLIDAPPVLAVADPSIVA--PLADGVILTVRIAKNGRRPVEQAGRILNDNGI
A0A5C5WDJ1      EACAKYDLVLIDAPPVLAVADPAIIA--PMVDSVLLTVRVIKNGRSIVEDAVRVLHDIQV
A0A5C5X547      TLQEQYDFVIVDCCPVLPVVDARIVS--EYVDGVILALTRDVSVVPDAISARDILRSHGA
A0A353FIP5      SLRGAYDYVFFDVPPVLAVADASSFL--NRLDAILLLVRFNLSSESEVAGACHRLKLAGA
A0A5B1CIK7      QAKEQYDLVIVDLPPVLAVSDPIVVM--SRLDGGVLVVRVANVRRDEVINTMRRIAASGG
A0A5C5WHS2      EAREMYDLVLVDLPPVLAVSDPIVVM--PRLDGGVLVVRVSRVRRDEVINTMRRIESSGG
A0A5C6B6G8      ELKQQFDVVLVDLPPVLAVSDPVVVM--PRLDGGVLVIRVARVRRDEVINTMRRIRSSGG
A0A5C5ZZN3      MASTQFDLVLVDLPPVLAVSDPVVVM--PRLDSGILVVRVANVRRDEVINTIRRIESAGG
A0A5C5XS91      TARSQFDFVLVDLPPVLAVSDPVVVL--PRLDGAILVVRVSKVRRDEVVNTLRRVETAGG
A0A5C6C4E6      TARSHFDFVLVDLPPVLAVSDPVVVL--PRLDGAILVIRVSKVRRDEVVNTLRRVETAGG
A0A2E1VVJ1      SFLSEYDRVLFDVPPVLAVADASAFL--HNLEAIFLLCRSNLLPEAVIEQATHRLRVSGA
A0A3M2AEL0      DVRGSFDYILFDIPPVLAVADASGFV--SQLDALFMLCRAGVVPEVVAASATKRIRLTGA
A0A2A2W9R6      NARQSFDMVFIDSPPLLAVTDPAIIA--LHVDGCLLTVRIEKNNRTLVERAAEILRDQRV
A0A518HKC1      EARQSFDMIFIDSPPLLAVTDPAIIT--LHVDSCLLAVRIEKNNRTLVERATEILRDQCV
A0A518L3P0      EARQSFDMVFIDSPPLLAVTDPAIIT--LHVDSCLLTVRIEKNNRTLVERAAEILRDQCV
A0A255R1S0      NVREGCDLVFFDAPPVLAVADPAIIA--LHVDCVLMGVRIEKNNRTLVERAADILREQST
A0A5B9MKP1      QARQSFDMVFIDSPPLLAVTDPAIIT--LHVDSCLLAVRIEKNSRTFVERAAEILRDHHV
A0A0S8J591      EAAERYDSVIIDASPVLGVADANILS--TMVDCVVLVVQASKNRRGLVMRAKNQLASVNA
M5RT57          ELRAQYRYIVIDTPPILSASEAILLA--RCADGSLLCTRRNVSREGQVKIAHDRLTKAGI
A0A351FYP6      EMKSRYDYVFFDAPPIMGVSDASVLA--SAVDLCVLVVQYRKYPQLMTQRAKDMVIKVGG
A0A2E7ESJ6      LLRDQFDFVIVDTPPVLAVSDPMAVA--ARVDGVILTFRIHKRARPLALRARDALVTTGA
A0A2D5AWU0      FLRKKYDCIVVDSPPILESSESRVMA--SEVDLCIFVTRLCVSTSPNAIRALGILRGVDA
A0A1G2YQB7      EVSRIFDHVIIDTPPILAAVDALLWS--SMVDGVIMTSLAGRTETPDLKESIERLKQINI
A0A353P687      EISRIFDHVIIDTPPVLAAVDALLWA--SMVDGVILTSLAGHTETPDLKDTIERLKQINV
A0A356EME5      QVSQKYAYVVLDTPPILAASESLVLA--KAADASLVCAMQDVSRASQVRTACERLVAAGC
L0DC26          QLKEHYDFLVIDSSPVLPVADALLIG--QHVDAVIFSVMRDVSRIPTVHAAYERLSRLGI
A0A3L7P4E4      MLRDRYEWIIIDSPPVLAVTDSATLS--RLVDGVILVVRMNGRTRMGAVRAAETLRTLGA
A0A3L7PEB5      MLRDRYEWIIIDSPPVLAVTDSATLS--RLVDGVILVVRMNGRTRMGAVRAAETLRTLGA
A0A1U9NL64      SLKAKYDRILLDAPPVMPVADARILA--AMCDVTLLVLRADSSTRNVSVAACEALAGVGA
A0A2N1UCJ3      ELTHRYDRVIIDSPPVTSVADSQILA--AICDITILVIRAEKSTRKLAQQAREALAGIGA
A0A7C4EK84      TLAGKYDHVVIDSPPVVPVTDARILG--ALCDVTLLVIRSEKSSRRLARHALESLTSVGA
A0A7C3F0T2      QLSTQYDHILIDSPPVMPVTDARILG--AICDQTILTVRAEKSHRKFAERACQGLNDVGA
A0A2E0X4J3      SLSEQFDRVIIDSPPVMPVADARVIA--AMSDATLLVLRAERATRRLCQAARNELWQVRA
A0A5C5YU10      RLKLQYDRIIIDSPPVMPVADSRVIA--SMSDAVLLVLRAEKSTRRLSLAARDELWRVRA
A0A517MPZ6      ELQQKYDKIVIDSPPVMPVADARVIS--AQTDATILVLRADCSTRRMSVAARDELWRVRA
A0A5C6CNV7      KLRLDYDKIVIDSPPVMPVADARVIA--AQTDATILVLRADRSTRRMSVASRDELWKVHA
A0A518K5H4      QLLRQYDQIVIDSPPVMPVADSRMIS--AMVDCSLLVLRAERSTRRISVGARDELLRVRT
A0A5C6AA28      QLSRHYDQIIIDSPPVMPVADARLIS--AMVDCSLLVLRAERSTRRISVSARDELLKVRT
A0A2E9VK20      QAKRDYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVRLHKNRRPSVKRALEMFEAHEI
A0A3D4PJK1      QAKRDYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVRLHKNRRPSVKRALEMFEAHEI
A0A532UT69      DLAKKYDRIVIDSPPVVHVADAQILA--ATSDVTLLVLRADKSTREASRRACASLSSVGA
A0A355AI52      WADGEYDQVIVDAPPVLAGTDAAAVG--RLCDGLMLVVRPEKNRRRVLIKAVETLRMLGV
A0A354PCQ3      EALSHYSYVVIDTAPVLSAGETLAVA--STMEATLLCVMRDVSRLDSIHQTTRRLEAAGA
A0A0S8GZ23      NISQRYDHVIIDTPPVLAVPDARLWA--RMADAVVLSSLAGQTESSDLKETLDLLSQINV
A0A1I3DDV4      DCKSRFDMVLVDSGPVLLVSDPAIVS--QKCDIAMLVVRPAIDTKRKVFESIRRLTSSKS
A0A2E0SMM6      WAETVYDQIIIDAPPILAVSDAGIVG--RLADTLILIMRPDKNRRGMVFRSIETLQMFGI
A0A3L7SI46      WAESAYDQILIDAPPVLAVTDPAIIG--RLVDGAVVVIRPDKNRRKLVLRAVESFRMSGV
A0A356KTN1      RLRRRFDRIVIDSPPVVAVSDATLMA--QAADAVIQVVSARTSSRSAATQANTELSRLGA
A0A5B9PJZ8      VYREQYDYILIDTPPLLAVTDPAIVC--RFVDLVYMVMRITNGVRSNSVRAKEVIDSMGV
A0A2S8G191      KLRQEYDYVIVDGSPILPVVDARLIG--QYVDGVVMAVLRDISRGVKVEEARELLNVFNV
A0A2E7EGG1      KARDSYRYIVVDTPPVLAASESLVMA--RDADATLVCAMRDVSRENHVRMTYHRLLSVGA
A0A2E2N5A9      ALKTRYDRIVVDSPPTQGVSDAMVLA--AHAEALLFIVRSEVTSSTEVERGVAQLRQNAT
A0A7C8AGA2      RISADYDHVIIDTPPVLAFSDALLWA--RMADGVILTSFVDRTSRPDLKEAIKRLERADA
A0A7C2FXP7      QASLAYDRVVIDTPPILAFPDALVWS--KIAGSAILTSFAKHTSRPELREAITRLEQIGV
A0A2E3GWC6      EATREYDFVLVDSPPILAVSDPSITA--RSVDAMMLVVRMQKNNRPSIKRTLELLGSHGV
F0SLB0          EATREYDFVLVDSPPILAVSDPSITA--RSVDAMMLVVRMQKNNRPSIKRTLELLGSHGV
A0A3L7NDH9      WAETTYDQIIVDASPVLAGTDAAAIG--RVCDGLVMVIRPEKNRRRIIVRSVQTLRAFGV
A0A1N6DAJ8      QLKEQYDFIVVDSSPVLPVADAMLIG--QHVDAVLFSIMRDVSRIPKVQEAYERLAKLGI
A0A532UD06      DLPKCYDRVIIDSPPVLPVADSQIIA--ASCDVTLLVLRADKSTRRLSRQACDSLVSVGG
A0A660URN1      ELVQKYDRVIIDSPPVTPVADSQILA--AICDVTIMVLRAEKSTRRLSRHARDNLLSVGG
A0A517ZCB5      WAETHYDQVLIDAPPSLAAADGQIIG--RMVDGAIMTVRPDKNRRRMVMRAVEALSELGC
A0A225EH48      RLRGQFDFIVVDSCPVLPVADALLVG--QHVDGVVISILQDISQLPKVLTASEKLTQLNI
A0A518INW8      EARQEYDFVFIDSPPLLAVADPLIIA--SLVDSVLLVVRVQKNGRRPVERSRELLASNKV
A0A518JPH9      EARQDYDFVFIDSPPLLAVADPLIIA--AQADTVLMVVRVQKNGRRPVERSRELLTSNKI
A0A5C5VEK8      RLKARYDRIIIDSPPVMPVADSRVIA--AMSDAVLLVLRAEKSTRSLSLAARNELWRVRT
A0A532UTJ0      TISRKYDHVIIDTPPTLGFPDALMWA--KIGGAAILVSFAGHTTMPDLKEAKDRLAEINV
A0A432MFP3      RLRRSFDVVIIDTSPVLPVPDALILG--RLADGAVIATRHDQSRFPAVERANGLLTGAGI
A0A2E2CCW9      QLRKEYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGI
A0A3C0AGX3      QLRKEYDYVLIDTPPLVVVSDPSVIA--SMVDGVLLVVRIDKNRRGVIRKVQQIIQTNGI
A0A518AAQ5      QLRNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGIIRKVQQVIQTNGI
A0A517QBG9      QLRNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGIIRKVQQIIQTNGI
A0A518FTU3      QLRNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGIIRKVQQIIQTNGI
A0A517WHH5      QLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGI
A0A5A8BGT3      QLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGI
A0A2E7K7A9      QLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGI
A0A517PTS5      QLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGI
A0A6I6AH34      QLRNEYDYILIDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGI
A0A517VTK3      QVRNDFDYVLVDTPPLAVVSDPSIVA--SSVDGVLLVVRVDKNRRGVIRKVQQIIQTNGI
A0A517WQT4      QVRNDFDYVLVDTPPLAVVSDPSIVA--SSVDGVLLVVRVDKNRRGVIRKVQQIIQTNRI
A0A517VID8      QLRNDYDYILIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGI
A0A517RK10      QLRNEYDYVLIDTPPLVVVSDPSVIA--STVDGVLLVVRLDKNRHGVIRKVQQIIQTNGI
A0A518IH18      QLRDAYDYVLIDTPPLVVVSDPSVIA--STVDGVLLVVRLDKNRRGVMRKVQQVIQTNGI
A0A5C5XLF4      QAKREYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVRLHKNRRPSVKRALEIFEAHEI
A0A2D5NDU9      QACATYDRVIVDSSPMLPVADARILA--TKCDATVLAVSGGSTSTKNVSAAYDALTQVNA
A0A1P8WP26      WAETRYDQIIVDAPPVLAVSDPLIIA--RLVDGVVLVVRPDKDRRRMVIRAAEALHNVGS
A0A3L7V1F3      WAETKYDQIIVDAPPVLAVSDPAIVG--RLVDAVILVVRPDKDRRRMVIRATETLQTLGC
