BYKdb

Dataset for cluster tadcd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

204 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A3L7SI46      -------------------------------------------------------MSSDF
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      -------------------------------------------------------MSNPI
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A517MDV3      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A5B9QNZ7      ------------------MPGQTVGPVSIKREYRCSPQDRPDIPPIFTGFTYSQALPCFT
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      MPLYIDSQPTARLSVLSSILQALQRAQIPRMLCVSFLSRMTLSPWNIRREPVRRYFGTGY
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A3A0DET7      ----------------------MSAVRTLSRLTECRGNGRVLCGALFRLFGDGKPDGLPL
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      ------------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      ------------------------------------------------------------
A0A5C5ZZN3      ------------------------------------------------------------
A0A5C5XS91      ------------------------------------------------------------
A0A5C6C4E6      ------------------------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      ---------------------MNKSEMNLPAFATSNPMLSSVTEEFRPEVDSEMSLLSYW
A0A533Q9U4      ------------------------------------------MLPFKGDESEEIHILDYV
A0A1U9NNE1      --------------------------MNQIDKYYESYLGSYAQEGTKQESENTLTLFKII
A0A2G2JCA2      ------------------------------MNMITNSTPNYRPAKPPAEKKPFISPQLVL
A0A533Q6B7      ---------------------------------MIPVDQRKPQSHTNRRENTEVHLLDYL
A0A351FYP6      ----------------------------------------MEPTSRKENSSDKLHILDYW
A0A2E7ESJ6      -----------------------MRHQTELHQPNQSSTDSPAHWGATSMDTVSSQGVDVG
A0A1G2YQB7      --------------------------MNSLTKFTENQIIMQKSNMIEPDNESETA--NLI
A0A353P687      --------------------------MNTLTKYSDNHNLAQSGGMVYPTNEDGDPALNIL
A0A356EME5      ----MSRRPDLSHSSLTERSAERAGPPAVSTSGMRPLNAPGVRKRTAGSSQEMSPRFLLN
A0A355AI52      -------------------------------------MLDHEKQELDSTAQSMRQAVRFL
A0A3L7SI46      VEIQDSRLGGLSDLADDKVSAKLHFISHWLFRMNTNERLTSDLDSTANGPNLLGEAVRFL
A0A3L7P4E4      --------------------------------------MSEFVPPSNPNVEPEEAGFDLW
A0A3L7PEB5      --------------------------------------MSEFV-TNSPNAEAEEAGFDFW
A0A2N1UCJ3      ---------------------------------MTDKKTNIENEAGSVEQMMSGTHRTFA
A0A517ZCB5      -------------------------------MNKLVLEGAGDATGRGESLDFVRGVVRFG
A0A432MFP3      -----------MDTSETTRPQYELARLSDLPPALRAPLPPASRPASDGGGLPINPRLVLR
D5SZ21          ----------------------------------------------------MQTLMRFW
A0A518CHE5      -----------------------------MNPYLDQSNSNESSNHDNSTSAMMARVMRFL
A0A257WS34      -------------------------------------------MQQAHHSTVLSELMRFL
A0A2E8FLY0      ---------------------------------MSRPTDTPIDTSGEPRTATLTAIARFL
A0A3D2U1E1      ------------------------------MSTDQSHPNRPLDETA-PQAATLTRIVRFL
A0A1P8WP26      ------------------------------MTTSQRQVNTVGAGGQDALAMTLHAIARFL
A0A3L7V1F3      ------------------------------MSGPENQILGMQEQGQNTAASTLHLMFRFL
A0A5B9QF68      -------------------------------MTNTDCKHNLREDAFMPAVDAVSAIARFL
A0A5B9QGF0      -------------------------------MINSDFNQNQADADFMPSVDAVSAVARFV
A0A5C6CK24      -------------------------------MTSTDFNQNQNDAEFMPSVDAVSAIARFV
A0A2E8B0L9      ------------------MSQTPELRAVSPPHSFDELHDPQD-----GAAEAVQAVAKFL
A0A5Q4GFE7      -------------------------------MMQHEQHSSADESMLPSSADSIHALIRFL
A0A2E3GWX1      -------------------------------MVSPEQYDLAAMPLPQETVNPLTTVIRFL
F0SG60          -------------------------------MVSPEQYDLAAMPLPQETVNPLTTVIRFL
A0A2E9VST2      -------------------------------MPAPENYDPQMNMHLQENHNPLQTILRFV
A0A356A6X2      -------------------------------MPAPENYDPQMNIQLQDNHNALQTILRFL
A0A5C5XLM3      -------------------------------MPAPENYDPQMNIQLQDNHNPLQTILRFL
A0A3M1VCL4      ------------------------MTQDVPSLVLQQEASRAADLAAVPAINPLASLLRFA
A0A5C5V7Z9      -----------------------------MTAADHQPGFQDEGVQEGSLAESLHGLVRLL
A0A5C5YT05      -----------------------------MTAVDQQGGFPEEAAHEGSLADSLHGLVRLL
A0A518D7F9      ---------------------------MKQSPTAALAREEEWQDDSGAAGAALEGVLRFL
A0A5C5ZIP0      -----------------------------MTQNQEHFHEPEITVSSAGPNEALQGVLRLV
A0A518KBK3      -----------------------------MSLDTVNDRGEPWGNELDAGGHALEAVVRLT
A0A5C6AKF9      -----------------------------MSLESANEHGEPWRDDNDASEHALEALVRLA
A0A2E0X4J3      ---------------------------MSPNSLVETDPFAPPVESRPGPPSAAGSEVNLL
A0A5C5YU10      --------------------------MNPLVTTPHGALDSEPIGQMQSSAAAPPQSTDLL
A0A517MPZ6      --------------------------MSSLVEYEDDYSLDADPQPNAGKGDDSALQTNLL
A0A5C6CNV7      --------------------------MSSLIEYDSNTQL--EPSGMAHDHAAGAGQTNLL
A0A518K5H4      -------------------MASSPANPYAPTPVAMSHVSPLATAAMSVDQEDDSDGVNVL
A0A5C6AA28      ----------------MALPPSAPASTYAMTPSSAS----LPAPGMIIDQDEDAGGVNVA
A0A2E9VK20      -----------------------------MKPSSDKNSRNVDTVHGHPLVKADEPAIDLV
A0A3D4PJK1      -----------------------------MKPSSDKNSRNVDTVHGHPLVKADEPAIDLV
A0A0S8GZ23      -------------------------MDKLEKYQPQEITPNIDYLEADSAPKDSSILHLFQ
L0DC26          ------------MMLNSNPGPGADSVNLPAVVPPHRAEVLSVTPAHFESSASLDPITLLR
A0A354PCQ3      --------------------------------------------MPSSSAAQFDPWILWV
A0A1I3DDV4      -------------------------MSDMPQKPDSQMPVKPMMDTRPMLDPNATGSFDVV
A0A2E2N5A9      ------------------------------MTSKPPSIEHHLTAVPHGPAEAELDLRKLW
A0A2E3GWC6      --------MPADASRSGFERNIAMRQNETMNQPTVESKNNPAPFPSHQMMQTPEPTVDLV
F0SLB0          --------MPADAGRSGFERHIAMRQNETMNQPTVESKNNPAPFPSHQIMQTPEPTVDLV
A0A2E0SMM6      ----------------------------MNPYLDQSSTNEKSGGHDNSTSAMMARVMRFL
A0A1N6DAJ8      -----------MMSNSNSGPRSDSANLPAVVPPYRTAEVFSIAPAPVGTAAGLDPIALLK
A0A5B9PJZ8      -------------------MSGLRPVQNNNNNYGIPQPQGSGSMPSSGGGLSELYNFDVF
A0A2S8G191      -------------------------MSLNNANLPQESSKRDIRVDAPVELVTGHANDFLS
A0A2E7EGG1      -------------------------------------------MSASTKRRRIENLTQFE
A0A225EH48      ---------------MQRSSASEAQMPIPLTPAQPSGQQYASGFQPSVPGQTLAPTAAAR
A0A3L7NDH9      ------------------------------MQENMSYSGSADGPHVDAMAQIVQNSMRFL
A0A518INW8      ----------------------------------MQTNHPMNEMTLPAEGITDSQPGDMT
A0A518JPH9      ----------------------------------MQTNHSTKEIAFPADGMLDSPPSDVT
A0A2E2CCW9      -------------------------MNTDFQPLDQQSDFAIDGMEENAEINSSGPGVDIV
A0A3C0AGX3      -------------------------MNTDFQPLDQQSDFAIDGMEENAEINSSGPGVDIV
A0A518AAQ5      -------------------------MNTEFQPLEPHSDLDFDGMEESN-MNSSGPGVDIV
A0A517QBG9      -------------------------MNTEFQPLDPHSDLDFDGMEESN-MNSSGPGVDIV
A0A518FTU3      -------------------------MNTEFQPLDPHTDLDFDGMEESN-MNSSGPGVDIV
A0A2E7K7A9      -------------------------MNTEFQPLEPHSDLDFDGMEDST-TNASAPGVDIV
A0A517PTS5      -------------------------MNTEFQPLEPHSDLDFDGMEDST-TNTSAPGVDIV
A0A517WHH5      -------------------------MNTEFQPLEPHSDLDFDGMEDST-TNASAPGVDIV
A0A5A8BGT3      -------------------------MNTEFQPLEPHSDLDFDGMEDST-TNASAPGVDIV
A0A517VTK3      -------------------------MNTEFQPLENHSDFEFDGMEGHTQSNTSGPGVDIV
A0A517WQT4      -------------------------MNTEFQPLENHSDFEFDGMEGNTPSNTSGPGVDIV
A0A517VID8      -------------------------MNTDFQPLDQQSDFALDGMEENAEFDSSGPGVDIV
A0A517RK10      -------------------------MNNEFQPLDQQSDFAIDGMEEHAPINSSGPGVDIV
A0A518IH18      -------------------------MSTEFQPLDQQSDFAIDGMEEHAPTNSSGPGVDIV
A0A5C5VEK8      -------------------------MTSLVSSQQGQFDPVPNDQFGPGPSSQAPQSTDLL
A0A532UTJ0      -----------------------MNEIKKLNEPVAGQELVNLQIPPEQSSEPTSDLVA--
A0A517NSK8      ------------------------------------MTQVDPNLNNQ--TADDSEALDLI
A0A5C5Z0D6      ------------------------------------MNDTTISSPNE--SAGDTDILDLL
M5UE94          ------------------------------------MNDTAAPQPRSYPEQQETDLLDLL
A0A1P8WN28      ------------------------------------MDPYTLEQLDSTEPQGFHALLRFL
A0A3B9CTT0      ------------------------------------MELEQPEQSASSQGNSLQGLLRFL
A0A5C5XLF4      ------------------------------MPSSDKNSNNADAVHGHPLIKADEPAIDLV
A0A2D5NDU9      -----------------------------------------------------MSFGQVL
A0A286RGB6      -----------------------MTPEREAGMSEHQHLPAPVGQDRTGAARPSAPAPLYL
A0A1V5N3W2      -------------------------MDSVVKYKPQPHPQEFVYTDVPPEAAPAAPLGLFR
A0A3E0MY27      DPKKPSERPLDVVSERPGEGALPVPTSGKDAVFDAIQTSTPARVRPEILTAPPKPMDLLR
A0A2E0X9P6      -----------MSHSAKEDHDYQLPAPRPPTEWTRQAVTASRPSRRADDSEGMPPDFVRR
A0A286RLF2      ----------------------------------MNESSWIQWAVPDSASHILHAIAQFL
A0A5C5ZM48      ------------------MNKMITPPTQDLTGAAIPAPMVIDAEGDDQSHSALSGQAIVG
A0A5B9WF77      -----------MNTPDRSDANLPARLTSSPRYPAQVSAMRREMDVAGAPSVTIDTRQLFR
A0A518BBX8      ---------------------------------MDRQEPFDPNASDDSPIIAMPDLTRLV
A0A518ALT3      ------MSESHPNSKDSRHQLTTTHEELAISRRRNITHARQGSGSKQPTQSGITPLFVWR
A0A517MDV3      --------------------------------------------MSGDNTVSPQPNLDFW
A0A3M1QRP3      ------MSDKPSRAQDESHALAAGEPLTPAAPFAATDAIDVFAADSGEEREPQKLSLSPA
A0A517TMV0      --------------------------MGTAIEEYSNRQDALAEPALGGGGDAFESLVRLV
A0A2E3RCU8      --------------------------------MSVETDDGAYELPLTNAAGAIHDVFQFL
A0A3E0MY88      ----------------------------MSHAPDKLDLEAIGTLDDPSVSHIVHHVVQFL
A0A1C3E6N1      ---------------------------------------------MMPEANTMQTLMRFW
A0A518GJT2      ----------------------------------------------------MQTLMRFW
A0A286RD13      -----------------MSDLVRVLGTSPPSTLASGNSVAPTPLQRETLHGPPKPSDVLH
A0A517MLW3      ----------------------------------MNQIENLSGPQHLTAADAIQALLRFG
A0A5B9QVD0      ------------------------------------------------------------
A0A3B8PNV4      --------------------------------MSQSPDDRPIAAPNEPQTATLAAIVRFL
A0A3D1DR40      --------------------------------MSQSPDDRPIAAPNEPQTATLAAIVRFL
A0A2E7RYU8      --------------------------------MSPSPDDRPIAAPNEPQTATLAAIVRFL
A0A3B8LXG8      --------------------------------MSPSPDDRPIAAPNEPQTATLAAIVRFL
A0A350CI62      -------------------------------MTDQDRILAGSQDGTNAAATTLHLLFRFL
A0A4P5WQK6      -------------------------------MTDQDRILAGSQDGANAAATTLHLLFRFL
A0A3C1X4W5      -------------------------------MTEQDRILTGSQDGQNAAATTLHLIFRFL
A0A3D3W3A7      -------------------------------MTEQDRILTGSQDGQNAAATTLHLIFRFL
A0A518DRX3      --------------------------------MTTELSLVSPDAEGSSPRDIMQAALRFL
A0A518DZF9      --------------------------------MTTELSLVSPDAEGSSPRDIMQAALRFL
F0SI78          -----------------MTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPTSSESGFDIR
A0A518IQ30      ----------------------------MQRESAPRLSETEQGSDEFQAADAIHAALRFL
A0A517LWP4      ----------------------------MQRESAPRLSETEHGSDEFQAADAIHAALRFL
A0A518JNW8      ----------------------------MQRESAPRLSETEHGNDEFQAADAIHAALRFL
A0A2E7ENQ5      -----------------------------------MNERRALPPTAGSQTHLVHTAMRLF
A0A1G3AQE9      ---------------------------------MQEPAVVRDELESESTAHMVHRLVQFA
A0A3L7UQT9      ---------------------------------MNSDVQQPAPAPILNTANVVAGMIRFL
A0A4P5YBU2      ---------------------------------MNSDVQQPAPAPILNTANVVAGMIRFL
A0A518AKT8      -------MLKTPESNNLSSMEQS--------------------DDISTSDMIHAGLRIWR
A0A5C5ZR72      --------MNEDQKSKQSQLTHRTAGSEGARGGSAHARHALKPSRAEAAQPQIGPMFFWW
A0A517TY85      --------MNLPPEPTREPTNLVVRPTQSRAPALANMTPAGG-SDAAAAMQGITPALVLK
A0A5B9QEI7      -------MNNSPNPPEHESTGSGLPARIPVAHALRRPMPAAARQNSTPNEQGITPAFVWR
A0A5S9IJB5      ------------------------------------------------MDKQEFNIHQYI
A0A1G2XVR0      ---------------------------MLTESEIQP---------------KQLDIRKYL
A0A1G3B0P0      ---------------------------MLTESEIQP---------------KQLDIRKYL
A0A1E3X4X0      ---------------------------MLNNK-------------------EQTHLTDYI
A0A286U4B3      ---------------------------MNNDSFLNQTQDPSNYYSGKTSSLDEIHLRDYF
A0A5C6DDS2      ---------------------------MKNDSYQNQTED--SFYNGETAFLEEINLRDYF
A0A0S8J591      --------------------------------------------MAVKRPERKMHLTDYL
A0A2E3GW02      ----MKIRLSPEGEFSNVTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPPSSESGFDIR
A0A1U9NL64      ---------------------------MNESFKTPQVNSSHEEANGDFEGREEGFQRSLF
A0A5B9QNZ7      DYFSGLNETDRGPVTTGTIVPPPAVDSPPPGRFPWQSYANESIPMSHEPTTSPEPVLDLW
A0A1U7CZ81      -----MDTTDSNDSLLPARLPSSSSSHLPAMSAAN--RHAYDL--TTVSSSVQISPQGVL
A0A142YNY8      -----MDTSDRHDSTLPAR-SHTPSSGVPARAATNFGGGSREL--AVGASTMQVNPTSIL
A0A1U7GLS6      -----MDTSDRPDSMLPAR-PTPPAPPVPSRGPASFGGGPRDLVPTSAAPALQVDPVSIL
A0A1Z8N7H5      ------MHLIDLLILGLALRRESRVSNEEGSLMSVETDNETYDAPLTNAAGAIHDGFQFL
A0A1G2YPI3      ------------METNNEFGQTEIVGHNMIDQQENNGHAGLANSHVGMPLPTQMMSESLV
A0A532UIN2      SDSISALIYAPKTFSEMTDQNRRRTRGSDVISQYENNRTFARDALQGGPRSAGITSESLV
A0A532UD06      --------------------MDHEALANGSQDLMSEQGHSQ----------PQEGLFQIA
A0A660URN1      -------MRTDNISNPGAQMDKDSPVDNGAYNIAPAAGADH----------LQSSLLQIA
A0A0S8KNX5      --------------------------MSDLEKYHDQVVGQQVVNFQIPPEPGRVGTSNLL
A0A3D3UVZ8      --------------------------MNELEKYHSQATGQEIVNLQIPPEQESEATSDLV
E8R3W3          ----MNPTDPVSAPPRDSHPSSPRPGTAMTRVAVDARPAKPALPPREEALATTLELGDLL
A0A517NFU9      ------------------------------MESSVSESASK----------ATVIEINLL
A0A5C5YWH4      ------------------------------MDSPTTESASK----------APVIEINLL
A0A3D2TNK4      --------------------MTDLNTSADIQSNFEASAESE----------LVPTIMRLL
A0A0J1B4A0      --------------MLFADQSIEFLKIMIRSNPSADDVNGD----------ELDIDLDLL
A0A142WSB9      --------------------------MTQPNPASANGNELAFAPPGLQASSLPGRSIDLV
M5SZR3          ---------------------------MNSNRKLVSRNANS----------QDEQLLDLK
M5TW92          ---------------------------MNSNRKLVSRNANS----------QDEQLLDLK
A0A2S8FKY2      ------------------MSNGNLVISSEKDRRRQGTNVPGTVVANRPQEEDGMQFGQVL
A0A517N8P6      ---------------------MQPASHTQTSRSDIGMAPPM----------SGPSDVSVG
A0A432MJP4      -----------MRLPDPQGSEADSTMSDRPLASDTNPSAHL----------GAAELKHLI
M5UQ35          ------------------------------MTNQEDDIDGD----------DFELDLDVL
A0A5C5WTY6      MNSSNGPSSKGMTSRLSKVEAAKAHYADESPATAPQSRRGASYYGYGYEQPKWGETINPL
A0A5C5Y033      --------------------MTGSTSVTQHQPNGRGGSTGSPRSGLGLPLRNSVEAINLP
A0A5C6G1Y2      --------------------MTGSTSVTQHQPNRRGGSTGSPRSGLGLPLRNSVEAINLP
A0A354PDV6      ------------------------MNREITSTGTDRQFNLN----------DQELSIDIL
A0A5C6FZ02      ----------------------MTENNAKPSAPAKSESRVT----------EDVVTLDVL
M5TIT3          ---------------------------------------ME----------ELSDSIDVL
A0A5M6CY44      --------------------MRQLPMPAAKSSSTRPRRPVA----------PEPDSLDLL
F2AXG2          --------------------MAESAKPTNRLPSRSPSNSTS----------DGEETLDVL
M2BB46          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDVL
L7CLQ6          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDVL
A0A0J1B719      --------------------MAESAKPTNRLPARGPSSASS----------DGEETLDVL
Q7UF18          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDVL
A0A2G1W1E0      --------------------MAESAKPTNRLPARGPSSSTS----------DGEETLDVL
K5E235          --------------------MAESAKPTNRLPARGPSSSTS----------DGEETLDVL
A0A5C6FFI9      ------------------------------------------------------------
A0A3A0DET7      PRHLATPSAKDPPPPMSSLIESDSFSVGEPTSYGAPHGRAA----------RTGREVSPL
A0A5C5WDJ1      --------------------------------MTESTKSFS----------FASGEIDPL
A0A5C5X547      -MSTDVGKPLAANGRSSRGLNNPQAPYLVQNTVSTAPAEEG----------SGIQLSAIW
A0A2A2W9R6      ----------------------------MKRYQDETLEADD----------AAELSIDLL
A0A518HKC1      ----------------------------MKRYQDEALDADD----------GAELNIDLL
A0A518L3P0      ----------------------------MKRYQDEALDADD----------GPELNIDLL
A0A255R1S0      ----------------------------MSSHSDEA--QSD----------GMEFDIDVV
A0A5B9MKP1      ----------------------------MKRYEDEAFEADD----------GAELNIDLL
A0A0S8FY64      ---------------------------MEDTLAAEAYPDEV----------REFDIRHHF
A0A1N6KFT7      ----------------------MAIQQSITGPGSEGPPSRT----------LQNDLVALW
L0DFG4          ----------------------MANQQSITGSVSEGYPSRT----------LQNDLIALW
A0A5C5XXG1      ----------------------MRLVVDVVGVDDSSESPAV----------AESRI----
A0A518BJJ1      -----------------------MFRHDQNTAGGVRDAVPE----------LRAIL----
A0A518D182      ----------------------MPLTHEGTDRNGSPDPAAG----------LRHVL----
A0A353FIP5      -------------------------------MPIPTSNAPE----------PKVDFNEAI
A0A5B1CIK7      --------------------MANTNEISASRVRQNARPSVE----------EEQDSLDVF
A0A5C5WHS2      --------------------MATSTENTSLRTQLSNRLSSD----------EDNDGLEIF
A0A5C6B6G8      ------------------MAPTNSQNPNNN-PRRRSAKTTS----------ENADSLDVL
A0A5C5ZZN3      ------------------MNKAENVEPVNRIARRPASSAME----------DPSETLDVL
A0A5C5XS91      ------------------MIMAEPNEPKNRIQALTRPKSDD----------DQADSLDVL
A0A5C6C4E6      ------------------MIMAEPNEPKNRIQSLTRPKPDD----------DQADSLDVL
A0A2E1VVJ1      -----------------------MSTVSGSPPTGPDANTGA----------KQIDVLELL
A0A3M2AEL0      -----------------------MDTFAAPPPEHDDQ---A----------VTLSLPRLL
A0A532UT69      -------------------------MTSDMTDKNTDLKMVGVARSIANTPPTSGFMPESL
A0A2D5AWU0      ---------------------------------MSEIRIPQIEQSSSGGGESVDAGRLFQ
M5RT57          -----------------------------------------------------MGPRYLI
A0A356KTN1      -----------------------------MQAPQTGLESDFGRSPTISDPLDAEDLRETL
A0A518HFS8      -------------------------------------------------------MPALL
                                                                            

A0A5S9IPR9      ---------------------AILRKHLIL-VAFCGVVG-AITAV-FYTSRLPNM-YRAG
A0A533Q9U4      ---------------------KIIRKRMWM-VIIFFVVI-VAIVT-IKTFKTTPV-YQAT
A0A1U9NNE1      ---------------------KALLRRWYI-VLLTVVVL-CAIGIPAIFYMFKPS-YETV
A0A2G2JCA2      ---------------------HALRRWWMIVIPIGMVLG-SAGAA-GLWSRYEPV-YKAS
A0A533Q6B7      ---------------------KIIQKRMWI-CVIVFIAI-VAVVV-VYTLRTQPL-YQTT
A0A351FYP6      ---------------------RIIRVRIVT-ILLVFLLT-AITTT-VVTFLIPKT-YMSL
A0A2E7ESJ6      ---------------------GILSRRKWL-VILGFMLG-LGLGY-VYMLQATPR-YESV
A0A1G2YQB7      ---------------------AIMRKRWKI-LTVTAIII-CGIGLPLIWLLVKPY-YLAT
A0A353P687      ---------------------TAVRKRWKI-LLFTMIII-CSIGLPAVWMFIKPF-YLAT
A0A356EME5      ---------------------ALLHWWKVA-MPVGLILA-AVAVA-GVWWFFEPV-FLSR
A0A355AI52      ---------------------RVLWHRRII-IMSTLALC-GMLGG-LYYATAARI-YEAK
A0A3L7SI46      ---------------------QVIRRKLPT-LLVCTILG-GVIGT-AWYVTATRK-YESV
A0A3L7P4E4      ---------------------GFLCRRAWL-GFFFGTIG-ATAAY-YYYLRQPVV-FKAT
A0A3L7PEB5      ---------------------GFLWRRAWL-GFLFGTIG-ATAAY-YYYLRQPVV-YKAT
A0A2N1UCJ3      ---------------------VTLQRRRLS-ILITAVLF-VAAAI-LYLIKAEPL-YTST
A0A517ZCB5      ---------------------RVVRNRLHI-VLGILVSV-SILGG-ISYVLSPPV-YESA
A0A432MFP3      ---------------------GLARHWWQA-LALWVVGS-AALAA-LVYLKFQPT-YRSF
D5SZ21          ---------------------RSVQYRKGL-IILAVLAA-SALGA-AYYIVSTRY-YESK
A0A518CHE5      ---------------------RVIMLRKKI-IVVCVILS-SVAGA-YRYSTQIPM-FQST
A0A257WS34      ---------------------HIVRLQMWT-LILTVAVT-GILGG-IYYMTADRV-YDSS
A0A2E8FLY0      ---------------------QVVRIRKGI-LFSTLFIS-TILGG-LYFATATRL-YESK
A0A3D2U1E1      ---------------------HVVRVRKGL-LFASVFVA-VLLAG-LYYATAPRL-YESS
A0A1P8WP26      ---------------------RTVRHRSGI-LLLCLVVS-GALGT-LYYVTAPRI-YQSK
A0A3L7V1F3      ---------------------RTVRLRSGI-LVATLVIS-SIAGA-TYFITAQRI-YQSN
A0A5B9QF68      ---------------------SLVRRRKQV-VITSVVIS-GLLGM-TYYLLATRK-YAST
A0A5B9QGF0      ---------------------GIVRRRKQV-VIASVVIS-GLLGM-TYFMLATRK-YAST
A0A5C6CK24      ---------------------GIVRRRKQV-VITAIIIH-VLLGT-TYYMLATRK-YAST
A0A2E8B0L9      ---------------------RVVYYRRSY-VITCVVVS-ALLGG-LYYYRASRV-YAAT
A0A5Q4GFE7      ---------------------QVVYHRKIY-VVSAVVVA-SLLGG-LYYTTATPI-YQAT
A0A2E3GWX1      ---------------------QSMLRRKWI-VMGWLTIT-VGLGI-TYFVLAPRL-YESS
F0SG60          ---------------------QSMLRRKWI-VMGWLTIT-VGLGI-TYFVLAPRL-YESS
A0A2E9VST2      ---------------------QSLIRRKWT-VMAWLTLT-ISLGM-TYFALATRK-YESS
A0A356A6X2      ---------------------QSLLRRKWT-VMAWLTFT-VSLGM-TYFALAPRK-YESS
A0A5C5XLM3      ---------------------QSLLRRKWT-VMAWLTFT-VSLGM-TYFALAPRK-YESS
A0A3M1VCL4      ---------------------HAVRMRKAI-LLGTLLIA-AVFGA-LYYLTATRY-YASN
A0A5C5V7Z9      ---------------------RLMQRNQST-IAWCVAGC-VALAM-AYYVAAPRI-YRST
A0A5C5YT05      ---------------------RLMQRNQAT-LAWCVAGC-TVIAM-AYYVAAPRF-YSST
A0A518D7F9      ---------------------RVVQRRQKL-VALIVAGH-LAVGA-AYYFTATRY-YEST
A0A5C5ZIP0      ---------------------RLAEQRHQT-LLWIVAGC-LGIGA-LYYGFAPRY-YRSE
A0A518KBK3      ---------------------RVVQYRRNT-VLWTLAGC-LAIGA-VYYVTAKRY-YRST
A0A5C6AKF9      ---------------------RVIRYRQQT-VLWTLAAC-LVVGA-AYYATAPRY-YRST
A0A2E0X4J3      ---------------------AIAWRSRWL-ILLFMILG-GAVSW-VLLQRATPR-YTSF
A0A5C5YU10      ---------------------ALAWQGRWL-ILIGVLIG-GSAAW-VHLQRVTPL-YQST
A0A517MPZ6      ---------------------SIAWQARWL-LLLTVLLG-VGCAW-LYLQRVVPR-YTSV
A0A5C6CNV7      ---------------------ELAWQARWL-LLLTVLTG-LGAAW-ILLQRVEPR-FTSV
A0A518K5H4      ---------------------AVAWQSRWL-ILLFTLLG-GVAAW-AYLQQATPR-YTSL
A0A5C6AA28      ---------------------AIAWQSRWL-ILLFTLLG-GLASW-LYLQRVVPR-YTSL
A0A2E9VK20      ---------------------KLALKNVVT-LGIAAAAG-IGLGI-FAYKILGPK-YTAS
A0A3D4PJK1      ---------------------KLALKNVVT-LGIAAAAG-IGLGI-FAYKILGPK-YTAS
A0A0S8GZ23      ---------------------PVLRRWYWV-LVIFILVS-AVGAP-IIWHVKRPI-YTTS
L0DC26          ---------------------ALRRRWALA-FGTGLLGA-AVIAT-LTFYLVPPAKYMAR
A0A354PCQ3      ---------------------TFRRCWAWA-LPIGALLA-GLAAF-FVLRNFVPI-YRAS
A0A1I3DDV4      ---------------------EIFRRQLPL-IACCTVLG-LLMAV-IYWANAEKW-YESS
A0A2E2N5A9      ---------------------MSVWLRKWL-ILGVMLFA-ALAAA-WATSWMTPL-YRAG
A0A2E3GWC6      ---------------------QLALRNIIW-LIIAGAVG-LGLGI-AAYKALGPS-YVAK
F0SLB0          ---------------------QLALRNIIW-LIIAGAVG-LGLGI-AAYKALGPS-YVAK
A0A2E0SMM6      ---------------------RVIMLRKKI-IVVCVILT-SIAGA-YWYSTQTPM-YQST
A0A1N6DAJ8      ---------------------ALRRRWPLA-VGAGLLGG-VVLAV-VTYFVVPPAKYTAR
A0A5B9PJZ8      ---------------------DMVRRKIWL-ILFFTLLG-IAAAL-LFFFQAPKT-YRST
A0A2S8G191      NNDVESEELGGGGIGVSQILHALRRRWLPA-FSIGIVLA-TAGVA-LAWVLDVPE-YTTR
A0A2E7EGG1      -----------HDFSLRMFTSVLIQWWRIL-IPVTLFAL-LISTV-FVFWSFRPQ-YRAS
A0A225EH48      -----------AWPTLPELVNALKRRLVLA-TFLGMLVG-MAAAA-AVWLALPSG-KHTA
A0A3L7NDH9      ---------------------QVLWRRKHL-LVASCAAA-GLLGG-LYYTTSKRT-FEAE
A0A518INW8      ---------------------RILRRRWPL-LMFGLVVG-LGIAF-AYHQNAKDV-FESS
A0A518JPH9      ---------------------RILRRRWPL-LLFGLVVG-LGIAY-AYHKNTKVV-YQSS
A0A2E2CCW9      ---------------------RLLLRNKYL-LVLGLAAG-LLLGQ-AAYMKLGPI-FSAD
A0A3C0AGX3      ---------------------RLLLRNKYL-LVLGLAAG-LLLGQ-AAYMKLGPI-FSAD
A0A518AAQ5      ---------------------RLLFRNKYL-IVGGLVAG-LLLGQ-AAYMKLGPV-FSAN
A0A517QBG9      ---------------------RLLFRNKYL-IVGGLIAG-LLLGQ-AAYMKLGPI-FSAT
A0A518FTU3      ---------------------RLLFRNKYL-IVGGLIAG-LLLGQ-AAYMKLGPI-FSAT
A0A2E7K7A9      ---------------------RLLFRNKYL-IVGGLLAG-LLLGQ-AAYMKLGPV-FSAN
A0A517PTS5      ---------------------RLLFRNKYL-IVGGLLAG-LLLGQ-AAYMKLGPV-FSAN
A0A517WHH5      ---------------------RLLFRNKYL-IVGGLLAG-LLLGQ-AAYMKLGPV-FSAN
A0A5A8BGT3      ---------------------RLLFRNKYL-IVGGLLAG-LLLGQ-AAYMKLGPV-FSAN
A0A517VTK3      ---------------------RLLFRNKFL-LISGLAVG-LILGQ-AAYMKLGPI-YSAS
A0A517WQT4      ---------------------RLLFRNKFL-LISGLAVG-LILGQ-AAYMKLGPI-YSAS
A0A517VID8      ---------------------RLLLRNKYL-LVIGLVAG-LILGQ-AAYVKLGPI-FSAT
A0A517RK10      ---------------------RLLFRNKFL-LVTGLVAG-LLLGQ-VAYMKLGPI-YSAS
A0A518IH18      ---------------------RLLFRNKFL-LITGLIAG-LMLGQ-VAYIKLGPI-FSAS
A0A5C5VEK8      ---------------------ALAWRGRWL-ILLGVLIG-GTASW-VYLQRVTPL-FLSQ
A0A532UTJ0      ---------------------GIFRRWYIV-LLVFLLIC-GAGLP-ATLFLVKPI-YSVT
A0A517NSK8      ---------------------GVLRRRIGF-IVLGVTLG-LIAAG-LYLLLTTPT-YRAE
A0A5C5Z0D6      ---------------------GMLRRRKGF-IALGLFLG-VAAAV-LYFFLTPPT-YRAK
M5UE94          ---------------------GILRRRKGL-IALGLFIG-VAAAV-LYYVLTPPT-FRAE
A0A1P8WN28      ---------------------RVVNRHRMI-LVGLVAAA-AFLAV-VRHKQIPKQ-YEST