D5SZ21          YVESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVRPDKNQRRSVIRAAETLRMWGN
A0A286RGB6      QLREDFDFVIVDGSPVLPVADTRFIS--THTDGVVLSVVRDISRAPQLRAARQVLESFHV
A0A518CHE5      WAETVYDQIIIDAPPILAVSDAGIVG--RLVDTLVLVMRPDKNRRGLVYRSVETLQMFGI
A0A1V5N3W2      TISQNYDHVIIDTPPVLAIPDALLWS--KMADAVVLSSLAGHSNLTDFQETFHRLSQLHV
A0A3E0MY27      QLRAEFDIIVIDTGPVLSVVDPLLIG--QHCDGAIVSVVRRVSQISNVYETCQRLQGTGI
A0A7C4Z5R7      QLKGEFDFILIDTSPVLPVADALVIG--QHTDGVLFSVLRDVSRIPLVTAASQRLERLGV
A0A2E0X9P6      RLQRDYALIVVDTPPVLAASESLVLA--RAADAVVLCLLSDVSQSQQVRRAARCLDATGS
A0A286RLF2      WAVEHYDQVIIDSPPAPLASDTAIWG--RLADGVILVLQPEKNKRRAVIRAAEYLALLKI
A0A517NSK8      HWAEEFDYVIVDSPPVLAVSDAAIIS--QKCDVTLLALRIVKNGRRIAHRAITLLRQHDA
A0A5C5Z0D6      AWRSEFDFIIVDTPPVLAVSDATIVS--EETDAVLLTVRIVKNGRRSAKRARDILRQTGA
M5UE94          VWRDKFDFIVVDTPPVLAVSDAAVVS--EEMDNVLLAVRIIKNGRKSAIRACDILQRSGS
A0A2E8FLY0      WAETVYDQILIDAPPALAVSDAAIIS--RQVDGGLLVVRPDKNRRRMVIRAAESMAAVEA
A0A3D2U1E1      WAESIYDQILIDAPPALAVTDAAIIS--RQVDGGLLVVRPDKNRRRMVVRATESLAAVGS
E8R3W3          QARGVFDFIIIDSAPVLPVSDTLLVG--RAVDAALFVVMRNQSRRDRVYDAYERLHRFGI
A0A5C5ZM48      AAREDYDYVVIDTPPLLVASEALMLA--RAADASILCAMRDKSRGEQVREAGQRLQAAGV
A0A5B9WF77      QLRQTYEMIIIDSPPVLPVPDALALG--RWTDGALLATRFEVSRSPQVERARRQLDNAGI
A0A518BBX8      GVREKFDFVVIDTPPVLAVSDPSVVA--VRVDGVLLVLRLSKSGRHPAERAKELLSRHGV
A0A1P8WN28      WAVSEYDQVIVDCPPTLPVSDAAIVG--RYVDSMLFLMNPDKTHRRSVARAVDQLRSMGL
A0A3B9CTT0      WAVANYDQVMVDCPPSMPVSDAAIVG--RYVDGLLYLMNPATTHRSMISRTVDTLRSLDL
A0A518ALT3      KLGKRFSTVIIDTPPVLSASEALVYA--KASDLVVYCSLSDVSRARQVRLATEKLEATGA
A0A3M1QRP3      AWRERYDMVLLDCSPILPVADARILA--RLADGTIMVVRDGHSDRRDVLDAIQTLRSAGG
A0A517TMV0      WADSRYDQVLLDCPPILAVSDAQIAA--RLVDGVVLVVTPEKNHRRLVSRACDSFLTSGT
A0A3E0MY88      WAETHYDQILVDSPPVLAASDVMVIG--RIVDGLVLVINPAKNRRRLVTRAYESLRTMGV
A0A5B9QF68      WADSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVRPEKNHRRSVIRAFESFQSVGC
A0A5B9QGF0      WADSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVRPEKNHRRSVIRAVESFQSVGC
A0A5C6CK24      WADSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVRPEKNHRRSVIRAVESFQSVGC
A0A2E3RCU8      WAEGEYDQILVDCPPTLVASDAVLVG--RITDGMVIVVRPEKNRRKVVFRAAQNLSEMKI
A0A1C3E6N1      YVESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVRPDKNQRRSVIRAAETLRMWGN
A0A518GJT2      YVESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVRPDKNQRRSVIRAAETLRMWGN
A0A2E8B0L9      WAETHYDQVLIDCPPVMAASDAAVVG--RLVDGIMLVVQPEKNHRRLVLRAAEQLLSMGV
A0A5Q4GFE7      WAEANYDQVLIDCPPILAAADAAIIG--RLTEGLIVVIQPEKNHRRLVLRAIAGMSSMGV
A0A257WS34      WAETIYDQILIDAPPILAVADPAIIG--RMVDAALVIIRPDKNRRRMVVRAVKSFIGAGV
A0A7C4LP10      WAESIYDQILIDAPPVLAVTDPAIIG--RMVDGAVIVIRPDKNRRKMVVRAVEAYRNTGV
A0A517MLW3      WAASRYDHVVLDCPPVLIANDVALVT--RLTDGLVLVVRPEKNSRRHVLRAIERLERFQT
A0A5B9QVD0      WATTQYDQIVLDCPPVLVANDVALAS--RLADGLVLVVRPEKNSRRHVLRAIERLARFNT
A0A3A0DET7      SLKTRYDRIVIDSPPVLPVADARVIA--AVSDATLLVLRAERSTRRSAIGARNELWRVHA
A0A3B8PNV4      WAESSYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVRPGTNRRRMVLRAAESITAIDA
A0A3D1DR40      WAESSYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVRPGTNRRRMVLRAAESITAIDA
A0A2E7RYU8      WAESAYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVRPGTNRRRMVLRAAESITAIDA
A0A3B8LXG8      WAESAYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVRPGTNRRRMVLRAAESITAIDA
A0A286RD13      SLRDQCDLVLVDSSPILTTADALILA--HVADSVVLSVIQDKSRLPRVFEAVQRLRSVDL
A0A2E3GWX1      WAEGEYDQILIDAPPSLAVTDPAIIG--RLVDGVILTVRPDRNRRRMILRAAESLQSLGA
F0SG60          WAEGEYDQILIDAPPSLAVTDPAIIG--RLVDGVILTVRPDRNRRRMILRAAESLQSLGA
A0A2E9VST2      WAEGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVRPDRNKRRMIIRAAESVTSLGG
A0A356A6X2      WAEGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVRPDRNKRRMILRAAESVTSLGG
A0A5C5XLM3      WAEGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVRPDRNKRRMILRAAESVTSLGG
A0A7C5FXU1      RLRSSYEFVVIDCPPILPVADGRFIS--LFADGVVLVTRRDVSRLPKVIDAYEILRALRV
A0A3M1VCL4      WAETTYDQILVDAPPALAVADPTAVG--RFVDGALLVIRPDKNRRKMVIRAAEAFRAVDV
A0A5C5V7Z9      WAEARYDQVLVDCPPVLAVSDAQIIG--RLVDGVVVVVTPEKNHRRLVVRACDSFLHAGC
A0A5C5YT05      WAEGRYDQVLVDCPPVLAVSDAQIIG--RLVDGVVVVVTPEKNHRRLVVRACDSFLHAGC
A0A518D7F9      WADSRYDQVLIDCPPVLAVSDAQIVG--RLVDGVVLVVSPEKNHRRLVSRACESFLSAGV
A0A5C5ZIP0      WADANYDQVLIDCPPVLAVSDAQIVG--RMVDGVVLVVSPEKNHRRLVARAYNSFLTAGV
A0A518KBK3      WADSKYDQVLIDCPPILAVSDAQIAA--RLVDGVVLVVSPEKNHRRLVNRACGHFTSGGA
A0A5C6AKF9      WADSRYDQVLVDCPPILAVSDAQIAA--RLVDGVVLVVTPEKNHRRLVTRACSHFSTGGA
A0A6M5Z0K7      ELRGRYDFIVIDSSPLMLVPDAMMVA--GCVDGLLYSVRPGISRVAEVHAGYERLREHRM
A0A350CI62      WAETRYDQIIVDAPPVLAVSDPAIAG--RLVDAVVLVVRPDKDRRRMVIRAAETLRTLGC
A0A4P5WQK6      WAETRYDQIIVDAPPVLAVSDPAIAG--RLVDAVVLVVRPDKDRRRMVIRAAETLRTLGC
A0A3C1X4W5      WAETRYDQIVVDAPPVLAVSDPAIAG--RLVDAVVLVVRPDKDRRRMVIRAAETLRTLGC
A0A3D3W3A7      WAETRYDQIVVDAPPVLAVSDPAIAG--RLVDAVVLVVRPDKDRRRMVIRAAETLRTLGC
A0A518DRX3      WAEIHYDQLLIDTPPILAASDAALAA--RHTDGILMVVQPVKNNRRLVMRAVDEIRALDL
A0A518DZF9      WAEIHYDQLLIDTPPILAASDAALAA--RHTDGILMVVQPVKNNRRLVMRAVDEIRALDL
A0A518AKT8      WADSQYDQVLVDCPPVLAVSDAQIVG--RLVDGAILVVRPDKNHRRLVARACESFRNTGS
A0A5C5ZR72      SARDRFDTILIDTPPVLGASEALSLC--RSADMTTLCALRGVSRSRQVKMAAEKLDSAGA
A0A7C5R0U3      WAEAQYDLVLVDCPPVMAASDAAIVG--DRVDATMVVVQPGKNRRRPVARAVDRLRALGV
A0A517TY85      GLREKFNTIIIDTPPILAASESLVFA--KAADLTVVCSLADVSRAKQVRVAVERLHATGA
A0A5B9QEI7      KLRGSFDTILIDTPPVLSASDSLIYA--KAADLVLFSSLADISRAKQVRCAVERLQTTGA
F0SI78          ALRDKYDVIFIDSPPVLAVADATAIA--PLADSLLLVIKNSKHSRPHAKQARESLDLVGA
A0A517MDV3      TLRQKYEYILIDSTPLLAVSESTSLG--QKVDGVVVALRTSNSSRPETERAVQRLQGVGV
A0A518IQ30      WAEANYDQVLVDCPPVVAASDAAIIG--RFVDGLLMVVQPAKNHRKLVIRSVEQLAQLGV
A0A517LWP4      WAEANYDQVLVDCPPVVAASDAAIIG--RFVDGLMMVVQPAKNHRKLVIRSVEQLGQLGV
A0A518JNW8      WAEANYDQVLVDCPPVVAASDAAIIG--RFVDGLMMVVQPAKNHRKLVIRSVEQLGQLGV
A0A2E7ENQ5      WACDHYDQVLIDTPPILAASDASIVS--RLTGGLVLIIQPSKNHRRLVHRAVDEIRAANL
A0A7C2KUQ9      RWKSQYDVVLLDASPVLPVADARILA--RLVDGALLVVREGRCRRGDVADALALLWASGT
A0A7C5BZF0      WAESAYEQVFVDSPPALATSDAALIG--RITGAVLLVVQPAKSTRRMVLRTIEQFQLLRI
A0A1G3AQE9      WAESVYDQILIDSPPVLAASDTAVIG--RLTSGVVLVVQPAKNRRRAVMRCVENLSVLKI
A0A3L7UQT9      WAETCYDQILVDAPPVLAVADPIIIG--RMVDAAVLVVRPDKNRRRMVIRAAEAFSAVEV
A0A4P5YBU2      WAETCYDQILVDAPPVLAVADPIIIG--RMVDAAVLVVRPDKNRRHMVIRAAEAFAAVEV
A0A7C7V5U8      WAESVYDRVLVDSPPALAASDTAIIG--RLVDGAMLVVQPEKNRRRLVMRAAESLTSLKI
                        :..*  *     .                                       

A0A5S9IJB5      KLSGIILNNMEV---------PKGRYYNSGY---YNYGYYGNDGLTT-------------
A0A5S9IPR9      ELSGLILNDVKG-----SYSSQLSYYNYYGLYYSKSYYTRGLNKNPLGRNSKINPLVDNT
A0A533Q9U4      KLLGVVINDVDF--------------SRDKYYYQYYYQYYYHYGEKEAKEA---------
A0A533Q6B7      KILGVVINDL-------------------DFSDEYRYHYYDKKERYYQKA----------
A0A1U9NNE1      TVLGTVLNGVHT---------------AHSYNK-YGYRYYKASSSPADKNGPTRNRPLLL
A0A2G2JCA2      SPMGTVLNGVSA-------------SYYSYHYGHYGYNHA--------------------
A0A1G2XVR0      DLLGIILNLVDV-------SKGGYYSYYYSHYYKYGYGYGAEPPKEKRKREKR-----EK
A0A1G3B0P0      DLLGIILNLVDV-------SKGGYYSYYYSHYYKYGYGYGAEPPKEKRKREKR-----EK
A0A1E3X4X0      KVLGVVMNNVDL-------SKGSYYYHYYQYYYRYGYGEEEEKKGRKKRRSKG-------
A0A286U4B3      EVLGVVINSVDA-------ARGDF------YGYGYGYGYGVEEKGKKGIIERMKWTKGKE
A0A5C6DDS2      EVLGVVMNSVDV-------AKGGYYQYGYQYGYQYGYGYGEDTGKKKGLIERM---KGKI
A0A2E3GW02      PLEGMVVNLVCE---ETSYRYEGGHYRRGMYGSNYNYGTNYSYHQRRYRYYYEGTDA---
A0A5B9QNZ7      EPLGFVVNDIDYLSRQGD---------EGKYGYGYHYGAGGKAEKYFRPTASAK------
A0A1Z8N7H5      PLFGLVANGVGAENNK-----------GYSFGEGEGYGYGYGYGDDENNDEDEGEIEQQG
A0A1G2YPI3      HVLGVVVNDVPK---------------KGHYGYYGSYGY---YYGDDRKKKKTGDRRPDG
A0A1U7CZ81      PVLGTVINGMKS---------------SDAYYGRYSYSR---GRSGYGEP-DASPTT---
A0A142YNY8      PVLGTVINGMRT---------------SDSYYGRYSYSRPGASTTDRERPADATSAG---
A0A1U7GLS6      PVLGTVINGMRT---------------SDSYYGRYTYSR---QQSDRERPAGATPAD---
A0A532UIN2      HILGALVNDVQG---------------------NGRYGY---YNGYGRNGKKKTGNREPA
A0A0S8KNX5      RVLGTVLSSVQA-----------------------EHSY---YRHGHSYYAQSAQSRESA
A0A3D3UVZ8      KVLGTVLSSVQA-----------------------EHSY---YRHGHSYYAQSAQTRESA
A0A517NFU9      QPSAVIVNGVDQDAKSYGYGN----------YQRDRYGY---VGHYHNQYAATNTENLPS
A0A5C5YWH4      APAAIVVNGVDQSSKSYGYGS----------YSAGKYAY---VGDYHSQYEATDIES---
A0A3D2TNK4      HVFGVVANGLSSDSSGYGYGY--------GYGYSYDGGY---SHEEEQDMVDTADTMMTP
A0A7C1Y4F0      RLLGAVVNDVQQKRGQ-----------YGYYSSYGNYGY---YGKREKKTG---------
A0A6I0ENW6      RLFGTVLIGTDP---------------RGGYYRGYDYGS---LARRPVEVSGV-------
A0A6L3A0B7      RLFGTVLIGTDP---------------RGGYYRGYDYGS---LARRPVEVSGV-------
A0A0J1B4A0      AIEGVIVNSRDSRSNHYAYSS------YDYYGKK-QYGY---VANYRRYYEANDDDDAGS
A0A142WSB9      RLLGVIANDAAA---STQTEG--------------SYGN---YEEYYSTAPATSGGAARS
M5SZR3          PIVGIVANCVRT--------SELDALGRARYGYGAYEGY---HQSRNGTTSKSPNRLTSN
M5TW92          PIIGIVANCVRT--------SELDALGRARYGYGAYEGY---HQSRNGTTSKSPSRLTSN
A0A2S8FKY2      PIIGTVLSGYSS-------------------------GM---YYSYTNRSTSTVEVE---
A0A517N8P6      NIIGLVINAVGDSGYSATYSQAWSDSYGGQPGGEYGHSY---YRYGSDRYLDASKGQTIT
A0A432MJP4      PLLGSVVNADGS--DDAQFLH------AGRY-----YGR---YGRSYGSVDGSGPRTGSV
M5UQ35          RAMGVVINTQSPRSGDYGYSS------YNYYGKK-ENGY---VASYRRYYAASDVADEET
A0A0S8FY64      RIIGAVLNDVRP---KTLRRY------G-------SYGY---YYYDYHRYYKDYQEDEGD
A0A1N6KFT7      PVLGFIVNGIDR---QNASGY------GQGYGY--GYGY---GYGTYGRGDDGLDQITPS
L0DFG4          PVLGFIVNGMDR---QGTGSY------GQGYGYGQGYGY---GYGTYGR--DEVSPIVSD
A0A5C5XXG1      NMVGCVLNTFGA---GKSFDL------GGGYYG--YYES---GYSRPT---NRTKPVTSA
A0A7C7YUM8      NLFGVILNAVFV---SRA-ST------SYGYGE--EY-----------------------
A0A7C2AHI6      NLVGAILNAVRP---TRA-GS----------RS--YYGY---GYENDE---D--------
A0A518BJJ1      KLVGCVMNAHRA---DRS-SA------SDRYQG--DYGY---GYTDAG---GDGGPPALE
A0A518D182      KIVGLVMNACRP---EKA-KG------AGAYSD--YYKA---RSAYYQ---DDRSP----
A0A5C5WTY6      QWIGALLNIVQA---PKEFHE------QG-------YGY---QSDSYRSRIPVKSQPSKM
A0A5C5Y033      NLIGSMLNVVGA---DKEFDA------GVSQ-----YGY---YRNDYTRSSSQRKRG--R
A0A5C6G1Y2      NLIGSMLNVVGA---DKEFDA------GVSQ-----YGY---YRNDYTRSSSQRKRG--R
A0A354PDV6      VTVGSVLNTLGA---QKEFSS------DGGY-----YGY---YRSGYSEVSVPQRSL---
A0A5C6FZ02      NMVGCVLNTFGA---GKSFDL------GGGY-----YGY---YESGYSRPTNRTKPV--T
M5TIT3          NFVGCMINAFGS---GKKFDS------DGGY-----YGY---YKSDYTRAASSNGRKPRV
A0A5M6CY44      NFVGWMLNSLGA---GTKFDS------AGGY-----SGY---YESDYTRKSSRNGKA--V
F2AXG2          EMLGCMLNAFGA---GKKFDS------DGGY-----YGY---YKSDYTRPSSSTTRQ--A
M2BB46          EMLGCMLNAFGA---GKKFDS------DGGY-----YGY---YKSDYTRPSSSTTRQ--A
L7CLQ6          KMLGCMLNAFGA---GKKFDS------DGGY-----YGY---YKSDYTRPSSSTTRQ--A
A0A0J1B719      EMLGCMLNAFGA---GKKFDS------DGGY-----YGY---YKSDYTRPTSSATRQ--A
Q7UF18          EMLGCMLNAFGA---GKKFDS------DGGY-----YGY---YKSDYTRPSSSTTRQ--A
A0A2G1W1E0      EMLGCMLNAFGA---GKKFDS------DGGY-----YGY---YKSDYTRPSSSTTRQ--S
K5E235          EMLGCMLNAFGA---GKKFDS------DGGY-----YGY---YKSDYTRPSSSTTRQ--A
A0A5C6FFI9      VPLALIVNGVDAGKRSS--YG------YGGYRAN-EYAY---VGKYHNEYAASEPSSIST
A0A5C5WDJ1      EPTAVIVNGVDK--NALRSYQ------YGGYGQN-KYGY---VGRYHHQYGSKPVTKDDS
A0A5C5X547      TVIGTIVSGHPVRGRYDLYN----------------------------------------
A0A353FIP5      KTLGAVLNGQKG---GDEKDY-----------------Y---YEEGRSR-----------
A0A5B1CIK7      NFVGCVLNAFGS---GQKFNV------QGGY-----YGY---YQSDYTKSPKKNGAV---
A0A5C5WHS2      NFVGCMLNAFGA---GKKFNV------EGGY-----YGY---YRSDYSRPASKNGSS---
A0A5C6B6G8      NFVGCMLNALGA---GANFDG------AGGY-----YGY---YRSDYTRKKKNGRAEAA-
A0A5C5ZZN3      QFAGCMLNAFGA---GKKFDG------GGGY-----HGY---YKSDYTRPTNAG--SKPA
A0A5C5XS91      NFVGCMLNTYGA---AKAFDA------DGGY-----YGY---YRSDYTRPTSKS--ASAE
A0A5C6C4E6      NFVGCMLNTYGA---SKAFDA------DGGY-----YGY---YRSDYTRPKSKSAAAAAE
A0A2E1VVJ1      PAIGAILNGHRPSRLQRDYSS------YGYG-----YGY------SYKQEGRSSGSEL--
A0A3M2AEL0      KLMGCILNGVRAPRLGR-YSR------YGYS-----YGY------AYGY-GYGDGSK---
A0A2A2W9R6      PIDGVIVNGRDSRRRSYGYSS------YNYYGKG-EYGY---VDSYRQYYESE----EED
A0A518HKC1      PIDGVIVNGRDSRRRGYGYSS------YNYYGKG-QYGY---VDGYRRYYESD----EEE
A0A518L3P0      PIDGVIVNGRDSRRRGYGYSS------YNYYGKD-QYGY---VDGYRRYYESD----DED
A0A255R1S0      PAEAVIVNGRAS-RRGYGYTG------YNYYSKK-EYGY---VSTYRRYYEADADGQDED
A0A5B9MKP1      PIDGVIVNSRDSRRRGYGYSS------YNYYGKG-QYGY---VDSYRRYYEAE----EED
A0A0S8J591      RLAGAVLNNVR------------------GTKGDYYYYRQRYQPVAEMMEEAGV------
M5RT57          KPLGTVLNGVPT-------------RSYAKTYGSYDYARRFE------------------
A0A351FYP6      DLVGVVLNNINI-------SQDSYYYYYSGYYYDYYYKSRETEEEPVEDKKDGKEEKLIA
A0A2E7ESJ6      NVIGVVVNGVDH-ET----SSYYSEYKY-GYAG-YRYGYNSRYGEYSSDAQEQ-------
A0A2D5AWU0      RVVGTFVNDDSA-KKT---NAYAGGIAYGAFRK-VEALEAPLPPRSDAGV----------
A0A1G2YQB7      NLIGIVLSNVSY-NKV---Y--------------YRYGHDYYGKPATVKELKQNLPSENT
A0A353P687      NLLGIVLSNVKY-NQI---Y--------------YPYGYGYYGKTNVIKDVKQEPADNIV
A0A356EME5      RPVAAVLNGVSS-RRY---E-----------YS-YGYYESVEE-----------------
L0DC26          RMLGAIVTGEQT-DHY---G-------------------SSYPSVSRTDKR---------
A0A3L7P4E4      NILGLIANGIDP-TKH---G------------G-YGYQYGVYGAGGRASKYYAEAPNKR-
A0A3L7PEB5      NILGLIANGIDP-TKH---G------------G-YGYQYGVYGAGGRASKYYAEAPNKR-
A0A1U9NL64      RPLGVVVTA-PG-KKM---SKYGYGYGYGYGYG-YSYEEDDKSSAKSA------------
A0A2N1UCJ3      RVLGAVVNDVSP-KHS---R-------YGYYSH-YSYYGYGYG---YGRKKE--------
A0A7C4EK84      KVLGVILNDVTR-SGE---P-------YGYAYA-YGYAPLKRTAPGNGNGRASHTASHA-
A0A7C3F0T2      HILGVVINAVP--RKE---DRYYHYSGYGYYYK-HGY--------GYGHERRRRKTARGD
A0A2E0X4J3      KRLGVVVNGVPM-RGA---GSYGYGGGY-GYGG-YGY--GGYGDPVADEPLPSGRRKKSR
A0A5C5YU10      QRLGIVVNAVPQ-SKG---GSYGYGYGYG-----YGY--GNYGEVAYGHEDQRSLGNRKK
A0A517MPZ6      QRIGIVVNAVPG-RKQ---ANYSQGYGY-GYGN-YGHSSGTYGDLAYGEPEPPVDISRRK