A0A3B9CTT0      ---------------------RVVNRHKLI-IVGFVAAA-CFLAV-VKHNRQPQI-YEAG
A0A5C5XLF4      ---------------------KLALKNVVI-LGIAAVAG-IGLGI-FAYKILGPK-YTAS
A0A2D5NDU9      ---------------------AMLWRGRWT-ILATTLVV-TLAAF-IYGEVTGSR-WRAE
A0A286RGB6      DAEWQPIPAAEAGQGFGAYLHAFRRRWLAV-AFLGMLCG-AAAAA-AAWFLFIPQ-YTAT
A0A1V5N3W2      ---------------------ALRRRWYIV-FLVFVLLA-GAGLP-AVWFLVKPK-YQAA
A0A3E0MY27      ---------------------ALQRRWLLA-FVLGCMLG-IPAAV-ITWFVVPIE-YTAE
A0A2E0X9P6      ---------------------VLRNSWKWA-IPLGLLLA-AAAGC-AVMYLHVPK-YQAS
A0A286RLF2      ---------------------VAVRRRWQI-MLGAFLAV-ALLGA-LYYATAPRI-YSAK
A0A5C5ZM48      ---------------------AVRRWWVVA-TPVGLFLS-VAAVV-AICLMSQPV-YRAS
A0A5B9WF77      ---------------------GLARNWWRI-LLVWLVVS-APLVY-VIYTLVEPT-YQAS
A0A518BBX8      ---------------------QIVWERRWT-FLVGPVVF-LALAT-LYYVQATPR-FESE
A0A518ALT3      ---------------------VFRNWWKFL-VPCSLLLA-VAAAA-LVLWLHVPQ-YEAR
A0A517MDV3      ---------------------GILRRRWLI-LFLGLAFG-ISLAV-FYAFVAPKV-YASR
A0A3M1QRP3      ---------------------RILRFKWTI-LVVFAAVC-ASALA-GVWIFVEPQ-YRSI
A0A517TMV0      ---------------------RIVRYRHQA-VLWIVAGC-LALGL-TYYAMAPRY-YRSE
A0A2E3RCU8      ---------------------KIVWYRRNS-MLVVGIVC-AIVAA-WYAATATRY-YQSS
A0A3E0MY88      ---------------------RVVRSRINI-LIIAIVVS-SLLGG-LYYATATRY-FQAN
A0A1C3E6N1      ---------------------RSVQYRKGL-IILAVLAA-SALGA-AYYIVSTRY-YESK
A0A518GJT2      ---------------------RSVQYRKGL-IILAVLAA-IALGA-AYYIVSTRY-YESK
A0A286RD13      ---------------------AVRRRWWLI-LIMGVLAS-AGVMV-FAWRTIPVE-YTAT
A0A517MLW3      ---------------------NGMMRRQRM-VASVFLLV-GLFAG-IYYVTADRV-YQAS
A0A5B9QVD0      -----------------------MYRRQRL-VVGVFAVV-GMLAG-LFYVTADRV-YQAD
A0A3B8PNV4      ---------------------QVVRIRRGI-LFCTLFIS-IVLGG-LYFATATRL-YESK
A0A3D1DR40      ---------------------QVVRIRRGI-LFCTLFIS-IVLGG-LYFATATRL-YESK
A0A2E7RYU8      ---------------------QVVRIRRGI-LFCTLFIS-TVLGG-LYFATATRL-YESK
A0A3B8LXG8      ---------------------QVVRIRRGI-LFCTLFIS-TVLGG-LYFATATRL-YESK
A0A350CI62      ---------------------RTVRFRKGI-LVASLVMS-TILGM-TYYITAERI-YEST
A0A4P5WQK6      ---------------------RTVRFRKGI-LVASLVMS-TILGM-TYYITAERI-YEST
A0A3C1X4W5      ---------------------RTVRLRKGI-LVAALVMS-TILGM-TYYITAERI-YEST
A0A3D3W3A7      ---------------------RTVRLRKGI-LVAALVMS-TILGM-TYYITAERI-YEST
A0A518DRX3      ---------------------QVLRRRKGY-VLAMLAGA-AVLGA-AYYVAAPRM-YEAK
A0A518DZF9      ---------------------QVLRRRKGY-VLAMLAGA-AVLGA-AYYVAAPRM-YEAK
F0SI78          ---------------------SIVWERKWL-LIFFAALG-AAIGY-LEFTKQPPV-YRSS
A0A518IQ30      ---------------------RMLRRKKQY-VAFSLLVT-SALGA-FYYLTADKV-YEAR
A0A517LWP4      ---------------------RMLRRKKQY-IAFSLLVT-CALGA-FYYLTADKV-YEAK
A0A518JNW8      ---------------------RMLRRKKQY-IAFSLLVT-CALGA-FYYLTADKV-YEAK
A0A2E7ENQ5      ---------------------RIIRHRRIQ-VVSCLVAT-ALLGA-LYYCTAAPL-YSAR
A0A1G3AQE9      ---------------------VTVRHRKNV-VILALAVA-AFLGA-LSYMTATRY-YSAS
A0A3L7UQT9      ---------------------HAVRVRRGT-LLAALLIS-ASLGA-AYYLTATRM-YDAH
A0A4P5YBU2      ---------------------HAVRVRRGT-LLAALLIS-ASLGA-AYYLTATRM-YDAH
A0A518AKT8      ---------------------TLS--YRRY-YVIASLVV-CCVLG-FAYYLAAPR-YYQS
A0A5C5ZR72      ---------------------VFTMSWRTV-VPIGLLLA-IPVAA-VIYLTYTPM-YEAT
A0A517TY85      ---------------------VLRGRWPVV-IPLGLVLA-AAAAA-IVLLLYVPK-YRAS
A0A5B9QEI7      ---------------------VFTGWWKWV-VPLGLILA-AGAGA-IVLMFYVPK-YEAS
A0A5S9IJB5      ---------------------EIITSRWYI-IFLSITLF-VGMAF-YYAKTTKRI-YQST
A0A1G2XVR0      ---------------------TTVLRRKWI-IIAFLVIS-GTYST-YKELTKIPY-YTAS
A0A1G3B0P0      ---------------------TTVLRRKWI-IIAFLVIS-GTYST-YKELTKIPY-YTAS
A0A1E3X4X0      ---------------------KIIQKRQWV-VILVFVVL-VATVT-ISTIRMTPV-YQAK
A0A286U4B3      ---------------------RVVMHRKWV-IVAIFTIT-VLLVT-LYTFKQKPI-FQAV
A0A5C6DDS2      ---------------------RVVMHRKWV-IMAIFSIT-VLLVT-LYTFKQKPV-FQAV
A0A0S8J591      ---------------------WVLKRRVLLILFFWGLV--FASVV-VATFMQQPL-YRAY
A0A2E3GW02      ---------------------SIVWERKWL-LIFFAALG-AAIGY-LEFTKQPPV-YRSS
A0A1U9NL64      ---------------------EVAWANRWL-ILATTILS-LTAAF-IYLAKATPI-FTSS
A0A5B9QNZ7      ---------------------GVLRRRWII-VFLGLALG-ISLAV-FYAVVAPKI-YSSQ
A0A1U7CZ81      ---------------------RGLARNWWRILLLWAVVS-APLDY-LIYSQIQPT-YEAV
A0A142YNY8      ---------------------RGLLRNWWKILGLWLIAS-LPLVY-GIYTQVKPT-YIAY
A0A1U7GLS6      ---------------------RGLLRNWWKILGLWLILS-APLAY-LVYSQVKPK-YMAY
A0A1Z8N7H5      ---------------------KVVWYRKNS-MIMVGFIL-AIIAG-WYAATATRY-YQSS
A0A1G2YPI3      ---------------------LILWRSRWI-VLLTTVAV-LAAAL-IYVTKVTPV-YTST
A0A532UIN2      ---------------------QIMWRGRWL-ILLATILA-VAAAV-VYLVKATPI-YSST
A0A532UD06      ---------------------LIVLQHRWT-ILLTTVGF-LVVGF-AYIMKATPI-YTSA
A0A660URN1      ------------------------LRHRWV-ILAAVLVS-LIAAF-GYILKATPI-YTSA
A0A0S8KNX5      ---------------------AGIFRRWYIVLLILFVMC-AAGLP-AIWFLIDPV-YEVT
A0A3D3UVZ8      ---------------------AGILRRWYIVLLILILIC-GSGLP-AVWFMVKPI-YDVT
E8R3W3          ---------------------RALRRRWLMAAIVAPLTAVLAMVV-AYPLVIKER-YSSE
A0A517NFU9      ---------------------GMLRRRWPH-IAFGIFVG-LSLAG-FYYFSTDRM-YESK
A0A5C5YWH4      ---------------------GMLRRRWPL-IVFGILVG-VSLAA-FYYAATTRM-YESK
A0A3D2TNK4      ---------------------RMLMIRKKT-IIISLYLF-AVCGV-IYYYFAVRL-YESS
A0A0J1B4A0      ---------------------GIVRRRYHL-IALGIFVG-VTLAT-IYFVNQVPI-YESK
A0A142WSB9      ---------------------RFVLSIWKW-LALGLFAG-LTLGV-VSYLIMGPV-YRAS
M5SZR3          ---------------------KVALRHKSL-IALGIAIG-LVIGA-LYYAQSTPV-FRSS
M5TW92          ---------------------KVALRHKAL-IALGIAIG-LVIGA-LYYAQSTPV-FRSS
A0A2S8FKY2      ---------------------HSLRRQWLASIVLGLLVA-VPVAI-AAWVLQSPT-YTSS
A0A517N8P6      ---------------------GVLWRRKGV-ILLLILCG-LGAGY-WFFTTQDET-FRAA
A0A432MJP4      ---------------------RVVRREWRW-SAVGLAVC-LTAAA-IYLVRTPRM-YQAT
M5UQ35          ---------------------GILRRRYHL-IALGVFVG-ALLAC-LFYVKQVPV-YQSN
A0A5C5WTY6      ---------------------SIVRRRWKW-IAGFACLG-ILATA-IYLSQTPPT-FRSQ
A0A5C5Y033      ---------------------QLIARQRWL-ILFLGSCG-LAMGV-AYATHAEVL-YESQ
A0A5C6G1Y2      ---------------------QLIARQRWL-ILFLGSCG-LAMGV-AYATHAEVL-YESQ
A0A354PDV6      ---------------------QVLSRQRWL-IVFCSLMG-MAAGV-LYSIQSTVW-YRST
A0A5C6FZ02      ---------------------QILFRQRWL-IAFLTLAG-LAAGV-AYALQARVW-YEST
M5TIT3          ---------------------EILSRQRWA-IVFLTLCG-FTAGV-AYAMYSQEW-FESH
A0A5M6CY44      ---------------------DIFRRQRWM-IIFLAVLG-LAAGI-LYALNATVW-FESR
F2AXG2          ---------------------QILSRQRWL-IAFLSIAG-LAAGV-AYALNAQVW-YESN
M2BB46          ---------------------QILSRQRWL-IAFLSIAG-LAAGV-AYALNAQVW-YESN
L7CLQ6          ---------------------QILSRQRWL-IAFLSIAG-LAAGV-AYALNAQVW-YESN
A0A0J1B719      ---------------------QILSRQRWL-IAFLSIAG-LAAGV-AYALNAQVW-YESN
Q7UF18          ---------------------QILSRQRWL-IAFLSIAG-LAAGV-AYALNAQVW-YESN
A0A2G1W1E0      ---------------------QILSRQRWL-IAFLSIAG-LAAGV-AYALNAQVW-YESN
K5E235          ---------------------QILSRQRWL-IAFLSIAG-LAAGV-AYALNAQVW-YESN
A0A5C6FFI9      ----------------------MLRRRWFH-LVLGTCLG-IAFAL-LYFYATKPT-YESH
A0A3A0DET7      ---------------------ALAWRNRWL-LLLTTLVG-GGAAW-ATVQRVTPR-YTSV
A0A5C5WDJ1      ---------------------GMIRRRWRL-LVFGVFVG-IALSA-LYYTTATQQ-YQSS
A0A5C5X547      ---------------------HAFRRRWAL-GLLIGILL-TPLAI-VPWLLMEPQ-STAV
A0A2A2W9R6      ---------------------GIVRRRFHL-IMLGVLVS-VTGAT-VYFVQQKPV-YESK
A0A518HKC1      ---------------------GIVRRRFHL-IMLGVLVG-ATCAT-IYFVKQKPV-YESS
A0A518L3P0      ---------------------GIVRRRFHL-IMLGVLVG-ATCAT-IYFVKQKPV-YESQ
A0A255R1S0      ---------------------GILRRRYHL-IALGLLVG-ATLAT-IFYVKQKPV-YQSS
A0A5B9MKP1      ---------------------GIVRRRFHL-IMLGLLVG-STCAT-IFFVKQKPV-YQSS
A0A0S8FY64      ---------------------GVIRSRFWT-IVACAVVL-FTVAV-LYTFQATPI-YEAS
A0A1N6KFT7      ---------------------DVLKRGWKF-VSLGLLVG-LTLAS-IYLAKTKRI-YQAS
L0DFG4          ---------------------EVMKRGWKL-VIFGLLVC-LTLAS-IYLAKTKRA-YQAS
A0A5C5XXG1      ---------------------P------PA-IDTPSSEG-VVESA-PWIA-------RRR
A0A518BJJ1      ---------------------DLIRKRWLA-IGACAAAT-VAAGI-GWLSLQPPV-YRAT
A0A518D182      ---------------------DLALRRRLA-LALFAVAG-LGLAL-GWIGAQAPV-YRAT
A0A353FIP5      ---------------------GILWRRKVQ-IALITVIA-ACVAF-LVAVTRTPS-FEAE
A0A5B1CIK7      ---------------------AILGRQRWL-IAALSLAG-LAAGI-AYALTAEVW-YSSQ
A0A5C5WHS2      ---------------------AILSRQRWL-IGLLTLAG-LAVGL-IYALNAEVW-YRSQ
A0A5C6B6G8      ---------------------ETITRQRWL-LAFFAMLG-LVVGV-AYSLNAQIW-YKSN
A0A5C5ZZN3      ---------------------EILSRQRWL-IIFLCLCG-LTAGI-AYALYAPVW-YETN
A0A5C5XS91      ---------------------QILQRQRWI-ILFLCICG-LTAGV-AYSLYAPVW-YQSS
A0A5C6C4E6      ---------------------QLLHRQRWI-IIFLCICG-LTAGV-AYAKYATVW-YQSS
A0A2E1VVJ1      ---------------------SAILRHKAL-IVLCTLLS-SAAVM-FYSATKEPV-FNAE
A0A3M2AEL0      ---------------------GIFWHQRLL-VTSLLILG-AVLGF-FLSMLVPPR-FAAE
A0A532UT69      ---------------------IRIIWRSRGIVLLTTFVSLAAAAV-YVTTITP-V-YKST
A0A2D5AWU0      ---------------------ALWRGKWYFLLFPAI---AGGGMY-YFLHGQKNL-YRST
M5RT57          ---------------------HSLTTYWYLTIPLAIVLAGLSATA-VLMTFTP-V-YRAT
A0A356KTN1      ---------------------LGFKRRLPLVIGVTLFFGVAAGVR-S--SNLPTV-YAST
A0A518HFS8      ---------------------RALRLRWKLAVSGAILLGAAAGAV-AFVAMPPAE-YSSR
                                                                            

A0A5S9IPR9      ASVAVIK-----PTK---NT---------------QGLPVNQTYYSKRLSTQ--------
A0A533Q9U4      ARVVLEQ--------------------NKLNVGFQQVISESQFTPLDFYTNQ--------
A0A1U9NNE1      GAIRVSP-----ILP---NV-------LFDD----AETQDVMPNYQGFMNTQ--------
A0A2G2JCA2      AWLQIEE-----VSP--------------------YLAFQDRSDSRKFVANQ--------
A0A533Q6B7      ASIMLEQKEFNVGIQ---QI-------LSEDKNI-----------YNFYTDQ--------
A0A351FYP6      SRIAVEK-----DTS---DIAPLLGMQATQSSFD-----------PYFISTE--------
A0A2E7ESJ6      AQILIED-----KQP---PT-------IPLTGVESQYIT------TSAEAKH--------
A0A1G2YQB7      AAIRVAP-----VIS---SI-------LFGGEEA-IPMY------RSYMYTQ--------
A0A353P687      AAIRVAP-----VIS---SI-------LFGGEEG-IPMY------RNYMYTQ--------
A0A356EME5      ALIQIRE-----NPP---AL-------VFAIEDK----S------SGYVETQ--------
A0A355AI52      AQLLIVD-----TSR---EN-------NPTSMTG-SHND------VAAMATY--------
A0A3L7SI46      SEIMVLK-----TDG---NV-------LDTTNQSNQRSI------QDIMPTY--------
A0A3L7P4E4      SQILITK-----QQA---EMPVNTVNGLAPNGRS-DPLA------SDIQTIM--------
A0A3L7PEB5      SQVLVIK-----QQA---DMPVNSVNGFDPSGQS-DPLA------SDVRLIL--------
A0A2N1UCJ3      ARLYVEQ-----TGP---KL-------IADYEGT-MTQS------KNYLYTQ--------
A0A517ZCB5      AELLVLQ-----TGS---SV-------LDSERNP-QGTL------SDQMPNF--------
A0A432MFP3      SLLQIER-----NQA---NP-------YGSLEDP-RSI--------EYLQTQ--------
D5SZ21          AELLILQ-----TGS---KV-------LDGAPEG-AAMK-------DLMPTY--------
A0A518CHE5      AQLLILS-----NGG---FQ-------TDDVSGQ-SLLK-------NQMPTY--------
A0A257WS34      ADVLVLQ-----TNG---NA-------LDGKDNN-QQSI------QNLMPTY--------
A0A2E8FLY0      ARLYVLQ-----MGS---NV-------LKTEQEN-QGGV------QENMATN--------
A0A3D2U1E1      SRLYVLQ-----MGS---NV-------LQESMES-QGGV------RENMANY--------
A0A1P8WP26      ASLFVVQ-----IGS---GV-------TQDSVQG-ASDP------SRSMPTF--------
A0A3L7V1F3      ASLYIVR-----KGG---NV-------TEETPNS-GSSA------NSDMPTF--------
A0A5B9QF68      AELLIIQ-----QKQ---DQ-------LATVGDH-ESSE-------DTMATH--------
A0A5B9QGF0      AELLIIQ-----QKQ---DH-------LATVGDH-ESSE-------DTMATN--------
A0A5C6CK24      AELLIIQ-----QKQ---DH-------LATVGDH-ESSE-------DTMATN--------
A0A2E8B0L9      ASLLITQ-----TGT---DI-------LNSTMMP-NAQQ------DALIPTY--------
A0A5Q4GFE7      SQLLILS-----TGP---DI-------LSPTLTA-ESSR------QALIPTY--------
A0A2E3GWX1      AELLILH-----TGE---GN-------MDETQQS-QRTL------QDHLPTY--------
F0SG60          AELLILH-----TGE---GN-------MDETQQS-QRTL------QDHLPTY--------
A0A2E9VST2      AELLVLH-----TGE---GN-------VDQTQQS-QRTL------QDYLPTY--------
A0A356A6X2      AELLVLH-----TGD---GN-------VDQTQQS-QRTL------QDYLPTY--------