A0A5C6CNV7      QRIGVVVNAVPA-RQQ---SSYSSGYGYGGYGA-YGHAGGSYGESAYQLDAYPAN-GRRQ
A0A518K5H4      QRLGVVVNAAPI-HRS---N-------FGGYSG-YGY--GSYGQVAYGHEDAAEARPAVR
A0A5C6AA28      QRLGVIVNAAPL-HRA---S-------YGGYYA-YGY--GSNGQVAYGGEVAPEPAPSRR
A0A2E9VK20      PLLGVIANGLQD-------ASGDYQYRG-GYGG--GYDKKSPYQ----------------
A0A3D4PJK1      PLLGVIANGLQD-------ASGDYQYRG-GYGG--GYDKKSPYQ----------------
A0A532UT69      HILGVVVNNVSK-KNSY------------GYYGGYKV-----------------------
A0A355AI52      TLFGTIVNAVGL-------EEMGYGYGY-GY-G-YGYGYGDEYG----------------
A0A354PCQ3      SVIGTVFSGV---------TSRQYVYRYGDY-Q-YALSGGDIHDDEFSDDNVSLGKGG--
A0A0S8GZ23      KILGNVLCNVSP-------SSSHYRYRY----G-YGYGYGRRRG----------------
A0A1I3DDV4      NLRGCILNTYGS-SKEFTRDSGY--YSSYNY---YGYGYGYGYG----------------
A0A2E0SMM6      HISGVVVNHLTP-------DQGGEYYGY----G-YGYGYNEDYG---HEDTQAEQGYGDD
A0A3L7SI46      EVIGIVANHIGS-K-----SNSEYGYGY-GY-S-YGYGH---------------------
A0A356KTN1      APVGLIFNQQPQ-D-----EAGAYFYYY----SRYGYGGE--------------------
A0A5B9PJZ8      ELSGVIINGLRR-RDQKTYDYKGGKYGYGGY-T-YGGGYGSSYGKNYSGNAPTPAA----
A0A2S8G191      PFLGAVVVGITK-E------------------DVYNYTSQRNRKKQLVHVES--------
A0A2E7EGG1      RPVGTVLNGVPT-------------RQYARRYGTYGYETASSYS----------------
A0A2E2N5A9      PVDWVILNQVDI-K-----KAERHGYRYSSYYDYYQYGSGSPS-----------------
A0A7C8AGA2      KILGTVVNNVKV-------AHSYHRYGY----G-YGYGHASDGGQKRESKSH--------
A0A7C2FXP7      TILGTVLHNVNM-------SNSYHQYGY-GYNA-AGNNKSHGHT----------------
A0A2E3GWC6      NLMGVIANGVEA-------TGGEYSYRG-GYGGGYARQQP--------------------
F0SLB0          NLMGVIANGVEA-------TGGEYSYRG-GYGGGYARQQS--------------------
A0A3L7NDH9      NIFGAVINGV---------GIEADGYGY-GY-G-YGYGYGTPYG-----DEVEEESIDDA
A0A1N6DAJ8      RMLGAIVTGEKS-D---------------HYGSKYEYSAR--------------------
A0A532UD06      HLLGAVVNDV---------KHKRGRYSYYNYSG-YGYDSGYDYGGYYDDDISAESRDQDE
A0A660URN1      HLIGVVVNDV---------SQRSGRYGYGRYGQ-YGYYGYCSYYGHYGYGRDERQRQYA-
A0A517ZCB5      NVYGLIVNHVSP-Q-----SDSEYSYGY-GY-G-YGYGEHDNDA----------------
A0A225EH48      PLLGAVVNGIKP-----------------DIHA-YGYNYV--------------------
A0A518INW8      KVAGVIVNGG---------ERADKHFGYGEYVKPYEYGYATQYTRSYASKPNERPVASSS
A0A518JPH9      KVAGIIVNGA---------ERGDKNFGYGEYVKPYEYGYATQYTKSYSSKPQPRPVSSAS
A0A5C5VEK8      QRLGVVVNAVPQ-S-----RGSSYGYGY-AYGG-YGAYGEIAYGHEEDATLS--------
A0A532UTJ0      KVLGTVLSSVDA--------------------G-HGYYRHHGYYTQSAQSREAAVGHKRK
A0A432MFP3      PVLGVVVNGA---------RTSDRRFGT-GYAT-YTYRSDRISDPGGGVSGS--------
A0A2E2CCW9      KVAGILANSVKS-G---------------KPGD-YDYGSGPGYSDYYIVPPQAQ------
A0A3C0AGX3      KVAGILANSVKS-G---------------KPGD-YDYGSGPGYSDYYIVPPQAQ------
A0A518AAQ5      RITGLIANNVIT-N---------------SLAG-YDYIDSEGYQEYFQGPAQKT------
A0A517QBG9      RITGLIANNVIT-N---------------SLAG-YDYIDSEGYQEYFQNPAQKT------
A0A518FTU3      RITGLIANNVIT-N---------------SLAG-YDYIDSEGYQEYFQNPAQKT------
A0A517WHH5      KITGLIANNVIT-N---------------SLVG-YDYIDSEGYQAYFEKPEPQT------
A0A5A8BGT3      KITGLIANNVII-N---------------SLVG-YDYIDSQGYQAYFEKPAAQD------
A0A2E7K7A9      KITGLIANNVIT-N---------------SLVG-YDYIDNEGYQAYFEKPAPEP------
A0A517PTS5      KITGLIANNVIT-N---------------SLVG-YDYIDNEGYQAYFEKPAPEP------
A0A6I6AH34      KITGLIANNVIT-N---------------SLVG-YDYIDSEGYQAYFEKPATQT------
A0A517VTK3      NVTGILANGIYN-G---------------KSGK-YRYRGGEGYHDYYLTPQQNN------
A0A517WQT4      NVTGILANGIYN-G---------------KSGK-YRYRGSEGYHDYYLAPQQNN------
A0A517VID8      KVTGILANGVQS-G---------------KLGD-YDYGSGPGYSDYYIVPSQVQ------
A0A517RK10      KVTGVLANGIFS-G---------------RYGE-YDYGAGEGYQEYFEAQPKKK------
A0A518IH18      KVTGILANGIFS-G---------------RYGE-YDYGAGEGYQEYFEAQPKKK------
A0A5C5XLF4      PLLGVIANGLQD-------GSGDYQYRG-GY-G-GGYDKKSPYQ----------------
A0A2D5NDU9      TVLGIVLNNMPK-------MKGEVAYSY----G-YGYGGGVQARQPYAFTAAGPEVEVTR
A0A1P8WP26      NLLGVVVNHLS--------GSEAEGYGY-GY-G-YGYGYE--ENDTHPTDERRQPSHNQA
A0A3L7V1F3      TLLGVVINHLT--------TTDTDGYGY-GY-G-YGYGYG--YGHENEHEEQPER-----
D5SZ21          NLLGLALNNMSS-D-----RAGGYGYGY-GY-G-YGYGHTDTDG----------------
A0A286RGB6      RVLGAVMTGSAE-D---------------VYYA-YPYHSPIVEGDSQRQEAPERG-----
A0A518CHE5      HISGIVVNHLTP-------DQGSDYYGY-GY-G-YGYSEDYGHEESTGEDGYDEDGYGDG
A0A1V5N3W2      RILGNVLANVAA-------RHSYNRYGY-GY-G-YGYGHK--HNPPDGKQIDMKQ-----
A0A3E0MY27      RLLGSVVNGV---------SGSQVSVGYYGY-G-YGYEDG------YGREELSHEVAES-
A0A7C4Z5R7      RLLGAVFVGAKG-D---------------VY-G-HSYQYT--------------------
A0A2E0X9P6      RIAGAVLSGVPM-R---------------RY-T-YAYDYRPRAAADYGSGEAF-------
A0A286RLF2      PLLGIVINRLSN-------EKEK---DYSGY-----------SGDYYGQPDESHE-----
A0A517NSK8      NVVGLVINGYQS-SNKNYGYIEK--YDSDSY-G-YGYGPT--SGGYYRSADA--------
A0A5C5Z0D6      SIAAIVVNGYQT-KDRSYGYTGG--YDAEAY-G-YGYGET--HKAYYRESKK--------
M5UE94          EVGAIIVNGYQS-KDKKYGYTGG--YDADAY-G-YGYGES--HKAYYGE-KS--------
A0A2E8FLY0      TLIGAVINHIAD-------TAGSEYYGC-GY-E-YDSKED--------------------
A0A3D2U1E1      TMLGAVINHVTA-------EAGGDYYGY-GY-G-FEYGSG--------------------
E8R3W3          PVLGTVVTAATS-PKR---------YGYDPYGY-YSYGYTYYYQ----------------
A0A5C5ZM48      RLAGVVLNGVPA-K------------------Q-YATRYGQPYG----------------
A0A5B9WF77      PVLGTVINGL---------RSSDSYYGRYTY-----------------------------
A0A518BBX8      NVIGVVVNN----------SDRGTRYGYGGY-G-YAYSYG--------------------
A0A1P8WN28      KIVGIVANTSLS-EDT---S------SY-GY-Q-YGYGYGNDYG--YGHD----------
A0A3B9CTT0      TPVGVVVNMGLS-SEK---EGQGYGYGY-GY-G-YGYGYESQYG--YGHD----------
A0A518ALT3      RIAGTVLSGVST-K---------------SY-V-YAYGR---YASLQGQA----------
A0A3M1QRP3      TILGSVFNGVPS-------RGGY--YYHGSY-G-YGSAARNVYG----------------
A0A517TMV0      PLLGVVANRITE-------QAGK------GY-G-YGYGYG------YGHDD---------
A0A3E0MY88      TVLGIVANRIDQ-------DQSK------GY-G-YGYGYTYSYN--YGGSDEETHHVEEP
A0A5B9QF68      NVLGVVANALSD-------ESQS--YGYGGY-G-YGYGYGSDYGSDYGNDEEAFEEEVSD
A0A5B9QGF0      NVLGVVANALSD-------ESQT--YGYGGY-G-YGYGYG--YG--YGHDEEEFGDE--V
A0A5C6CK24      NVLGVVANALSD-------ESQT--YGYGGY-G-YGYGYG--YG--YGHDEQDFEDV--D
A0A2E3RCU8      PVYGLVANCIKA-------ENGK-GYNF-GE-G-EGYGYG--YG--YGDDDSGSLDEADG
A0A1C3E6N1      NLLGLALNNMSS-------DRAG------GY-G-YGYGYG--YG--YGHTDTD-------
A0A518GJT2      NLLGLALNNMSS-------DRAG------GY-G-YGYGYG--YG--YGHTDTD-------
A0A2E8B0L9      NLIGVVPNRVGD-------DSSGYYGGY-GY-G-YGYGYG--YD--DGYGM---------
A0A5Q4GFE7      GLIGIVANRIRH-------ESGGGYFGYGGY-G-YGYGYG--YR--DGYGQPADEARIDQ
A0A257WS34      QVVGIAANHLAN-------SPSQ---DY-GY-G-YGYGYG--YG--YGHDDAI-------
A0A7C4LP10      RVLGAVINHLGD-------VGQE--YGY-GY-G-YGYGYG--YG--YGHDDAT-------
A0A517MLW3      NVLGMVINAMDA-------STADGA--Y-GY-G-YGYGYG--YG--DELTDEKQAVVMPS
A0A5B9QVD0      NVYGLVINGLDS-------ASSDRAYGY-GY-G-YGYGYG--YG--DDNQDEKIHLI---
A0A3A0DET7      NRLGVVLNSVPL-R-----KQAAYGYGD-PY-G-YGYGHQ--YG--YGEYAAIEEASAP-