A0A5C5XLM3      AELLVLH-----TGD---GN-------VDQTQQS-QRTL------QDYLPTY--------
A0A3M1VCL4      ARLLVLQ-----TNA---SV-------LQEQQST-PRAV------LDQLPTL--------
A0A5C5V7Z9      AKLLLIE-----QDS---DK-------VSGVADA-GRAD-------DVMATH--------
A0A5C5YT05      AKLLLIE-----QDP---DS-------VSSVAEG-GRAD-------DLMATH--------
A0A518D7F9      AKLLVIE-----QNP---DQ-------LSSMGDQ-AGSD-------NVTANH--------
A0A5C5ZIP0      AKLMVIQ-----QVA---DE-------LSSMSDQ-IGSD-------NLMTTH--------
A0A518KBK3      AKLLVVD-----QSA---GE-------LTTMNDQ-AGAD-------NLMATH--------
A0A5C6AKF9      AKLLVVD-----QSG---GE-------MVSLNEQ-AGAD-------NLMATH--------
A0A2E0X4J3      SKLYVER-----NMP---QI-------IDSGMGL-SQSK-------GFLYTQ--------
A0A5C5YU10      SRVYVER-----SLP---KL-------LSSDMQL-GHSN-------SYLFTQ--------
A0A517MPZ6      SRIYVER-----SLP---QI-------FASDAQR-GTSS-------SYLYTQ--------
A0A5C6CNV7      SRLYIER-----NMP---RI-------LEQEVQL-GNSA-------SYLYTQ--------
A0A518K5H4      SRIFVEQ-----KLP---SV-------LAGESLG-AFST-------KHLYTQ--------
A0A5C6AA28      ARVFVEQ-----NLP---RA-------LNGDALG-TFSN-------KYLFTQ--------
A0A2E9VK20      SQILVKL-----KSP---IE-------IREEGNR-IIAG--------ERSAH--------
A0A3D4PJK1      SQILVKL-----KSP---IE-------IREEGNR-IIAG--------ERSAH--------
A0A0S8GZ23      GTIHIRP------------L-------VADLLTG-AHESGGISNYDIYVNTQ--------
L0DC26          AMLHVNS-----VKP---RI-------LLQTGEV-QSDY------GSYQRTQ--------
A0A354PCQ3      SLLEANQDYVVFQGV---MP-------VV----------------KNLAQTE--------
A0A1I3DDV4      AKMLVTL-----KDM---RA-------SDKGESS-WAAD---GVQDEILANH--------
A0A2E2N5A9      ATLLVES-----ERA---KL-------LAIEQAN-QNET----LNNDFLQTE--------
A0A2E3GWC6      SQILVKL-----KTS---VP-------LGDDDNR-PTAG--------ERSAH--------
F0SLB0          SQILVKL-----KTS---VP-------LGDDDNR-PTAG--------ERSAH--------
A0A2E0SMM6      AQLLVLS----------------------NGGFD-TDDVSGQALLKNQMPTY--------
A0A1N6DAJ8      SMLHVNS-----TQP---RI-------LLKVGEN-ESDY------VAYQRTQ--------
A0A5B9PJZ8      AKVFVDE-----KSA---PS-------ISEEDGY-AQDT---------VEKY--------
A0A2S8G191      AMLRISS-----SQG---SL-------LKQDGEK-TGDF------DVYKLTH--------
A0A2E7EGG1      AWLQING-----VQP---YV-------AFPDREV-RDRD----SNRKFVHTQ--------
A0A225EH48      MALIQLK-------P---IV-------SAGKQSM-GEDF------ESFKQTQ--------
A0A3L7NDH9      ASILIVG-----SQG---DS-------LDTSLTG-GRND------PTAMATY--------
A0A518INW8      MEILVSQ-----RAT---EL-------MTSSGPD-GRSFDANVVQADLLATH--------
A0A518JPH9      MDILVSQ-----RAS---EL-------MTSNSPN-GRSFDASVVRADLLATH--------
A0A2E2CCW9      TKIQVSQ-----KNP---VP-------IKEGEIQ-TFGE---------LTAH--------
A0A3C0AGX3      TKIQVSQ-----KNP---VP-------IKEGEIQ-TFGE---------LTAH--------
A0A518AAQ5      TKIQVSQ-----KNP---VP-------IKEGEVQ-TFGE---------LTAH--------
A0A517QBG9      TKIQVSQ-----KNP---VP-------IKEGEVQ-TFGE---------LTAH--------
A0A518FTU3      TKIQVSQ-----KNP---VP-------IKEGEVQ-TFGE---------LTAH--------
A0A2E7K7A9      TKIQVSQ-----KNP---VP-------IKEGEVQ-TFGE---------LTAH--------
A0A517PTS5      TKIQVSQ-----KNP---VP-------IKEGEVQ-TFGE---------LTAH--------
A0A517WHH5      TKIQVSQ-----KNP---VP-------IKEGEVQ-TFGE---------LTAH--------
A0A5A8BGT3      TKIQVSQ-----KNP---VP-------IKEGEVQ-TFGE---------LTAH--------
A0A517VTK3      TKVQVSQ-----KNP---VP-------IKEGEIQ-TFGE---------LTAH--------
A0A517WQT4      TKVQVSQ-----KNP---VP-------IKEGEIQ-TFGE---------LTAH--------
A0A517VID8      TKIQVSQ-----KNP---VP-------IKEGEIQ-TFGE---------LTAH--------
A0A517RK10      TKVQVSQ-----KNP---VP-------IKEGEVQ-TFGE---------LTAH--------
A0A518IH18      TKIQVSQ-----KNA---VP-------IKEGEAQ-TFGE---------LTAH--------
A0A5C5VEK8      SRIYVER-----SLP---NL-------LGAEYQV-GRS-------NSYLFTQ--------
A0A532UTJ0      GAIKVAP------------I-------IADIMTD-EGDHGGISNYESFMNTQ--------
A0A517NSK8      MEILVGQKSADMVNG---AS-------SNTSVEG-ANTD------GDVLSTH--------
A0A5C5Z0D6      MEILVGQKSGDLVKG---AT-------SDSSVEG-AEAA------EDVLSTH--------
M5UE94          MEILVGQKSGDLVRG---AN-------SSSSVEG-VDTK------EDVLSTH--------
A0A1P8WN28      ARLMVRQ-----VSA---DP-------KSQSNSA-T---------EGLLASY--------
A0A3B9CTT0      TKMLVRQ-----TGS---D--------MANFGAP-L---------EAAMAGY--------
A0A5C5XLF4      SQILVKL-----KNP---VE-------IREGGNR-VIVG--------ERSAH--------
A0A2D5NDU9      SRLFINAGVNAKAGP---EV-------MALGFGA-----------TNYAQTQ--------
A0A286RGB6      ALIRVSS-----SVQ---SV-------LFPTQQG-AGPS-----FDIYKATQ--------
A0A1V5N3W2      AAIRVAP-----IIP---SI-------LFSDKDS-EGVI---PMYESFMNTQ--------
A0A3E0MY27      AFLQFND-----EEV---II-------DAQSRSD-GRRI------DDPLQTH--------
A0A2E0X9P6      ALIQIES-----KVP---FV-------AFEQPST-VRDE------ARYFNTQ--------
A0A286RLF2      AELLILQ-----TGD---NA-------LSPTIEA-QGSR-----ENSLIPTF--------
A0A5C5ZM48      AWLKIKA-----ESP---YV-------VFKDEET-ALDA------KRFVETQ--------
A0A5B9WF77      SLVLVES---NQNDP---FS-------AFSNPAL-SGQA------PTYLKTQ--------
A0A518BBX8      AKVLVIN-----KKP---TL-------MTDRAGL-PVSH-----FEDYVETH--------
A0A518ALT3      ALIKIES-----NIP---YI-------AFDSNNS-NSRD-----SDRYVQTQ--------
A0A517MDV3      VEVLVMR-----KDP---GL-------PQMSDSQ-TGAAPQQEVGDALLATH--------
A0A3M1QRP3      AQIEVRP---QRDMI---AF-------KTDNDGI-THFY------QQFLTTQ--------
A0A517TMV0      ARLQVID------QS---GE-------DLASISE-QSGT------DSLMATQ--------
A0A2E3RCU8      TSVLIVQ-----NGS---AD-------HGNVLGV-NRND------QQLMPTH--------
A0A3E0MY88      ASVLIIR-----NGG---SE-------GSSSMGI-DGEN------RRYMPTH--------
A0A1C3E6N1      AELLILQ-----TGS---KV-------LDG-APE-GAAM------KDLMPTY--------
A0A518GJT2      AELLILQ-----TGS---KV-------LDGAAPE-GAAM------KDLMPTY--------
A0A286RD13      AWLQVSL-----ERP---RV-------LFDTKDD-DPLL------RNR-QTQ--------
A0A517MLW3      AQLLVEE-------P---SI-------GVFPGAS-PTAQ------SNKLPTQ--------
A0A5B9QVD0      AQLLVEE-------P---GL-------GMLPGSG-VMAQ------PNKLPTQ--------
A0A3B8PNV4      ARLYVLQ-----MGS---NV-------LQNDQEN-QGGV------QENMATN--------
A0A3D1DR40      ARLYVLQ-----MGS---NV-------LQNDQEN-QGGV------QENMATN--------
A0A2E7RYU8      ARLYVLQ-----MGS---NV-------LQNDQEN-QGGV------QENMATN--------
A0A3B8LXG8      ARLYVLQ-----MGS---NV-------LQNDQEN-QGGV------QENMATN--------
A0A350CI62      ASLYVVR-----KGS---GV-------TSDATSN-SANP------VTEMPTY--------
A0A4P5WQK6      ASLYVVR-----KGS---GV-------TSDATSN-SANP------VTEMPTY--------
A0A3C1X4W5      ASLYVVR-----KGS---GV-------TADATST-SANP------VTEMPTY--------
A0A3D3W3A7      ASLYVVR-----KGS---GV-------TADATST-SANP------VTEMPTY--------
A0A518DRX3      ASLLITQ-----TGP---DV-------MSGSTPA-ASGG------DSLIPTY--------
A0A518DZF9      ASLLITQ-----TGP---DV-------MSSGTAS-AASG------DSLIPTY--------
F0SI78          ASILVDR-----YQP---RM-------PIEGIDP-LSGQ------TDPLSTH--------
A0A518IQ30      AQLLVTQ-----TSP---DM-------LNAGVSS-SVTN------DTLVATH--------
A0A517LWP4      AQLLVTQ-----TSP---DM-------LNAGVSS-NLNN------DALVATH--------
A0A518JNW8      AQLLVTQ-----TSP---DM-------LNAGVSS-NLNN------DALVATH--------
A0A2E7ENQ5      VSLMMMY-------H---GG-------EDSLTGS-DTYR------RGMLPTY--------
A0A1G3AQE9      AGVWVLE-------L---GS-------SSAGSVE-DNLH------QTQLPTQ--------
A0A3L7UQT9      AQVRIVQSERNHDSL---TS-------SPQSSQA-NSDV------FQMMATY--------
A0A4P5YBU2      AQVRIVQSERDHNSL---TS-------SPQSSQA-NSDV------FQMMATY--------
A0A518AKT8      TAKLLIN-----ERK---AD-------ELTSVGD-QIAN------DDLMANQ--------
A0A5C5ZR72      GLIRIED-----SPQ---YV-------AFRSGSV-DAGG------RKFIQTQ--------
A0A517TY85      ALIKIEA-----QPT---FI-------AFAQDKV-SATD------DRYVQTQ--------
A0A5B9QEI7      ALVKIEA-----ETP---FI-------AFQQGAL-NKDS------ERYVQTQ--------
A0A5S9IJB5      GTIAILP-----KNL---NL-------ARDR-----IDLSMFRNMQNYLQTQ--------
A0A1G2XVR0      TQVIITQ-----NTP--KGL-------TFQA-------FSFEGNNSSSFTTN--------
A0A1G3B0P0      TQVIITQ-----NTP--KGL-------TFQA-------FSFEGNNSSSFTTN--------
A0A1E3X4X0      ARVLIEK-----EER--VNV-------TGKDIQE-VVTYDPYATRGEFYKNQ--------
A0A286U4B3      TTIRIFK-----EAP--KVL-------SFEEV------MSTEGGRTDFYKTE--------
A0A5C6DDS2      TTIRIYK-----DAP--KVL-------SFEDV------VNTGGGLADFYKTE--------
A0A0S8J591      ARIEIER-----SVDTPDVI----------------EAGARRMATEEFYNSQ--------
A0A2E3GW02      ASILVDR-----YQP---RM-------PIEGIDP-LSGQTD------PLSTH--------
A0A1U9NL64      SRVYVEQ-----SGP---KI-------LDE------TQGVM-TQSKNYLYTQ--------
A0A5B9QNZ7      VEVLVMR-----KDP---GL-------PMMAQNQ-QGAPQQ-EIGDSLLATH--------
A0A1U7CZ81      STIRAEP-----TQL---SL-------YGQQ-----NSNAQAQPIERFIGTQ--------
A0A142YNY8      SVIRIEP-----TQP---EL-------FGSS-----SRGDGSSSIERIIETA--------
A0A1U7GLS6      SRIMVQL-----TQP---DL-------FGGI-----APGQANERTV-AIETE--------
A0A1Z8N7H5      ASILIVR-----NGM---SQ-------EDS------ALGIN-RNSQHLMPTH--------
A0A1G2YPI3      SRIYVEQ-----SGP---KI-------FAE------TQEGVMTQSKNYLYTQ--------
A0A532UIN2      SRIYVEQ-----SGP---KI-------FSE------TETSVMTQSKNYLYTQ--------
A0A532UD06      SRLYVEQ-----SGP---KI-------INE------YEGVM-TQSHNYLYTQ--------
A0A660URN1      SKLYVEQ-----SGP---KI-------ITE------YKGVM-TQSKNYLYTQ--------
A0A0S8KNX5      GAVTIAP-----IMA---DI-------LTDV-----PDSGEISNYSSFMNTQ--------
A0A3D3UVZ8      GAVRVAP-----ILA---DI-------LSGE-----QDRGEISNYESFMNTQ--------
E8R3W3          ATLQLA------------------------------LFGRSIVFNNGVSMGDAHAYMRTQ
A0A517NFU9      IEILVGQ-----RSS---EV-------TNNGTIT-GANASGDNIQEDQLATH--------
A0A5C5YWH4      IEILVGQ-----RSS---EV-------TSSGTLS-GAAASGDSIQDDQLATH--------
A0A3D2TNK4      AKILIDE-----KNQ---DR-------VA-------TVGDQ-SIVSNILDTH--------
A0A0J1B4A0      LAVLVGQ-----RSG---EV-------ANTGVNN-GAKDMA-SMQEDVLSTH--------
A0A142WSB9      TRVQVSK-----KA----------------------------SLPINSQEARRYSDRSQH
M5SZR3          AQVLIVR-----KTP---NT-------E--------IKGQN-AFYNDYMSTH--------
M5TW92          AQVLIVR-----KTP---NT-------E--------IKGQN-AFYNDYMSTH--------
A0A2S8FKY2      AYLRISS-----NDQ---PL-------AFK------------TIEQTNRNDY-RTFKNTQ
A0A517N8P6      ATIEVYS-----QNV---------------------PTNTG-SASEIVVETA------PN
A0A432MJP4      ARVLVLE-----TGR---QP-------LKVTEAD-AGGGEG---GVDRFPTY--------
M5UQ35          LAVLVGH-----RSA---DL-------NRASSSS-LLEGAT-TIEDVILSTH--------
A0A5C5WTY6      AKILVNP-----NRV---EV-------GDS------DTSND-VVDEDVLANH--------
A0A5C5Y033      AKVLVAQ-----RSA---GL-------NNS------GTGTD-VVDEDVLANH--------
A0A5C6G1Y2      AKVLVAQ-----RSA---GL-------NNS------GTGTD-VVDEDVLANH--------
A0A354PDV6      AAILVNS-----KNA---GL---------E------SNATN-VVEEDILANH--------
A0A5C6FZ02      ARVLINE-----KSS---GL--------AS------SSSNE-MVEEDILANH--------
M5TIT3          AKILINQ-----KSA---GL-------EGD------STGQA-IVDEDILANH--------
A0A5M6CY44      AKLLISE-----RTA---GL-------GGT------GTGTG-MVEEDTLANH--------
F2AXG2          AKVLINQ-----ASA---GL-------GGD------STGTD-MVDEDILANH--------
M2BB46          AKVLINQ-----ASA---GL-------GGD------STGAD-MVDEDILANH--------
L7CLQ6          AKVLINQ-----KSA---GL-------GGD------TTGTD-MVDEDILANH--------
A0A0J1B719      AKVLINQ-----KSA---GL-------GGN------STGTD-MVDEDILANH--------
Q7UF18          AKVLINQ-----KSA---GL-------GGN------STGTD-MVDEDILANH--------
A0A2G1W1E0      AKVLINQ-----KSA---GL-------GGN------STGTD-MVDEDILANH--------
K5E235          AKVLINQ-----KSA---GL-------GGN------STGTD-MVDEDILANH--------
A0A5C6FFI9      IEILVGQ-----RSS---EL-------TTSGTMS-NSQASGDTIQEDLLATH--------
A0A3A0DET7      SRLYVER-----ALP---R-----------------------VLESEAPVVQSATYLYTQ
A0A5C5WDJ1      IEVLVGQ-----RSS---EM-------TSRGTIN-GNSGSGESIRDDQLATH--------
A0A5C5X547      VQLHLHQ-----DDP---ML-------IFNTADQ-VQTSAI-TYKLFQSTQA--------
A0A2A2W9R6      LAVLVGQ-----LSS---EM-------ASTGVRG-TSDGAV-TMQDEILSTH--------
A0A518HKC1      LAVLVGQ-----LSS---EM-------ASTGVRG-TSDGAV-TMQDEVLSTH--------
A0A518L3P0      LAVLVGQ-----LSS---EM-------ASTGVRS-TSDGAV-TMQDEILSTH--------
A0A255R1S0      LAVLVGQ-----RSS---QL-------ATTGVRE-ASDNAV-TIQDKILSTH--------
A0A5B9MKP1      LAVLVGQ-----LST---KV-------AATGVRD-ASDGAV-TMQEEILSTH--------
A0A0S8FY64      ARLLIE-----------------------RR-----APQVS-PFEDMQERRD-KEYFATQ
A0A1N6KFT7      TSLLVI-----------------------QH-----GGRPL-NVSAYTDPNR-ISEGSED