A0A3B8PNV4      DLLGVVINNVDS-------DTGGDYDGY-GY-E-YG------------------------
A0A3D1DR40      DLLGVVINNVDS-------DTGGDYDGY-GY-E-YG------------------------
A0A2E7RYU8      DLLGVVINNVDS-------DTGSDYDGY-GY-E-YG------------------------
A0A3B8LXG8      DLLGVVINNVDS-------DTGSDYDGY-GY-E-YG------------------------
A0A286RD13      PLLGIVLHGTAP-SR----------YRS-YYRS-YTID----------------------
A0A2E3GWX1      NLLGVVVNRLSD-------SSGE--YSY-GY-G-YGY--G--YG--YGHEDPVQDQPAAW
F0SG60          NLLGVVVNRLSD-------SSGE--YSY-GY-G-YGY--G--YG--YGHEDPVQDQSAAW
A0A2E9VST2      NLLGVVVNGLSD-------SRGE--YGY-GY-G-YGYGEG--YG--EGHDDPTHDDE---
A0A356A6X2      TLLGVVVNGLSD-------SRGE--YGY-GY-G-YGYGEG--YG--EGHDDPTNEVE---
A0A5C5XLM3      TLLGVVVNGLSD-------SRGE--YGY-GY-G-YGYGEG--YG--EGHDDPAYEGE---
A0A7C5FXU1      KMLGTVFLGSKE-------D------GY-YY-H-HYRR----YY--LAPAAVED------
A0A3M1VCL4      PLLGIVVNNVSA-------EDGDGYYGY-GY-G-YGYGYG--YG--YGYAESDD------
A0A5C5V7Z9      HVHGVVANRISN-------KSEG---GY-GY-G-YGYGQQ--YG--YGHTEEEE-LAPVA
A0A5C5YT05      HVHGVVANRISN-------KSEG---GY-GY-G-YGYG----YG--YGHSDEEERVEEKV
A0A518D7F9      HVLGVVANRITQ-------GGGH---GY-GY-G-YGYG----YG--YGHDEPDT------
A0A5C5ZIP0      NMVGVVANRISE-------QAGK---GY-GY-G-YGYG----YG--YGHTETND------
A0A518KBK3      PLVGVVVNRVSD-------QIGK---GY-GY-G-YGYG----YG--YGHEEEEH------
A0A5C6AKF9      PLLGVVANRISE-------QAGK---GY-GY-G-YGYG----YG--YGVDEADH------
A0A6M5Z0K7      PFLGVVVNGVPQ--------------SH-AY-A-PGYGR---------------------
A0A350CI62      TLLGVVVNHLNV-D-----DAGG--YGY-GY-G-YGYGYG--YG--YGHDQEPEEQSGSG
A0A4P5WQK6      TLLGVVVNHLNV-D-----DAGG--YGY-GY-G-YGYGYG--YG--YGHDQEPEEQSGSG
A0A3C1X4W5      TLLGVVVNHLNL-D-----DAGG--YGY-GY-G-YGYGYG--YG--YGHDQEPDEQSGAG
A0A3D3W3A7      TLLGVVVNHLNL-D-----DAGG--YGY-GY-G-YGYGYG--YG--YGHDQEPDEQSGAG
A0A518DRX3      NLIGVIANRIDV-A-----QAGY--YGY-GY-G-YGYGEN--DS--DDDHISPTSTTATS
A0A518DZF9      NLIGVIANRIDV-A-----QAGY--YGY-GY-G-YGYGEN--DS--DDDHISPTSTTATS
A0A518AKT8      QVLGVVANDVSD-M-----HGSG--YGY-GY-G-YSYHS---------------------
A0A5C5ZR72      NLAGAALSGVAP---------MG--YGS-VY-A-YGYGF---------------------
A0A7C5R0U3      HLVGVVANRVTP-E-----PGDD--YGY-GY-G-YGYGD---------------------
A0A517TY85      NVAGAVLSGVSP---------SH--YVY-NY-G--AYGA---------------------
A0A5B9QEI7      NLAGVVLSGVSV---------NR--YVY-HY-G--SYGQ---------------------
F0SI78          PLEGMVVNLVCE-ETSYRYEGGH--YRR-GMYG-SNYNYG--TN--YSYHQRRYRYYYEG
A0A517MDV3      QAVGFVVNDIDR-LAK---QGDE--VDA-GY-G-YEYG----------------------
A0A518IQ30      QLTGIILNRVDD--ST---AGSQ--FGY-GY-G-YGYGYG--YG--YGDEE---------
A0A517LWP4      QLTGIILNRVDD--SV---SGGQ--FGY-GY-G-YGYGYG--YG--YGDEE---------
A0A518JNW8      QLTGIILNRVDD--SV---SGGQ--FGY-GY-G-YGYGYG--YG--YGDEE---------
A0A2E7ENQ5      ELIGVVINRISD--DG---DSAY---GY-SY-G-YGQGYG--HG--YHEDANVDDDPTTL
A0A7C2KUQ9      KPLGTVI--FAS--RN---RIGY--PSY-TV-----------------------------
A0A7C5BZF0      PVVGIVLNRVGL---K---EADY--YGY-GYYG-YEYEES--DG--PADEELQQDLADDA
A0A1G3AQE9      PLLGIVLNRIGS--EK---EGGY--YGY-GYGG-YGYGYI--YK--YGADADSKDESELA
A0A3L7UQT9      NLMGVVVNHLSS--DS---SGDY--YGY-GY-G-YGYGYG--YG--YGYGHDDANAAAE-
A0A4P5YBU2      NLLGVVVNHLSS--DS---SGDY--YGY-GY-G-YGYGYG--YG--YGYGHDDANAAAE-
A0A7C7V5U8      NLLGVVINRLAP--DK---DGGY--YGY-DA-G-YDYQYA---G--QPDGLDETDGPPGG
                                                                            

A0A5S9IJB5      ------------------------------------------------------------
A0A5S9IPR9      KKS---------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      TSGN--------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      KEINV-------------------------------------------------------
A0A1G3B0P0      KEINV-------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      KVENT-------------------------------------------------------
A0A5C6DDS2      KLKNV-------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      NRDSYQGISFQSKTFDQSENXQEKLPAKFRKTA---------------------------
A0A1G2YPI3      VVKDSALDAKAID-----------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      AGVRRTVVSPSRMAKDSRWRTPLMKT----------------------------------
A0A0S8KNX5      RRSRRKLMFSVDGGVDHSSGLETSVAERSADNYSYTQSSESRKDTGRK--RKKPRLSVED
A0A3D3UVZ8      RVSRRKLMFSMEEGADNTYDSKIPESDKPGEGFSYSQSVESRKSVMRKRTRKKPPVSNED
A0A517NFU9      VRTVPSPKGELGPKGEAGLSGELGPKGRSSRSSERASL----------------------
A0A5C5YWH4      ---------------------TIPQRSPRILAAERSVG----------------------
A0A3D2TNK4      MPEIVQLPSIASEEHLPSASPQEHQSHETPFQTKSANSTTPLKPRRVA------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      APRRKRSSSKRTAAASTRSLPIPEAASSNGHVANGSTVNGSSNGHPTT------------
A0A142WSB9      KAAAGKLW----------------------------------------------------
M5SZR3          NGHANGALVTSTGDVEVNGHGDKHSSNPLEERGNPNS-----------------------
M5TW92          NGHANGALVTSTGDVEVNGHGDTHSSNPLEERGNPNS-----------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      VRSQRSRNADPARAATLSEPVKTTE-----------------------------------
A0A432MJP4      WPSGTAAGEGASASWAPASLLRRLRTGGPGPGFGNGGRGVNGNGKLG-------------
M5UQ35          PVSSSARLSAAKLRGVSGLPAQEGRPSRIDVFADGPVMEEQSVNGHSHENVKSGGLNGVA
A0A0S8FY64      ELEMPASVPVAVEDERPDDGPDEEGSAERFEPGTVSFVVRGGQDFSFSFELEDGQQTVVG
A0A1N6KFT7      TKEITTSVSSSESTNGLPQPLLKD------------------------------------
L0DFG4          GKEIAAFGPPSKPTNGLPQGILKD------------------------------------
A0A5C5XXG1      RIVEVDNDA---------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      GVEAALPSELEREVASASARDERF------------------------------------
A0A518D182      ----------DRQAA---------------------------------------------
A0A5C5WTY6      AAIRSFAAEESVI-----------------------------------------------
A0A5C5Y033      AAATPGSV----------------NNAA--------------------------------
A0A5C6G1Y2      AASATGSV----------------NNAA--------------------------------
A0A354PDV6      --QNGAIP----------------SYNGRVGSVITTRASDIGSRD---------------
A0A5C6FZ02      SARI-VEV----------------DNDA--------------------------------
M5TIT3          GESSASAA----------------TVNGRASHD---------------------------
A0A5M6CY44      NGRAKAGR----------------QLSARKTDS---------------------------
F2AXG2          APKA-ATI----------------SSNGRVAE----------------------------
M2BB46          APKA-ATI----------------SSNGRVAE----------------------------
L7CLQ6          APKA-ATI----------------SSNGRVAE----------------------------
A0A0J1B719      APKA-ATI----------------SANGQPKSK---------------------------
Q7UF18          APKA-ATI----------------SSNGRVAE----------------------------
A0A2G1W1E0      APKA-ATI----------------SSNGQPKPE---------------------------
K5E235          APKA-ATI----------------SSNGRVAE----------------------------
A0A5C6FFI9      LPRVKGATK--SATSSGSPNASRAVVLGSATPTLPGMASQKAALE---------------
A0A5C5WDJ1      NTTTLEDTWENRLRHSDDLGSRLHHNIDRLNEIVKN------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      ------------------------KPL--PARSAAISSDIAGRDG---------------
A0A5C5WHS2      ------------------------KRIASPARASSIPTDMN-------------------
A0A5C6B6G8      ------------------------RPIGSLPAAAKTENESDA------------------
A0A5C5ZZN3      RSG---------------------SLNGFSAAPAEAPVNGKAH-----------------
A0A5C5XS91      RTSRVATVQVNGKSQANGKA----QANGKASAGGNASANGKAKTK---------------
A0A5C6C4E6      RSNRVATAQVNGKAHTNGHANGTSQTNGTSQTSGKAKTNGKVKSK---------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      S-SPTSKRS------QKRINGEAAKLNGRS-ARDRLISGKR-------------------
A0A518HKC1      A-VISNGRS------RKRVNGEAVKMNGRG-ASDRLITGKR-------------------
A0A518L3P0      APTSSNGRS------RKRVNGKAAKMNGHA-ASDRLITGKR-------------------
A0A255R1S0      RPIRSARAATSSRVVNGKVNGHAKHASDVAEAAHPVTLDRK-------------------
A0A5B9MKP1      EPARVNGRS------HKRINGQVAKVNGRTATSDRLISGKR-------------------
A0A0S8J591      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A351FYP6      QADAAGEDVNP-------------------------------------------------
A0A2E7ESJ6      ---------------------------KAISKYYDDESSQTLQHESPYQS----------
A0A2D5AWU0      ------------------------------------------------------------
A0A1G2YQB7      SEKVKQQV----------------------------------------------------
A0A353P687      IPEVK-------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      KEHVGNPEGQLPTVSQR-------------------------------------------
A0A2E0X4J3      VIEPVAAETE--------------------------------------------------
A0A5C5YU10      RLIQARPETPAVVEQT--------------------------------------------
A0A517MPZ6      KSRARSQQLPSPEATSEAMEPLDI------------------------------------
A0A5C6CNV7      KGLAISAKAETPSTDPAETSEIST------------------------------------
A0A518K5H4      RRLKSMADEDLTSIDG--------------------------------------------
A0A5C6AA28      RLLKQDLEPELGAVDS--------------------------------------------
A0A2E9VK20      --------------------------------QTNDIPEFLAPTQAVIPS----------
A0A3D4PJK1      --------------------------------QTNDIPEFLAPTQAVIPS----------
A0A532UT69      ------------------------------------------------------------
A0A355AI52      ------------------------------LDDDGEYGDEEEEENYMRAA----------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ---------------------------DGNNDKRKRPKPKTLLISGPGSK----------
A0A1I3DDV4      -------------------NRGYGRRVKDNGSAETENGHSLAGSTPAGRK----------
A0A2E0SMM6      GYGDDGYVGDGHADDGYRHAPATLEYANYDQQYESGYEDDDYEANPYHAA----------
A0A3L7SI46      ---------------------------DDRSDTTTEATDDEYEVKTPMAA----------
A0A356KTN1      --------------------------------------------PKDEES----------
A0A5B9PJZ8      ---------------------------NTPSHQPPIPNLVDAKSSSKSRN----------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      -------------------------------------------ADQEEVT----------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ---------------------------KRAETLLLTSEPRDETGDESGSS----------
A0A7C2FXP7      ---------------------------QNRRKMLLLTAKVAKINAAAVKV----------
A0A2E3GWC6      -------------------------------------AKPTTPPPILTKQ----------
F0SLB0          -------------------------------------AKPTTPPPILTKQ----------
A0A3L7NDH9      FVTDDALADHEDSNVDDGSDPGVEDRVLPMNPRSGTSSRSRGASNPRAVA----------
A0A1N6DAJ8      ---------------------------------------------TRESV----------
A0A532UD06      ANVHVHV-----------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ---------------------------DEDAQTLPAGPKFVSPEQLRKSA----------
A0A225EH48      ---------------------------------------------KQLPA----------
A0A518INW8      V-----------------------------------------------------------
A0A518JPH9      V-----------------------------------------------------------
A0A5C5VEK8      ---------------------------SRKKRLIKSRPAPAESATVVEQT----------
A0A532UTJ0      LMF------------------------SMEEGADDGKDSETPDGGVTTDV----------
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------AKQADVPAKTKITH----------
A0A3C0AGX3      ------------------------------------AKQADVPAKTKITH----------
A0A518AAQ5      ------------------------------------ASPVAKPARTEVTS----------
A0A517QBG9      ------------------------------------ETPVEKPARTEVTS----------
A0A518FTU3      ------------------------------------ATPVEKPARTEVTS----------
A0A517WHH5      ------------------------------------TKPAANPAKTEVTS----------
A0A5A8BGT3      ------------------------------------KKSAVNPVKTEVTS----------
A0A2E7K7A9      ------------------------------------AKPAANPAKTEVTS----------
A0A517PTS5      ------------------------------------AKPAANPAKTEVTS----------
A0A6I6AH34      ------------------------------------SKPAANPAKTEVTS----------
A0A517VTK3      ------------------------------------SPEPTVSVHTEVPG----------
A0A517WQT4      ------------------------------------SPEPTVSVHTEVPG----------
A0A517VID8      ------------------------------------AKQADATAKTKITQ----------
A0A517RK10      ------------------------------------IRQPAVPVNSDITG----------
A0A518IH18      ------------------------------------TTQPVVPANTEITS----------
A0A5C5XLF4      --------------------------------QTNDMPEFLAPTQAVIPS----------
A0A2D5NDU9      QP-------------------------TSGPSRDSSAADDGHADERPSAD----------
A0A1P8WP26      DVA------------------------VSLSMIGSGPEPEDS--ADKKAA----------
A0A3L7V1F3      DVA------------------------SGLSALASGKSREADLRERNRAA----------
D5SZ21          ----------------------------DHDDLLDDHASSHSSYSSRTAA----------
A0A286RGB6      ------------------------------------------------------------
A0A518CHE5      NYQKEPAILGYT---------------SPDSGQDAGYEDDDYETNPYQAA----------
A0A1V5N3W2      ---------------------------LMLLLRPDEKKKDTSPSEESSKN----------
A0A3E0MY27      ------------------------------------------------------------
A0A7C4Z5R7      ---------------------------------------------ASAAN----------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      ---------------------------EKEVPEITESISTPERTVPRRVA----------
A0A517NSK8      ---------------------------TAETVKVSSRDAEEAPVAAGSRV----------
A0A5C5Z0D6      ---------------------------GSRPLQSTSS-----------------------
M5UE94          ---------------------------APFDLQSVS------------------------
A0A2E8FLY0      ---------------------------------------EE----LKQAA----------
A0A3D2U1E1      ---------------------------------------EESSDGLKQAA----------
E8R3W3          ----------------------------------------HQRASEDGAA----------
A0A5C5ZM48      -------------------------------DEGAEPVGAESYAANETSV----------
A0A5B9WF77      ------------------------------------SRQRATQTPSADAV----------
A0A518BBX8      --------------------------------NEKYLDESPLSSDSQDAT----------