L0DFG4          TSLLVI-----------------------QH-----GGRPL-NVTAYTDPNR-INEGSED
A0A5C5XXG1      AAWVIL-----------------------SG-----PAGHS-SHHEGCQGCK-RSTCQSK
A0A518BJJ1      ATILLD-----------------------QS-----QPTGG-VLGELAALSS-APAAASE
A0A518D182      ATVLID-----------------------EQ-----DGASA-TLSELSLFGS-APRASAE
A0A353FIP5      GRVLLE-----------------------EG-----SAVGG-ILGDLSMLSS-APPATAE
A0A5B1CIK7      AKVLINE-----RSA---GL-------G-SE-----GNATN-VVDEDILANH--------
A0A5C5WHS2      AKVLINE-----KSA---GL-------G-AG-----SAATD-IIDEDILANH--------
A0A5C6B6G8      AKVLIAE-----KTA---GL-------GEGS-----ATGQG-MVEEDTLANH--------
A0A5C5ZZN3      ATVLINQ-----KSA---GL-------G-GD-----STGQS-IVDEDILANH--------
A0A5C5XS91      ATVLINQ-----KSA---GL-------D-SD-----GTGQE-MVEEDILANH--------
A0A5C6C4E6      ATVLINQ-----KSA---GL-------D-KD-----GTGQE-MVEEDILANH--------
A0A2E1VVJ1      GRVALD-----------------------SG-----GFQSG-FLSEVAVLSPVQPPESKE
A0A3M2AEL0      ATVLLR-----------------------PE-----GSEQS-LLREFTLFEQ-SPATLAE
A0A532UT69      SKIFVEQ-----SGP---KI-------ITE------TEQGVLTQSKNYLYNQ--------
A0A2D5AWU0      AQVQVAP-----REV---DP-------LNG------NAGSTGK-ARTLLKQQ--------
M5RT57          AVMKIAS-----YAP---FI-------AYT------TPEPQMN-PEDFTETQ--------
A0A356KTN1      ARLQLAK-----EAPDPTRA-------RYE------MYSSDYV-ATEYLNTQ--------
A0A518HFS8      SLVHVAE-----KRP---RD-------LFE------TRESGVS-YAIYQHTQ--------
                                                                            

A0A5S9IPR9      VAILQSRAMAKKVIERLPEAICLSFFGRERTDVTA-------------------------
A0A533Q9U4      CEIIKSRSIAKKVIDTLNLKNDPVFNPPEKDEYPESAGNRTQDPSAETQFINRFLS----
A0A1U9NNE1      AELMSSNEILNRVAEDMAKRGIRICEPDMDPVAIL-------------------------
A0A2G2JCA2      VALMRSHIVLGSVVSNKDVSSTPELKNSVDIIAALGR-----------------------
A0A533Q6B7      CEIIKSRLIAKKVIDILDLKNHPGFNPYKGIENPALAADNPSDPFTETYLINAFLS----
A0A351FYP6      FEKIQSQKVLDEVVK-------------SCELREKWKKHYGGKQLTDVEAR---------
A0A2E7ESJ6      AIVIVSPRILTQAFD-------------------N-FN------LFRLPTFKDDP-----
A0A1G2YQB7      ADLIISDRVLQRVVD----------DL---SDKN--I-------IASDIEKPDPLKSVRN
A0A353P687      ADLITSDRVLQRVVD----------DL---SDKN--IK------LMEEAKSRDPVTAVRN
A0A356EME5      KEMIRSARVLRPVVE----------SP---EIRSL-PE------LQEKKDK---------
A0A355AI52      EKLVSSPLVLQSAST----------LL---EAPVR-EL------FGSQDSE---------
A0A3L7SI46      QKVLTSDRVLEGAIT----------RL---PNAHR-ID------LKGTPKS---------
A0A3L7P4E4      SELTVRPAISDGRLR----------EL---------PS------LSGASNL---------
A0A3L7PEB5      SEVTVGPAITDGRLK----------EL---------PS------LSGSPNL---------
A0A2N1UCJ3      SEIIKSTPIIAKVVQ----------RS---DIKRL-RT------FEAKPESIAEKIKKQI
A0A517ZCB5      ERVLRSDEVVKRTLK----------QL---PPEHR-SD------FRGVRPE---------
A0A432MFP3      IQLITSPRVLSVAKL----------DP---KVASQ-SG------VREAPDA---------
D5SZ21          ERIMQGDIVLADAAQ----------KL---PVKYR-TD------FRGVAPA---------
A0A518CHE5      TRLLSSDRVLETAAS----------HL---PPEHQ-VD------VSGNPME---------
A0A257WS34      QKVLLSDAVIEGAIK----------GL---PSKHR-HV------LRKVPRA---------
A0A2E8FLY0      QGVLTSDVVLEEALQ----------KL---PEKHR-ID------LKGIPRN---------
A0A3D2U1E1      QGVLTSDLVLEEVLQ----------KL---PAKHR-VD------LKDVPRA---------
A0A1P8WP26      RRLMADDEVMRRALE----------RL---PERFK-QH------FSELTEA---------
A0A3L7V1F3      IELMSRDEVIVRALK----------TL---PKNAR-VD------LVGYPEG---------
A0A5B9QF68      QKLIASPIVLQNAIK----------RL---PPKHR-ID------LVGEPTH---------
A0A5B9QGF0      RKLISSPIVLQNAIK----------QL---APQHL-ID------LVGKPTH---------
A0A5C6CK24      QKLIASPIVLQNAIK----------QL---SPQYL-ID------LVGEPTH---------
A0A2E8B0L9      ERLFSSAVVLDGAIQ----------RLLKSPAEAR-ID------LAGLPRD---------
A0A5Q4GFE7      ERLFTTQEVLEGAIE----------SLLQGPAENR-ID------FASAPRH---------
A0A2E3GWX1      TKVLSSEEVLKGTLQ----------RL---PRDQQ-AK------FLGMSKR---------
F0SG60          TKVLSSEEVLKGTLQ----------RL---PRDQQ-AK------FLGMSKR---------
A0A2E9VST2      TKVLASDEVLKGALL----------RL---PDTAR-TK------FIGMTKH---------
A0A356A6X2      TKVLASDEVLKGALV----------RL---PDTAR-TK------FIGMTKH---------
A0A5C5XLM3      TKVLASDEVLKGALV----------RL---PDTAR-TK------FIGMTKH---------
A0A3M1VCL4      QEVVVSDRVLEDAIE----------RL---SPEYRMVD------LQDVPRS---------
A0A5C5V7Z9      RELVKSPVVLQNAIA----------NL---PPEHR-VD------LLTVKPS---------
A0A5C5YT05      RELVKSPVVLQNAIS----------DL---PPEHR-ID------LETINPS---------
A0A518D7F9      QQIVRSPVVVREAIQ----------AL---EPQHR-LD------LLGVPSQ---------
A0A5C5ZIP0      KDLVRSPVVVRNAIE----------QL---KPEHR-ID------LVESPPH---------
A0A518KBK3      RELVKSSEVVTRAIE----------RL---APEHR-ID------FVDQKPN---------
A0A5C6AKF9      RELVKSSEVVSRAID----------RL---GPEYR-ID------FVDKKAN---------
A0A2E0X4J3      AEMLRSTPVLAAALE----------AP---GMAQL-QA------VRDSDSP---------
A0A5C5YU10      KELIKSTGVLASVAD----------SP---MASGM-ET------FRGVENR---------
A0A517MPZ6      AELITSTPVLAAAAN----------AP---ESSQL-ET------FRSTDNP---------
A0A5C6CNV7      AELIRSTPVLAAAAE----------QG---ENASL-ET------FRDVDNR---------
A0A518K5H4      AQLICSPSVLNAAIE----------AP---ENVGI-ET------FRNTDNP---------
A0A5C6AA28      AELIRSSSVLSAAVE----------AP---ENAAL-ET------FRKTDNP---------
A0A2E9VK20      VEIIRSPKVVERAVR-------------------D-SQ------LDQLATLAGSE-----
A0A3D4PJK1      VEIIRSPKVVERAVR-------------------D-SQ------LDQLATLAGSE-----
A0A0S8GZ23      AQIIRDNRVLQNVADV----------------------------LDDNNTLLGTG-----
L0DC26          LALLESRLVLSAALK-------------------Q-AS------VAKLPILTKMS-----
A0A354PCQ3      KALFLNPIVLGPVLA-------------------D-AD------LRRAPSLSDPE-----
A0A1I3DDV4      MEIVSSRRIIGNALQ-------------------R-VN------AEEMPGIKAHTDSKT-
A0A2E2N5A9      IELLKSRGLAERVVR----------QL---DLVNH-PE------FAAQPLSVGQGVGTWF
A0A2E3GWC6      VEIIRSPRVIERAVH-------------------E-SH------LDKLPTLAGSE-----
F0SLB0          VEIIRSPRVIERAVH-------------------E-SH------LDKLPTLAGSE-----
A0A2E0SMM6      TRLLSSDHVLQSAAM----------QL---PPEHQ-ID------IGGTPLEMQVK-----
A0A1N6DAJ8      LALLKSRLVLSTALK-------------------D-PE------VAKLEVIAKVV-----
A0A5B9PJZ8      IEILRSTATLKNAIR-------------------D-GK------FEQMETFEDVD-----
A0A2S8G191      RQLLRGPFVINAALR-------------------D-PE------VAKLPVIKEKV-----
A0A2E7EGG1      VELLRSPLILGRVLS-------------------Q-PE------ITAMPEIRSRR-----
A0A225EH48      MRLLKTRMLLDRVVS-------------------N-PN------VSRLPDIKGTD-----
A0A3L7NDH9      EKLIASPLVLESAAKLLDG-------------------------PTRVALGSQDP-----
A0A518INW8      IALLESPMILNDAIE----------------SGKL-SD------LDSFVAARREG-----
A0A518JPH9      IALLKSPMILNDAIE----------------VGNL-SD------LDSFVAARREG-----
A0A2E2CCW9      IDVIKSPRIVGEAVK-------------------E-AR------LNQLPSLAGEK-----
A0A3C0AGX3      IDVIKSPRIVGEAVK-------------------E-AR------LNQLPSLAGEK-----
A0A518AAQ5      IDVIKSPRIVGQAVK-------------------A-AH------LTELPTLEGEK-----
A0A517QBG9      IDVIKSPRIVGQAVK-------------------A-AH------LTELPTLEGEK-----
A0A518FTU3      IDVIKSPRIVGQAVK-------------------A-AH------LTELPTLEGEK-----
A0A2E7K7A9      IDVIKSPRIVGQAVK-------------------A-GK------LTELPSLEGEK-----
A0A517PTS5      IDVIKSPRIVGQAVK-------------------A-GK------LTELPSLEGEK-----
A0A517WHH5      IDVIKSPRIVGQAVK-------------------A-GK------LTELPSLEGEK-----
A0A5A8BGT3      IDVIKSPRIVGQAVK-------------------A-GK------LTELPSLEGEK-----
A0A517VTK3      IDVIKSPRIVGEAVK-------------------E-AK------LYNLPSLAGET-----
A0A517WQT4      IDVIKSPRIVGEAVK-------------------E-AK------LYNLPSLAGET-----
A0A517VID8      IDVIKSPRIVGEAVK-------------------E-AK------LNQLSSLAGEK-----
A0A517RK10      IDVIKSPRIVGEAVK-------------------E-AK------LNELPSLAGEK-----
A0A518IH18      IDVIKSPRIVGEAVK-------------------E-AK------LNELPSLAGEK-----
A0A5C5VEK8      AELIRSTGVLAAVAE-------------------S-PE------AASMETFRGVE-----
A0A532UTJ0      AEKVTSSSVVQRVANALVDKNLSFFDT---EPAGL-LTKWKQKLLGTTPKPEIAA-----
A0A517NSK8      IQLMTSRRILKKAIA----------DH---ELTDI-AS------VSNAIDEGK-------
A0A5C5Z0D6      IELMTSRRILQTAID----------KH---GLEDL-AS------IAEVVAEGR-------
M5UE94          IQLFSSRRILKSAIE----------KH---DLDEV-KS------VVDAISESENL-----
A0A1P8WN28      RQLLLSDRVLTDTVK-----------------ELK-SL------PPELAAEPDRT-----
A0A3B9CTT0      KHLMLSDKSLTQTAE-----------------NLD-PK------PPELSG-VDSL-----
A0A5C5XLF4      VEIIRSPKVVERAVR-------------------D-SH------LDQLATLAGST-----
A0A2D5NDU9      AEVIVSGEILRSALT-----------------RFH-EE------FPDSEINKDET-----
A0A286RGB6      LEYLRSRFVLVAALR-------------------Q-PE------VARLPSIREQI-----
A0A1V5N3W2      ADIIVSDQVIQRVADELADKKLALFED---PDPIA-RY------LTKDSKPLNPV-----
A0A3E0MY27      IQLIKSPFVINTALS-------EPGIA---DISWL-KE------VKAE-----GE-----
A0A2E0X9P6      IELLRGTVVLIPLLG-------------------R-SE------IGAMEEFQNEP-----
A0A286RLF2      VNLITSAKVLEGAIQ---------KLS---REDLA-VD------LNMDK----PE-----
A0A5C5ZM48      VELIRSPMVVAPLLG-------------------D-PA------IAQLEILRGEL-----
A0A5B9WF77      LVSVTSDPVLAGAFV------------------VE-PR------IAKFSMFKNSN-----
A0A518BBX8      QVLIESPLIVERAIR---------------TNPEI-LQ------LESAKPSSEDE-----
A0A518ALT3      IETMKSPIVLGPLLS-------------------R-PS------VSEIEEINSEF-----
A0A517MDV3      MEIIRSPRVIGDAID--NRQLEELESI---RSELD-PV------LAKFDH---RR-----
A0A3M1QRP3      IHKITSARVIERVLE-----RDDVRQT---SLFDE-VE------QNVLTKLLRSP-----
A0A517TMV0      REVVRSSEVIRRAIE----------RL---SPEHR-VD------LADTP----PR-----
A0A2E3RCU8      QQLIVSQPVLENAIQ----------HI---PSECL-QE------FKGN-----RE-----
A0A3E0MY88      EQLLKSAVVLSGVRQ----------LV---EPSHQ-VD------FQGT-----RG-----
A0A1C3E6N1      ERIMQGDIVLADAAQ----------KL---PVKYR-TD------FRGVA----PA-----
A0A518GJT2      ERIMQGDIVLADAAQ----------KL---PVKYR-TD------FRGVA----PS-----
A0A286RD13      TTLVTSNRVLTAALQ-------------------R-PG------ISQLPYIRNQV-----
A0A517MLW3      EKIIRSDRVLKQALD-------QLRQM---DSSLQ-ID------LVGLS----DE-----
A0A5B9QVD0      EKILRSDRVVQSTLR-------SLREQ---PAAAQ-ID------IRDKS----DE-----
A0A3B8PNV4      QGVLTSDVVLEEALQ----------KL---PAKHR-ID------LKGIP----RS-----
A0A3D1DR40      QGVLTSDVVLEEALQ----------KL---PAKHR-ID------LKGIP----RS-----
A0A2E7RYU8      QGVLTSDVVLEEALQ----------KL---PAKHR-ID------LKGIP----RS-----
A0A3B8LXG8      QGVLTSDVVLEEALQ----------KL---PAKHR-ID------LKGIP----RS-----
A0A350CI62      IALMSEEEVIARALR---------IMP---EKYRR-VD------LAGYP----QS-----
A0A4P5WQK6      IALMSEEEVIARALR---------IMP---EKYRR-VD------LAGYP----QS-----
A0A3C1X4W5      IALMSEEEVIARALK---------ILP---EKYRR-VD------LEGYP----QS-----
A0A3D3W3A7      IALMSEEEVIARALK---------ILP---EKYRR-VD------LEGYP----QS-----
A0A518DRX3      EKLFTSAVVLNSAVE-------KLQDA---PPEVV-LA------FDAAP----SK-----
A0A518DZF9      EKLFTSAVVLNSAVE-------KLQDA---PPEVV-LA------FDAAP----SK-----
F0SI78          IALFNTPVILKKAVE----------DF---RLG----E------LSSIS----SS-----
A0A518IQ30      ERLIESSVVLGGALD-------RIRQL---DSDLK-ID------LAGVS----PE-----
A0A517LWP4      ERLIESSVVLGGALD-------RIRKL---DSELK-VD------LAGVP----EE-----
A0A518JNW8      ERLIESSVVLGGALD-------RIRKL---DSELK-VD------LAGVP----EE-----
A0A2E7ENQ5      ERLFYSSVVLEQAAA-------RIQEL---PAPLR-VD------VTPKP----RD-----
A0A1G3AQE9      VDIVRSDKVLDAAVR----------QL---RPEDC-ID------FAGAP----KS-----
A0A3L7UQT9      QRIMSGDRVLSAALE----------DL---PKEYC-VD------FEGFN----PE-----
A0A4P5YBU2      QRIMSGDRVLSAALE----------DL---PKEYC-VD------FKGFN----PE-----
A0A518AKT8      RDLVTSAIVVSNALA----------NL---DSEHL-ID------LERVP----RS-----
A0A5C5ZR72      IELMRNPVVLRETLA----------DE---DVGSA-EH------LKE------ES-----
A0A517TY85      IELLRGPVVLGPALDWSPQTKNGQKLP---KLGEL-AE------VKE------QA-----
A0A5B9QEI7      IELLRGPVVLTPVLG----------RP---EIASI-PE------IKR------SP-----
A0A5S9IJB5      YDLIVSTPLLQKTFDHFNFAEKEKFRNVPD------------------------------
A0A1G2XVR0      ERILRSRSLAQKVLSTMDYKDSPEFNPVKKANIFSIKELTRGNSSPTVRKPEPGKESQEP
A0A1G3B0P0      ERILRSRSLAQKVLSTMDYKDSPEFNPVKKANIFSIKELTRGNSSPTVRKPEPGKESQEP
A0A1E3X4X0      HEILKSRSLAKRVIEELKLGNGPEL---------------------------PSGSSKR-
A0A286U4B3      CEVLKSLTLAKRVVDSLRLDLDPEF---------------------------IGNSKALD