A0A1P8WN28      ---------------------------DEEDDLDSVDFPPPPSSDLGKVA----------
A0A3B9CTT0      ---------------------------EDDDEYDQM-------TDGELAA----------
A0A518ALT3      ------------------------------------------------------------
A0A3M1QRP3      -------------------------------------PATDNDPLDVRVI----------
A0A517TMV0      --------------------------------------TAEALEEKPLAA----------
A0A3E0MY88      LPHAESPELAAPGSVSFELDST-----APWPPQTQQQVVHDGTTVPRKVA----------
A0A5B9QF68      ADEPQESIPDPA---------------TKRSRTPRRKQGPTEPIRPRRAA----------
A0A5B9QGF0      ADEPLETIPHPS---------------TKMSVTPRRKTSPTDPIRPRRAA----------
A0A5C6CK24      ADSEELIVPHPA---------------TQVGVSLRRKETSTDPIRPRRAA----------
A0A2E3RCU8      TTLNAEDNYADINF-------------QMRPLDQKVSEIENASIHFRKSA----------
A0A1C3E6N1      ---------------------------GDHDDLLDDHASSHSSYSSRTAA----------
A0A518GJT2      ---------------------------GDHDDLLDDHASSHSSSSSRTAA----------
A0A2E8B0L9      ----------------------------DEEDEDDIQTSASDSIQPRRAA----------
A0A5Q4GFE7      DRFASGETD------------------WSDEEDSDVPPGAP---HPRNAA----------
A0A257WS34      ---------------------------EDPALAAMEDDDGYRIAA---------------
A0A7C4LP10      ---------------------------DPQTGGDDGGDDAHELQPVRRAA----------
A0A517MLW3      QNAVSQSELV-----------------VHTDSAAPKTAPVRRSTPRRRAA----------
A0A5B9QVD0      ------AEPT-----------------ADQPPAAPQAP--RRAAPRRRVA----------
A0A3A0DET7      ---------------------------DRGRKKSRALVKAATEPAITSQE----------
A0A3B8PNV4      ------------------------------------GEDEPASSPHRLAA----------
A0A3D1DR40      ------------------------------------GEDEPASSPHRLAA----------
A0A2E7RYU8      ------------------------------------GEDEPASSPHRLAA----------
A0A3B8LXG8      ------------------------------------GEDEPASSPHRLAA----------
A0A286RD13      -------------------------------------------VESRAAE----------
A0A2E3GWX1      SDFYDA---------------------EPERQKKERKRFSRKAA----------------
F0SG60          SDFYDA---------------------EPERQKKERKRFSRKAA----------------
A0A2E9VST2      EEAIPM---------------------TQSNSHRPRKRFSRDESSDRYAA----------
A0A356A6X2      EEAIPI---------------------SNNNSQRPRKRFSRDQSSDRYAA----------
A0A5C5XLM3      EEAIPI---------------------SNNNSQRPRKRFSRDQSSDRYAA----------
A0A7C5FXU1      ---------------------------------------------KETK-----------
A0A3M1VCL4      ------------------------------EEHDGKRRSGRGKRAKKAA-----------
A0A5C5V7Z9      APPTSP---------------------VDPDPRDWRRLGGDDADPARAA-----------
A0A5C5YT05      EHDLSP---------------------VEPAAASWRRPTEGPADADRAA-----------
A0A518D7F9      -------------------------------------EDDTPIAPLRAA-----------
A0A5C5ZIP0      -------------------------------------EILENNAPGKAA-----------
A0A518KBK3      -------------------------------------VSHADENRPMAA-----------
A0A5C6AKF9      -------------------------------------DEPNDRSLPVAA-----------
A0A6M5Z0K7      -----------------------------------SIVPVATVVETGQPL----------
A0A350CI62      GHSG------SPEQPVAAGHS------VSAGLYSISVGGSRSSGDSSRAA----------
A0A4P5WQK6      GHSG------SPEQPVAAGHS------VSAGLYSISVGGSRSSGDSSRAA----------
A0A3C1X4W5      SQPS--------------------------------------------------------
A0A3D3W3A7      SQPSLSGYGMTSGQSATAGQS------VSAGLYSISVGGSRGSGDSSRAA----------
A0A518DRX3      TPQHSPVVRRPDRSTSSQPTSTPTTPTRRRPAATQSDDHQPQVTRRRAA-----------
A0A518DZF9      TPQHSPVVRRPDR-TSSQPTSTPTTPTRRRPAATQSDNHQPQVTRRRRAA----------
A0A518AKT8      ---------------------------EDEEEPLPGEASLPHDDDSRRAA----------
A0A5C5ZR72      ---------------------------PEQEERPEGLVGVPGGV----------------
A0A7C5R0U3      ---------------------------SRDGDGDDASATLPLRGSRAA------------
A0A517TY85      ---------------------------HR-------------------------------
A0A5B9QEI7      ---------------------------HE-------------------------------
F0SI78          TDA---------------------------------------------------------
A0A517MDV3      ----------------------------------GQRKVNAYFRAPQSNG----------
A0A518IQ30      ---------------------------QDDVVESLPLQQAPTQAPHRKVA----------
A0A517LWP4      ---------------------------QDDTVDALPMQQAPTQPPHRKAA----------
A0A518JNW8      ---------------------------HDDAVEALPMEQTPTQSPHRKAA----------
A0A2E7ENQ5      ---------------------------PIQDPQVFQRPADDASEPRRRAA----------
A0A7C2KUQ9      ---------------------------LPSPRPANSADSALETPSLPASQ----------
A0A7C5BZF0      VKKEISP-------PTVAAEETAGELGGEDNREFGGEIVPSNLRKVRRVA----------
A0A1G3AQE9      EAAAIGK-------DAAGAQGNGVSRWKEAD-------PPPGLVP-RRVA----------
A0A3L7UQT9      -----------------SEHEAG----DEEP-------ASDEVQPLRRAA----------
A0A4P5YBU2      -----------------SEHEAG----DEEP-------ASDEVQPLRRAA----------
A0A7C7V5U8      HPSLVAE-------NTLAGHTCG----QPDS-------SPPGIVPQRRVG----------
                                                                            

A0A5S9IJB5      ------------------------------------------------------------
A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      GAD-------KTDDPETPRTS---------------------------------------
A0A3D3UVZ8      IADADNTDTSETDSENRPTEA---------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          STEARLSDR---------------------------------------------------
A0A0S8FY64      RSSAECDIGLPSASVSPQHCRIANSGGRIVVEDLGSANGTFVGYRRVRRATVGPGDVIRI
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      ------------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      ------------------------------------------------------------
A0A5C5ZZN3      ------------------------------------------------------------
A0A5C5XS91      ------------------------------------------------------------
A0A5C6C4E6      ------------------------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7C4Z5R7      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      ------------------------------------------------------------
A0A7C5R0U3      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7C2KUQ9      ------------------------------------------------------------
A0A7C5BZF0      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
                                                                            

A0A5S9IJB5      ----------------
A0A5S9IPR9      ----------------
A0A533Q9U4      ----------------
A0A533Q6B7      ----------------
A0A1U9NNE1      ----------------
A0A2G2JCA2      ----------------
A0A1G2XVR0      ----------------
A0A1G3B0P0      ----------------
A0A1E3X4X0      ----------------
A0A286U4B3      ----------------
A0A5C6DDS2      ----------------
A0A2E3GW02      ----------------
A0A5B9QNZ7      ----------------
A0A1Z8N7H5      ----------------
A0A1G2YPI3      ----------------
A0A1U7CZ81      ----------------
A0A142YNY8      ----------------
A0A1U7GLS6      ----------------
A0A532UIN2      ----------------
A0A0S8KNX5      ----------------