A0A5C6DDS2      CEVLQSRTLAKRVINRLRLDLHPEF---------------------------IAKLKTKE
A0A0S8J591      VENLRSRRIARKLYNDMGMYNWEYFRKLGPDRD---------------------------
A0A2E3GW02      IALFNTPVILKKAVEDFRLGELSSISSSNPMASISS------------------------
A0A1U9NL64      AELMKSTPIIKEAIEENDMASMRTFDEIDNPTGYLKKQL---------------------
A0A5B9QNZ7      MEIIRSPRVIGDAVDNRQLEALESIRQQLDPELARLD----------------------H
A0A1U7CZ81      IAFITTNTVLKPAIGDSTVAELPFIKNSTDKLTDLRQ-----------------------
A0A142YNY8      RAALISDRVLNGAIIDPQVSGLPFIKGSLSPRTELKE-----------------------
A0A1U7GLS6      MGRIRTDRVINDALGDATVSELPFIKNSMAPQADLLE-----------------------
A0A1Z8N7H5      QQLIVSQPVLENAIQYISPECLSEFQGQQRESWH--------------------------
A0A1G2YPI3      AELLKSTPILTAVLDTAGIQQMQTFSEVDNHISYLKKTL---------------------
A0A532UIN2      SELLKSTPIVAAVLDVPGIAQMKTLAGVDNSIAYLKKEL---------------------
A0A532UD06      SELIRSIPIISDAVNDTRIGHLETFAGIDNLVGYVKREL---------------------
A0A660URN1      GELIKSTPIVANVADDSEIGRFKTFEQIDNPAAFLKKNI---------------------
A0A0S8KNX5      AEMITSSRVVRRVADDLADRNLPFLEDEPTDPISKLKRKIDGTQDKRTPEEI--------
A0A3D3UVZ8      AEKITSNSVVQRVADDLVGKNLFFFEAEPNDLVSNWKRKILGTKKIDPAMKL--------
E8R3W3          SQLLRSPIVVEDALKDEKYKGLKTLEDLNENERFNWLSA---------------------
A0A517NFU9      LRLFVGRRMLAEAIQKGNLDQLASFQQVVANGGSVIDHILK-------------------
A0A5C5YWH4      MRLFVSRRLLSDAIKDGKLAELESFKNAAKEGRGGIDHILQ-------------------
A0A3D2TNK4      SDLVTSPVVIEQAIEYLAPEHRTDIEGMPPSTWVRIIGS---------------------
A0A0J1B4A0      MELFASPKILENAIQIAGLNVKVGDLAE--------------------------------
A0A142WSB9      VHFLTSDAIAAIAIEKYGLKDIPGIANARDPLKAVWEDA---------------------
M5SZR3          QALIKSSVIISRASQLPEISALKTKTKELHQGL---------------------------
M5TW92          QALIKSSVIISRASQLPEISALKTKTKELHEGL---------------------------
A0A2S8FKY2      RQLMVTPFVLNSALS---------------------------------REDIMSLDIVRE
A0A517N8P6      LAFIQAEMTSQDVLSDAIAIGQLTAFDETPADVSSLINMIRA------------------
A0A432MJP4      AAILSSPHIVGRAIEQVGVENLPTLQLAKREGKTPTQAAIE-------------------
M5UQ35          MELFRSRKVIERAISVARLDRTVGEIQE--------------------------------
A0A5C5WTY6      VELIRSRRTIESALNQAGLIAEPSI-----------------------------VAKAEP
A0A5C5Y033      MGLIRSRKIVSEALA--------------EYGLMEL------------PSLVAKVS---D
A0A5C6G1Y2      MGLIRSRKIVSEALA--------------EYGLMEL------------PSLVAKVS---D
A0A354PDV6      MQMLRSRKIVEGALT--------------KDGLMDL------------ASIQPLLTPA-K
A0A5C6FZ02      IELLLSRKIVGEAMAAKDDD---------GNSLMTL------------PSVVEHLDPEIE
M5TIT3          IELIQSRMIVGEALE--------------QSNLMAL------------PSIVERIDVDNP
A0A5M6CY44      IELISSRMIVDEALK--------------TNGLTEI------------ESLQSQVS---P
F2AXG2          MELLLSRKIVGEALDPEDVKDEETGELIKREKLIDL------------PSVLPHLD---E
M2BB46          MELLLSRKIVGEALDPEPVKDEETDELIKREKLIDL------------PSVLPHLD---E
L7CLQ6          MELIQSRMIVGEALE--------------QTKLLDL------------PSILQQLS---E
A0A0J1B719      MELIQSRMIVGEALE--------------QNELLDL------------PSIETHLN---E
Q7UF18          MELIQSRMIVGEALE--------------QTELVNL------------PSIESHLD---E
A0A2G1W1E0      MELIQSRMIVGEALE--------------QTELVDL------------PSIESHLD---E
K5E235          MELIQSRMIVGEALE--------------QTELLDL------------PSIESHLD---E
A0A5C6FFI9      VQLLTSRLLISDAIATENLEKLPSIGAVVAGGDNAVDYIIE-------------------
A0A3A0DET7      AELIRSTPVLAAAADAPENA----------------------------------------
A0A5C5WDJ1      MRLFIARKVLTQAIELGDLTQYPSFAEIRQSGGSYVDHILD-------------------
A0A5C5X547      -QLIRSDLNISQVLEL--------------------------------DSEISNLPQVVA
A0A2A2W9R6      IELFGSPKVLQQAIDRAKLNRSVGQLRG--------------------------------
A0A518HKC1      IELFSSPKVLQQAIDRANLNRSVGQLRG--------------------------------
A0A518L3P0      IELFGSPKVLQQAIDRAKLNRSVGQLRG--------------------------------
A0A255R1S0      IALMTSPKVLGQAADEHDLGKSAGEIAG--------------------------------
A0A5B9MKP1      VELFGSPKILKQAIERESLGRSVGQLQR--------------------------------
A0A0S8FY64      VSLITSRAVL-----------DKALEDDRLTGLFQAEDMRQMARPGLWHSAFREVRAVLG
A0A1N6KFT7      ----------------PVPTHMVLIRSPL-------------------------------
L0DFG4          ----------------PVPTHMVLIRSPL-------------------------------
A0A5C5XXG1      RFHVDDKSYRPVRLAKPVEPRQVLTPPPPGRRDK--LAAVKGRSVYSLPPLGPDLSYHFA
A0A518BJJ1      IALLRSRSLAEKTIQSPPDGSIPTPENPHAQRNQGLTTVVESPDQQPVRRIFDRMVGIRR
A0A518D182      IALLSSRALAEQVVATPAD----VLDADERARHLGLEAQVDDLARRPLAAAVGRLTG-QI
A0A353FIP5      LEVLQSRMIVDPVV-------APQSESSLGLNLT--LRVDDLDRYSPWKLVRRKLAGKTL
A0A5B1CIK7      IELLQSRLIV-----------GEALEAN---------GLLEL------DSILPHLNEKI-
A0A5C5WHS2      MELLQSRLIV-----------GEALESN---------GLMNL------ESITPHLGDSG-
A0A5C6B6G8      MELIASRMIV-----------GDALQETQVPGQD--YSLMEL------PSIKAQLSDTE-
A0A5C5ZZN3      IELIQSRMIV-----------GEALEQN---------SLVSL------PSIVEQLDETKP
A0A5C5XS91      IQLIKSRMIV-----------GEALEQN---------ELSEL------PSITTHLNQERP
A0A5C6C4E6      IQLIKSRMII-----------GEALQQN---------DLATL------PSIVERLNPERT
A0A2E1VVJ1      AEILGSRKLVRMVAAHPLSTDGPEFAQGLGIGLS--IKVDDFDRYWPEASILRRFTGGSV
A0A3M2AEL0      MEVLGSRAVAQAVA---LPKGESDLAPEVGLGLS--VTVDDVDRNWPWPAVLRKLGRGEE
A0A532UT69      AALLKSTPILTAVLNDHNARQMQTFTGAGNPIGVLRS-----------------------
A0A2D5AWU0      QILVKSPAILKPLSESKALRGLKSFSREIIGSKPMIT-----------------------
M5RT57          IELIRSSLVAEQVLDDSEIAELPGLQSIEKPIAWLTD-----------------------
A0A356KTN1      MRILESHSLAVDAVKANPKIAREL------ELELGRE-----------------------
A0A518HFS8      TTLIRSNKVLEAALKKSGIGSLEMVRSRTDPVAWLRE-----------------------
                                                                            

A0A5S9IPR9      ------------------------------GQLLR-------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A351FYP6      ------------------------------KHLEK-------------------------
A0A2E7ESJ6      --------------------------DPL-LKLSE-------------------------
A0A1G2YQB7      KWSAKKNSDLVLA-------------LKN-AIASN-------------------------
A0A353P687      KFSKNNSSDLILL-------------LRK-AIADN-------------------------
A0A356EME5      ----------------------------V-QWLQR-------------------------
A0A355AI52      --------------------------ILA-EIFSK-------------------------
A0A3L7SI46      --------------------------RWT-AVLKK-------------------------
A0A3L7P4E4      ----------------------------T-QTILN-------------------------
A0A3L7PEB5      ----------------------------P-MTILA-------------------------
A0A2N1UCJ3      GLAEPSFTTGEID-------------NLV-IYLKK-------------------------
A0A517ZCB5      --------------------------RWI-ESFQS-------------------------
A0A432MFP3      --------------------------E---QYLRE-------------------------
D5SZ21          --------------------------DWP-GVLKK-------------------------
A0A518CHE5      --------------------------MQV-KILRS-------------------------
A0A257WS34      --------------------------RWA-DTLRS-------------------------
A0A2E8FLY0      --------------------------KWT-ETLRN-------------------------
A0A3D2U1E1      --------------------------KWI-DALRK-------------------------
A0A1P8WP26      --------------------------EAV-AEMQK-------------------------
A0A3L7V1F3      --------------------------QWV-RTIKD-------------------------
A0A5B9QF68      --------------------------KWV-EKLSE-------------------------
A0A5B9QGF0      --------------------------EWV-ETLSE-------------------------
A0A5C6CK24      --------------------------KWV-ETLSK-------------------------
A0A2E8B0L9      --------------------------KWI-DALRA-------------------------
A0A5Q4GFE7      --------------------------RWA-NILRG-------------------------
A0A2E3GWX1      --------------------------QAI-GTLRE-------------------------
F0SG60          --------------------------QAI-GTLRE-------------------------
A0A2E9VST2      --------------------------QAI-EKLRS-------------------------
A0A356A6X2      --------------------------QAI-EKLRS-------------------------
A0A5C5XLM3      --------------------------QAI-EKLRS-------------------------
A0A3M1VCL4      --------------------------KWV-KEVRS-------------------------
A0A5C5V7Z9      --------------------------RWI-EALNE-------------------------
A0A5C5YT05      --------------------------HWV-EELGR-------------------------
A0A518D7F9      --------------------------RWL-EDILS-------------------------
A0A5C5ZIP0      --------------------------KWV-DSISD-------------------------
A0A518KBK3      --------------------------RWV-ETIGD-------------------------
A0A5C6AKF9      --------------------------EWV-ETINE-------------------------
A0A2E0X4J3      ----------------------------V-GMLYE-------------------------
A0A5C5YU10      ----------------------------V-GLLYS-------------------------
A0A517MPZ6      ----------------------------I-GLLKK-------------------------
A0A5C6CNV7      ----------------------------V-AFLRK-------------------------
A0A518K5H4      ----------------------------L-ALLRE-------------------------
A0A5C6AA28      ----------------------------V-GLLRE-------------------------
A0A2E9VK20      --------------------------EPA-RDIID-------------------------
A0A3D4PJK1      --------------------------EPA-RDIID-------------------------
A0A0S8GZ23      --------------------------IDRISALKT-------------------------
L0DC26          --------------------------DPI-EWLEG-------------------------
A0A354PCQ3      --------------------------IAE-QNLRK-------------------------
A0A1I3DDV4      --------------------------DAV-DYVSE-------------------------
A0A2E2N5A9      ARLGAFVRTKQPDQAAQGEGTSSKAFDRATEKLMA-------------------------
A0A2E3GWC6      --------------------------DPA-RDIID-------------------------
F0SLB0          --------------------------DPA-RDIID-------------------------
A0A2E0SMM6      --------------------------TLR-TQLST-------------------------
A0A1N6DAJ8      --------------------------DPI-EWLEK-------------------------
A0A5B9PJZ8      --------------------------SVI-RYLRD-------------------------
A0A2S8G191      --------------------------DPV-SWLQG-------------------------
A0A2E7EGG1      --------------------------DPIDWLSTQ-------------------------
A0A225EH48      --------------------------DPV-TFLED-------------------------
A0A3L7NDH9      --------------------------EIVAVILKN-------------------------
A0A518INW8      --------------------------ISALGLLKQ-------------------------
A0A518JPH9      --------------------------NSALGLLSG-------------------------
A0A2E2CCW9      --------------------------DPT-QDIID-------------------------
A0A3C0AGX3      --------------------------DPT-QDIID-------------------------
A0A518AAQ5      --------------------------DPA-QEIID-------------------------
A0A517QBG9      --------------------------DPA-QEIID-------------------------
A0A518FTU3      --------------------------DPA-QEIID-------------------------
A0A2E7K7A9      --------------------------DPA-QEIID-------------------------
A0A517PTS5      --------------------------DPA-QEIID-------------------------
A0A517WHH5      --------------------------DPA-QEIID-------------------------
A0A5A8BGT3      --------------------------DPA-QEIID-------------------------
A0A517VTK3      --------------------------DPT-EEILG-------------------------
A0A517WQT4      --------------------------DPT-EEILG-------------------------
A0A517VID8      --------------------------DPT-QDIID-------------------------
A0A517RK10      --------------------------DPT-QDIID-------------------------
A0A518IH18      --------------------------DPT-QDIID-------------------------
A0A5C5VEK8      --------------------------NRV-AMLYE-------------------------
A0A532UTJ0      --------------------------RLKQAIVGE-------------------------
A0A517NSK8      --------------------------NPL-EYIRD-------------------------
A0A5C5Z0D6      --------------------------SSL-KFVMD-------------------------
M5UE94          --------------------------SPL-AYILD-------------------------
A0A1P8WN28      --------------------------VWP-IRLRE-------------------------
A0A3B9CTT0      --------------------------RWP-GELRK-------------------------
A0A5C5XLF4      --------------------------EPA-RDIID-------------------------
A0A2D5NDU9      --------------------------ITV-PWLKY-------------------------
A0A286RGB6      --------------------------DPV-QWVSE-------------------------
A0A1V5N3W2      --------------------------VAIRQAIRD-------------------------
A0A3E0MY27      --------------------------DQV-AWLNE-------------------------
A0A2E0X9P6      --------------------------EPL-KHLQE-------------------------
A0A286RLF2      --------------------------TWV-EGLRR-------------------------
A0A5C5ZM48      --------------------------DPI-GMLGE-------------------------
A0A5B9WF77      --------------------------DPA-AELRK-------------------------
A0A518BBX8      --------------------------DAV-DVIIE-------------------------
A0A518ALT3      --------------------------DPQ-AYIRE-------------------------
A0A517MDV3      --------------------------AVV-NYIIE-------------------------
A0A3M1QRP3      --------------------------SPG-KRLMD-------------------------
A0A517TMV0      --------------------------KWI-SSINS-------------------------
A0A2E3RCU8      --------------------------SWH-RELAS-------------------------
A0A3E0MY88      --------------------------PGV-GVLAS-------------------------
A0A1C3E6N1      --------------------------DWP-GVLKK-------------------------
A0A518GJT2      --------------------------DWP-GVLKK-------------------------
A0A286RD13      --------------------------DPI-MWLRR-------------------------
A0A517MLW3      --------------------------QAL-TTLQG-------------------------
A0A5B9QVD0      --------------------------AAV-KTIRA-------------------------
A0A3B8PNV4      --------------------------KWT-EALRN-------------------------
A0A3D1DR40      --------------------------KWT-EALRN-------------------------
A0A2E7RYU8      --------------------------KWT-EALRN-------------------------
A0A3B8LXG8      --------------------------KWT-EALRN-------------------------
A0A350CI62      --------------------------AWV-RMVRD-------------------------
A0A4P5WQK6      --------------------------AWV-RMVRD-------------------------
A0A3C1X4W5      --------------------------AWI-RKVRD-------------------------
A0A3D3W3A7      --------------------------AWI-RKVRD-------------------------
A0A518DRX3      --------------------------EWA-KTIEQ-------------------------
A0A518DZF9      --------------------------EWA-KTIEQ-------------------------
F0SI78          --------------------------NPM-ASISS-------------------------
A0A518IQ30      --------------------------KWK-DTLRN-------------------------
A0A517LWP4      --------------------------KWK-DLLRG-------------------------
A0A518JNW8      --------------------------KWK-DLLRG-------------------------
A0A2E7ENQ5      --------------------------EWV-EILRK-------------------------
A0A1G3AQE9      --------------------------EWS-KKLRD-------------------------
A0A3L7UQT9      --------------------------VWP-TLLKN-------------------------
A0A4P5YBU2      --------------------------VWP-TLLKN-------------------------
A0A518AKT8      --------------------------DWV-EDLTD-------------------------
A0A5C5ZR72      --------------------------NRV-KAIQK-------------------------
A0A517TY85      --------------------------DPV-DYLKR-------------------------
A0A5B9QEI7      --------------------------DPL-KYLQK-------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A1G2XVR0      ETPVKYDVDDALINNYLS------------------------------------------
A0A1G3B0P0      ETPVKYDVDDALINNYLS------------------------------------------
A0A1E3X4X0      ----------RLIDVYLK------------------------------------------
A0A286U4B3      GSVNKSVSMDRLARQLLG------------------------------------------
A0A5C6DDS2      SDADKPVSVEKLVTIFLN------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A5B9QNZ7      RRAVITYILD--------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      EENPLEWLQE--------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A5C5WTY6      PEDTVTYVAS--------------------------------------------------
A0A5C5Y033      ETDQVDYVIQ--------------------------------------------------
A0A5C6G1Y2      ETDQVDYVIQ--------------------------------------------------
A0A354PDV6      GEDAADYVIS--------------------------------------------------
A0A5C6FZ02      TVDAVDYVID--------------------------------------------------
M5TIT3          SSDAVDYVIN--------------------------------------------------
A0A5M6CY44      ETDAAEYVIE--------------------------------------------------
F2AXG2          KTDAIDYVID--------------------------------------------------
M2BB46          KTDAIDYVID--------------------------------------------------
L7CLQ6          KTDAIDYVID--------------------------------------------------
A0A0J1B719      KTDAIDYVID--------------------------------------------------
Q7UF18          KTDAIDYVID--------------------------------------------------
A0A2G1W1E0      KTDAIDYVID--------------------------------------------------
K5E235          KTDAIDYVID--------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      EPDPIEWILE--------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A0S8FY64      YEPVRPVEAWELL-----------------------------------------------
A0A1N6KFT7      ---VIQAAVDSLGSNTPTSLAQSSDPVGFAR-----------------------------
L0DFG4          ---VIQTAVESLGPKKTPSLALATNPLEAVR-----------------------------
A0A5C5XXG1      VSPSIYGTLAILASSTGLLVDF-------IDLPIRPSIRMTENNAKPSAPAKSESRVTED
A0A518BJJ1      GKGALHARARALADGAAEAIRVSFDGEGQIRLTPVDVAASPDDDAREARPQRPDGRYRVG
A0A518D182      PAPRIAVRSERLDGSAPERVRLRFVSPTRVELAALGDMAYAEHFGSDA----TELDYAAG
A0A353FIP5      D-GALSGELALPIARQNSAPVTVTFHSSNSGVATSGKI-------LRQQSKAFSLANSPL
A0A5B1CIK7      --DSVDYVIE--------------------------------------------------
A0A5C5WHS2      --DPVEYVID--------------------------------------------------
A0A5C6B6G8      --DAIDYVID--------------------------------------------------
A0A5C5ZZN3      QFDAVDYVIE--------------------------------------------------
A0A5C5XS91      GFDATDYVVE--------------------------------------------------
A0A5C6C4E6      GFDATDYVVE--------------------------------------------------
A0A2E1VVJ1      PNGSLEMELLQPYTDPWTHRIELEFLAEGEVLARSSRI------AEPETIRFDPNDTEPI
A0A3M2AEL0      PTGSLRVEVEQLPRDLTYRAWRIHFSSPEVVEVLPDSLWAAVLPGRKQVVRLD--DGKPL
A0A532UT69      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      --------TISVAVGDG------------------------------------------T
A0A533Q9U4      --------PLKVSLMRN------------------------------------------S
A0A1U9NNE1      --------KLMINKETI-----------------------------------LIEPGEKT
A0A2G2JCA2      --------NINVRAVSG------------------------------------------S
A0A533Q6B7      --------GLNVSLMRN------------------------------------------S
A0A351FYP6      --------VIDVSQYRN------------------------------------------T
A0A2E7ESJ6      --------NLKVELVED------------------------------------G-----T
A0A1G2YQB7      --------QLSVAPEDN------------------------------------------T
A0A353P687      --------KLTVAPEDK------------------------------------------T
A0A356EME5      --------ELRLTSVGK------------------------------------------S
A0A355AI52      --------SLSVRGLRQ------------------------------------------T
A0A3L7SI46      --------NLTVSSTRL------------------------------------------T
A0A3L7P4E4      --------GLNAERTVE------------------------------------D-----G
A0A3L7PEB5      --------GLSATRTVE------------------------------------------G
A0A2N1UCJ3      --------LLDVQVGIK------------------------------------------D
A0A517ZCB5      --------HLEVSAERK------------------------------------------T
A0A432MFP3      --------MIKVAARPN------------------------------------------T
D5SZ21          --------MVTVRSARQ------------------------------------------T
A0A518CHE5      --------QLSTSVSPQ------------------------------------------T
A0A257WS34      --------GLSVSAARQ------------------------------------------T
A0A2E8FLY0      --------NLAVTTPRR------------------------------------------T
A0A3D2U1E1      --------QLGVSAPRR------------------------------------------T
A0A1P8WP26      --------SLSVSSDFG------------------------------------------T
A0A3L7V1F3      --------NLSVSCAFS------------------------------------------T
A0A5B9QF68      --------NLSARVTRK------------------------------------------T
A0A5B9QGF0      --------NLSAQVTRR------------------------------------------T
A0A5C6CK24      --------NLSARVTRK------------------------------------------T
A0A2E8B0L9      --------NLSASGLRR------------------------------------------T
A0A5Q4GFE7      --------NLSAQAIRR------------------------------------------T
A0A2E3GWX1      --------NLSVSTTRQ------------------------------------------T
F0SG60          --------NLSVSTTRQ------------------------------------------T
A0A2E9VST2      --------NLTVNSTRQ------------------------------------------T
A0A356A6X2      --------SLTVNTARQ------------------------------------------T
A0A5C5XLM3      --------SLTVNTARQ------------------------------------------T
A0A3M1VCL4      --------NTYVSTIKQ------------------------------------------T
A0A5C5V7Z9      --------NLSATTVRR------------------------------------------T
A0A5C5YT05      --------GLSASTVRR------------------------------------------T
A0A518D7F9      --------RLSASSVRK------------------------------------------T
A0A5C5ZIP0      --------RLSASATRK------------------------------------------T
A0A518KBK3      --------SLTASTVRK------------------------------------------T
A0A5C6AKF9      --------QLTASTVRK------------------------------------------T
A0A2E0X4J3      --------GLAIQVGAD------------------------------------------N
A0A5C5YU10      --------GLNVDVGRD------------------------------------------D
A0A517MPZ6      --------NLSVQVGKN------------------------------------------D
A0A5C6CNV7      --------NIDVQVGQN------------------------------------------D
A0A518K5H4      --------EIEVVVGER------------------------------------------D
A0A5C6AA28      --------SLEVAVGER------------------------------------------D
A0A2E9VK20      --------SLKVS-RTA------------------------------------GEDHHQL
A0A3D4PJK1      --------SLKVS-RTA------------------------------------GEDHHQL
A0A0S8GZ23      --------ALADG-TIT------------------------------------IKHLTRT
L0DC26          --------QLQVD-FAP------------------------------------G-----S
A0A354PCQ3      --------NLSIS-GGG------------------------------------T-----A
A0A1I3DDV4      --------HISLT-KGG------------------------------------QGSARDA
A0A2E2N5A9      --------AISVN-PRG------------------------------------K-----S
A0A2E3GWC6      --------GLKVE-RTA------------------------------------GEDHHKL
F0SLB0          --------GLKVE-RTA------------------------------------GEDHHKL
A0A2E0SMM6      --------SVSPQ----------------------------------------------T
A0A1N6DAJ8      --------ELQVD-FAS------------------------------------G-----S
A0A5B9PJZ8      --------GKALI-AKS------------------------------------ADVKSNS
A0A2S8G191      --------ALSVN-FPD------------------------------------N-----A
A0A2E7EGG1      --------GLLIA-PKG------------------------------------S-----S
A0A225EH48      --------RIKLR-------------------------------------------WGSP
A0A3L7NDH9      --------HLKIK-GVR------------------------------------S-----T
A0A518INW8      --------DLNIS-RGG------------------------------------SGDAEGA
A0A518JPH9      --------NLNIQ-RGG------------------------------------AGGSQGA
A0A2E2CCW9      --------TLKVK-RIS------------------------------------GNDRAFL
A0A3C0AGX3      --------TLKVK-RIS------------------------------------GNDRAFL
A0A518AAQ5      --------SLKVK-RLS------------------------------------GTDRTYL
A0A517QBG9      --------SLKVK-RLS------------------------------------GTDRTYL
A0A518FTU3      --------SLKVK-RLS------------------------------------GTDRTYL
A0A2E7K7A9      --------SLKVK-RLS------------------------------------GTDRTYL