A0A3D3UVZ8      ----------------
A0A517NFU9      ----------------
A0A5C5YWH4      ----------------
A0A3D2TNK4      ----------------
A0A7C1Y4F0      ----------------
A0A6I0ENW6      ----------------
A0A6L3A0B7      ----------------
A0A0J1B4A0      ----------------
A0A142WSB9      ----------------
M5SZR3          ----------------
M5TW92          ----------------
A0A2S8FKY2      ----------------
A0A517N8P6      ----------------
A0A432MJP4      ----------------
M5UQ35          ----------------
A0A0S8FY64      SPYTISVEGPTGNRAG
A0A1N6KFT7      ----------------
L0DFG4          ----------------
A0A5C5XXG1      ----------------
A0A7C7YUM8      ----------------
A0A7C2AHI6      ----------------
A0A518BJJ1      ----------------
A0A518D182      ----------------
A0A5C5WTY6      ----------------
A0A5C5Y033      ----------------
A0A5C6G1Y2      ----------------
A0A354PDV6      ----------------
A0A5C6FZ02      ----------------
M5TIT3          ----------------
A0A5M6CY44      ----------------
F2AXG2          ----------------
M2BB46          ----------------
L7CLQ6          ----------------
A0A0J1B719      ----------------
Q7UF18          ----------------
A0A2G1W1E0      ----------------
K5E235          ----------------
A0A5C6FFI9      ----------------
A0A5C5WDJ1      ----------------
A0A5C5X547      ----------------
A0A353FIP5      ----------------
A0A5B1CIK7      ----------------
A0A5C5WHS2      ----------------
A0A5C6B6G8      ----------------
A0A5C5ZZN3      ----------------
A0A5C5XS91      ----------------
A0A5C6C4E6      ----------------
A0A2E1VVJ1      ----------------
A0A3M2AEL0      ----------------
A0A2A2W9R6      ----------------
A0A518HKC1      ----------------
A0A518L3P0      ----------------
A0A255R1S0      ----------------
A0A5B9MKP1      ----------------
A0A0S8J591      ----------------
M5RT57          ----------------
A0A351FYP6      ----------------
A0A2E7ESJ6      ----------------
A0A2D5AWU0      ----------------
A0A1G2YQB7      ----------------
A0A353P687      ----------------
A0A356EME5      ----------------
L0DC26          ----------------
A0A3L7P4E4      ----------------
A0A3L7PEB5      ----------------
A0A1U9NL64      ----------------
A0A2N1UCJ3      ----------------
A0A7C4EK84      ----------------
A0A7C3F0T2      ----------------
A0A2E0X4J3      ----------------
A0A5C5YU10      ----------------
A0A517MPZ6      ----------------
A0A5C6CNV7      ----------------
A0A518K5H4      ----------------
A0A5C6AA28      ----------------
A0A2E9VK20      ----------------
A0A3D4PJK1      ----------------
A0A532UT69      ----------------
A0A355AI52      ----------------
A0A354PCQ3      ----------------
A0A0S8GZ23      ----------------
A0A1I3DDV4      ----------------
A0A2E0SMM6      ----------------
A0A3L7SI46      ----------------
A0A356KTN1      ----------------
A0A5B9PJZ8      ----------------
A0A2S8G191      ----------------
A0A2E7EGG1      ----------------
A0A2E2N5A9      ----------------
A0A7C8AGA2      ----------------
A0A7C2FXP7      ----------------
A0A2E3GWC6      ----------------
F0SLB0          ----------------
A0A3L7NDH9      ----------------
A0A1N6DAJ8      ----------------
A0A532UD06      ----------------
A0A660URN1      ----------------
A0A517ZCB5      ----------------
A0A225EH48      ----------------
A0A518INW8      ----------------
A0A518JPH9      ----------------
A0A5C5VEK8      ----------------
A0A532UTJ0      ----------------
A0A432MFP3      ----------------
A0A2E2CCW9      ----------------
A0A3C0AGX3      ----------------
A0A518AAQ5      ----------------
A0A517QBG9      ----------------
A0A518FTU3      ----------------
A0A517WHH5      ----------------
A0A5A8BGT3      ----------------
A0A2E7K7A9      ----------------
A0A517PTS5      ----------------
A0A6I6AH34      ----------------
A0A517VTK3      ----------------
A0A517WQT4      ----------------
A0A517VID8      ----------------
A0A517RK10      ----------------
A0A518IH18      ----------------
A0A5C5XLF4      ----------------
A0A2D5NDU9      ----------------
A0A1P8WP26      ----------------
A0A3L7V1F3      ----------------
D5SZ21          ----------------
A0A286RGB6      ----------------
A0A518CHE5      ----------------
A0A1V5N3W2      ----------------
A0A3E0MY27      ----------------
A0A7C4Z5R7      ----------------
A0A2E0X9P6      ----------------
A0A286RLF2      ----------------
A0A517NSK8      ----------------
A0A5C5Z0D6      ----------------
M5UE94          ----------------
A0A2E8FLY0      ----------------
A0A3D2U1E1      ----------------
E8R3W3          ----------------
A0A5C5ZM48      ----------------
A0A5B9WF77      ----------------
A0A518BBX8      ----------------
A0A1P8WN28      ----------------
A0A3B9CTT0      ----------------
A0A518ALT3      ----------------
A0A3M1QRP3      ----------------
A0A517TMV0      ----------------
A0A3E0MY88      ----------------
A0A5B9QF68      ----------------
A0A5B9QGF0      ----------------
A0A5C6CK24      ----------------
A0A2E3RCU8      ----------------
A0A1C3E6N1      ----------------
A0A518GJT2      ----------------
A0A2E8B0L9      ----------------
A0A5Q4GFE7      ----------------
A0A257WS34      ----------------
A0A7C4LP10      ----------------
A0A517MLW3      ----------------
A0A5B9QVD0      ----------------
A0A3A0DET7      ----------------
A0A3B8PNV4      ----------------
A0A3D1DR40      ----------------
A0A2E7RYU8      ----------------
A0A3B8LXG8      ----------------
A0A286RD13      ----------------
A0A2E3GWX1      ----------------
F0SG60          ----------------
A0A2E9VST2      ----------------
A0A356A6X2      ----------------
A0A5C5XLM3      ----------------
A0A7C5FXU1      ----------------
A0A3M1VCL4      ----------------
A0A5C5V7Z9      ----------------
A0A5C5YT05      ----------------
A0A518D7F9      ----------------
A0A5C5ZIP0      ----------------
A0A518KBK3      ----------------
A0A5C6AKF9      ----------------
A0A6M5Z0K7      ----------------
A0A350CI62      ----------------
A0A4P5WQK6      ----------------
A0A3C1X4W5      ----------------
A0A3D3W3A7      ----------------
A0A518DRX3      ----------------
A0A518DZF9      ----------------
A0A518AKT8      ----------------
A0A5C5ZR72      ----------------
A0A7C5R0U3      ----------------
A0A517TY85      ----------------
A0A5B9QEI7      ----------------
F0SI78          ----------------
A0A517MDV3      ----------------
A0A518IQ30      ----------------
A0A517LWP4      ----------------
A0A518JNW8      ----------------
A0A2E7ENQ5      ----------------
A0A7C2KUQ9      ----------------
A0A7C5BZF0      ----------------
A0A1G3AQE9      ----------------
A0A3L7UQT9      ----------------
A0A4P5YBU2      ----------------
A0A7C7V5U8      ----------------
                                

© 1998-2021Legal notice