A0A517PTS5      --------SLKVK-RLS------------------------------------GTDRTYL
A0A517WHH5      --------SLKVK-RLS------------------------------------GTDRTYL
A0A5A8BGT3      --------SLKVK-RLS------------------------------------GTDRTYL
A0A517VTK3      --------SLKVK-RIS------------------------------------GNDRAYL
A0A517WQT4      --------SLKVK-RIS------------------------------------GNDRAYL
A0A517VID8      --------TLKVK-RIS------------------------------------GNDRAFL
A0A517RK10      --------TLKVK-RIS------------------------------------GNDRAYL
A0A518IH18      --------TLKVK-RIS------------------------------------GNDRAYL
A0A5C5VEK8      --------ALSVG-VGQ------------------------------------D-----D
A0A532UTJ0      --------KSIVVAADR------------------------------------R-----S
A0A517NSK8      --------HLHVT-KGG------------------------------------LGVAKDA
A0A5C5Z0D6      --------NLSVS-KGG------------------------------------EGVARDA
M5UE94          --------NLEVT-KGG------------------------------------DGVAKDA
A0A1P8WN28      --------MLVVT-FET------------------------------------D-----E
A0A3B9CTT0      --------MLTVK-FNS------------------------------------A-----S
A0A5C5XLF4      --------SLKVT-RTA------------------------------------GEDHHQL
A0A2D5NDU9      --------HLRAE-VGS------------------------------------D-----N
A0A286RGB6      --------HLSVR-FPG------------------------------------N-----S
A0A1V5N3W2      --------GIIAVVPGR------------------------------------K-----T
A0A3E0MY27      --------RIDVV-NPR------------------------------------M-----T
A0A2E0X9P6      --------HLAVA-QIG------------------------------------E-----S
A0A286RLF2      --------NLAAS-AVY------------------------------------R-----T
A0A5C5ZM48      --------LVHVF-QRG------------------------------------D-----S
A0A5B9WF77      --------RLEVQ-ILP------------------------------------D-----T
A0A518BBX8      --------EIDVKRTTG------------------------------------RLSSSPD
A0A518ALT3      --------HLSVR-QVG------------------------------------K-----S
A0A517MDV3      --------QLWIERGGQ------------------------------------E-----L
A0A3M1QRP3      --------GLDVN-VAH------------------------------------N-----S
A0A517TMV0      --------RLSAS-TVR------------------------------------K-----T
A0A2E3RCU8      --------KISTH-VVR------------------------------------S-----T
A0A3E0MY88      --------NISVS-TAK------------------------------------G-----T
A0A1C3E6N1      --------MVTVR-SAR------------------------------------Q-----T
A0A518GJT2      --------MVTVR-SAR------------------------------------Q-----T
A0A286RD13      --------NLRVR-FAD------------------------------------Q-----A
A0A517MLW3      --------NLTVQ-LVR------------------------------------N-----T
A0A5B9QVD0      --------NLSVN-LLR------------------------------------N-----T
A0A3B8PNV4      --------NLAVT-APR------------------------------------R-----T
A0A3D1DR40      --------NLAVT-APR------------------------------------R-----T
A0A2E7RYU8      --------NLAVT-APR------------------------------------R-----T
A0A3B8LXG8      --------NLAVT-APR------------------------------------R-----T
A0A350CI62      --------NLQAS-SAY------------------------------------N-----T
A0A4P5WQK6      --------NLQAS-SAY------------------------------------N-----T
A0A3C1X4W5      --------NLQAS-SAY------------------------------------N-----T
A0A3D3W3A7      --------NLQAS-SAY------------------------------------N-----T
A0A518DRX3      --------NLRAS-SKR------------------------------------G-----T
A0A518DZF9      --------NLRAS-SKR------------------------------------G-----T
F0SI78          --------GLSVSRSAK------------------------------------A-----E
A0A518IQ30      --------NLSAS-AAR------------------------------------R-----T
A0A517LWP4      --------KLSAS-AAR------------------------------------R-----T
A0A518JNW8      --------NLSAS-AAR------------------------------------R-----T
A0A2E7ENQ5      --------NLTAR-AVR------------------------------------S-----T
A0A1G3AQE9      --------KLSVN-ALR------------------------------------N-----K
A0A3L7UQT9      --------HVSVT-NER------------------------------------G-----T
A0A4P5YBU2      --------HVSVT-NER------------------------------------G-----T
A0A518AKT8      --------RLSAS-ISR------------------------------------K-----G
A0A5C5ZR72      --------RLKVK-QVG------------------------------------G-----S
A0A517TY85      --------NLSVS-QVG------------------------------------K-----S
A0A5B9QEI7      --------QLTVR-QIG------------------------------------K-----S
A0A5S9IJB5      --------PLKVFRGLF-----------------------------------TVTPLRKS
A0A1G2XVR0      --------KLTVQMTGN------------------------------------------S
A0A1G3B0P0      --------KLTVQMTGN------------------------------------------S
A0A1E3X4X0      --------KLSITPVRN------------------------------------------T
A0A286U4B3      --------RTEILSVRN------------------------------------------S
A0A5C6DDS2      --------MINIELVRN------------------------------------------S
A0A0S8J591      --------PIAVVRNWI-----------------------------------RVSRVPKT
A0A2E3GW02      --------GLSVSRSAK-----------------------------------------AE
A0A1U9NL64      --------QVSVGKKDD-------------------------------------------
A0A5B9QNZ7      --------NLWVERGGQ-------------------------------------ELAYAP
A0A1U7CZ81      --------KLKVKNKDG------------------------------------------T
A0A142YNY8      --------RLAIVNPRN------------------------------------------T
A0A1U7GLS6      --------RLVVTNQKN------------------------------------------T
A0A1Z8N7H5      --------RQLAGKIST-------------------------------------RVVKST
A0A1G2YPI3      --------NATVGKKDD-------------------------------------------
A0A532UIN2      --------DVSVGKKDD-------------------------------------------
A0A532UD06      --------KVAVGRKDD-------------------------------------------
A0A660URN1      --------NVAVGKKDD-------------------------------------------
A0A0S8KNX5      --------LKQAITNGV----------------------------------IVAAADRLS
A0A3D3UVZ8      --------KLAIVEDET----------------------------------ITVAADRRS
E8R3W3          --------NIQSSFAGD-------------------------------------------
A0A517NFU9      --------NIEVNRGGE-------------------------------------GSARDA
A0A5C5YWH4      --------HIEVIRGGE-------------------------------------GSSRDA
A0A3D2TNK4      --------RLHT------------------------------------------RVTRKK
A0A0J1B4A0      --------NLSVSKGGD-------------------------------------GLAKSA
A0A142WSB9      --------TAKLVSGQD---------------------------------------QSFD
M5SZR3          --------NVELDENAD-------------------------------------------
M5TW92          --------NVELDENAD-------------------------------------------
A0A2S8FKY2      --------ELIVGFPGD------------------------------------------A
A0A517N8P6      --------NLVLSPPFE------------------------------------GAESPDR
A0A432MJP4      --------ELDVS-----------------------------------------RPDRAA
M5UQ35          --------NLAVGRGGS-------------------------------------GDAEAA
A0A5C5WTY6      --------NLRIDRGGL-------------------------------------GAAKKA
A0A5C5Y033      --------NTSIGKGGD-------------------------------------GSARSA
A0A5C6G1Y2      --------NTSIGKGGD-------------------------------------GSARSA
A0A354PDV6      --------QLEIVKGGA-------------------------------------GAAKSA
A0A5C6FZ02      --------HMEVVKGGE-------------------------------------GGAKTA
M5TIT3          --------HLSVSKGGD-------------------------------------GSAKNA
A0A5M6CY44      --------HLEIVKGGS-------------------------------------GGAKTA
F2AXG2          --------QLSIVRGGD-------------------------------------GSAKTA
M2BB46          --------QLSIVKGGD-------------------------------------GSAKTA
L7CLQ6          --------QLSIVKGGD-------------------------------------GSAKTA
A0A0J1B719      --------QLSIVKGGD-------------------------------------GSAKTA
Q7UF18          --------QLSIVKGGD-------------------------------------GSAKTA
A0A2G1W1E0      --------QLSIVKGGD-------------------------------------GSAKTA
K5E235          --------QLSIVKGGD-------------------------------------GSAKTA
A0A5C6FFI9      --------NLDVARGGK-------------------------------------GASKNA
A0A3A0DET7      --------NLETFHGVD-------------------------NRVAFLRDNINVGVGSQD
A0A5C5WDJ1      --------SIEVERGGD-------------------------------------GNAQNA
A0A5C5X547      --------NLHVMQLPD------------------------------------------T
A0A2A2W9R6      --------GLSISKGGQ-------------------------------------GAGASA
A0A518HKC1      --------GLSISKGGQ-------------------------------------GAGASA
A0A518L3P0      --------GLSISKGGQ-------------------------------------GAGASA
A0A255R1S0      --------KLSVGKDGE------------------------------------------A
A0A5B9MKP1      --------GLSISTGGE-------------------------------------GAGSAA
A0A0S8FY64      ------------------------------------------------REIVGVRPVKDT
A0A1N6KFT7      ------------------------------------------------GNLKVSRPDRLT
L0DFG4          ------------------------------------------------GSLKVTRPDRLT
A0A5C5XXG1      --------VVTLDVLQILFRQRWLIAFLTLAGLAAGVAYALQARVWYESTARVLINEKSS
A0A518BJJ1      ------GVELNLAVRGDVSRREFVVRRVSEASAVKRLL----------SDTRVVESQRNS
A0A518D182      EPVEWSGLRLWIDADADRSLGTYVVHVRTPDDAARDLM----------NNTRVMETQRNS
A0A353FIP5      --VEIADTKIRLFPEGDLTGRQFRLNVATRREAVERVL----------KELAVSETARGS
A0A5B1CIK7      --------HLSIVKGGD-------------------------------------GSAKTA
A0A5C5WHS2      --------RLELVKGGD-------------------------------------GSAKTA
A0A5C6B6G8      --------HLELVKGGE-------------------------------------GSAKTA
A0A5C5ZZN3      --------QLSIVKGGE-------------------------------------GSAKTA
A0A5C5XS91      --------HISISKGGE-------------------------------------GSAKAA
A0A5C6C4E6      --------HLSISKGGE-------------------------------------GSAKAA
A0A2E1VVJ1      --VTMFGRRYKLMITGTLSGRKFGVTLRNLDATVGDLL----------SRLRIRETSRGS
A0A3M2AEL0      ---ELAGARIRLIPDGDLSGRTFRLTLRSVRRAIRDTQ----------ESCRVVETHKGS
A0A532UT69      --------GLD-VSVGK-----------------------------------------RD
A0A2D5AWU0      --------ELN-DRIGT-----------------------------VVDP--------NT
M5RT57          --------NIRVQQVG------------------------------------------SS
A0A356KTN1      --------ATP-EELGG-----------------------------MFQRGVRVEALEST
A0A518HFS8      --------RLR-TEFG------------------------------------------NS
                                                                            

A0A5S9IPR9      DILYIT----CRGKNAENVAYIANLYVDVFVDEN-------EREIKNAQDKLLNWLKQV-
A0A533Q9U4      GVVSIS----YDGHNPQLITRIANMIVKTYIEQD-------WEKRYNVAKDALDWLNKQ-
A0A1U9NNE1      ELINIK----MKTNNTAFSEELVDSFIRVYMTMQ-------AYEENQGEDNKLALLENK-
A0A2G2JCA2      EMYSVE----FQSTDPVKASLIVNEVAKSYYNLH-------NQTEAVKDKRVLDLLETE-
A0A533Q6B7      GVVCIT----YTGDDPYLITTITNAIVKTYIEQD-------WERRYSVAKEALEWLNKQ-
A0A351FYP6      SIIELR----AYDRDKNLAQQIAQALAKEYENYR-------SSLQEERVKAGIDKLRER-
A0A2E7ESJ6      NVLNIR----FIGPYPEDTQKVVNAVLHTYQQFL-------QEAYEDSGTETRDLIVKA-
A0A1G2YQB7      ELIKIA----VKSSNPTSASKIANAFVQAYMTIV-------ASEEVKDGDHKLTVLENE-
A0A353P687      ELIKIS----VKSSNPSNASKIANSFVQAYMTIV-------ATEELKDGDHKLTVLEDE-
A0A356EME5      EFLQVD----FQGPDPKNAAKIVNAVVKRYFDLL-------AEVTDERVAKVIALLDRE-
A0A355AI52      NLLELN----FRSSHQDATAVVVAAIIQAYAKFM-------DESHRGTANSIVDLLQNE-
A0A3L7SI46      NMIQVR----YVSKNAKTAKLVVDAIVAAYLEYM-------NEIHKGNSKESMVLLNRE-
A0A3L7P4E4      QVLDIS----FKGTDPDDCAKVVNAVVASYDKNL-------RETYTDQGMVVSNLLKDA-
A0A3L7PEB5      QILDIS----FKGSDPVDCAKVVNAVVASYDKSL-------RESYADKGTVVAKLLTNA-
A0A2N1UCJ3      DIIAVS----CLSPYREEAAQIVNAVIEAYVDYQ-------TSQKKSSVSEVLKILQKE-
A0A517ZCB5      NVMNIR----YRSGDADTAYVVVSTLIGAYLEYM-------DHVMENTARDLLGILSQR-
A0A432MFP3      SLIEVA----AEAERAHEAADVVNAVVRSYLDAN-------KEWSEARTNNAIRMLVEY-
D5SZ21          NVLELT----CRSRDPKAAAAILYAVLSASIDFL-------NKNHQGTSQEILQILSKE-
A0A518CHE5      NLIDIR----FTSQSPETAAYTIDQVIMAYLKFM-------EETHQNGTQNLLKLLTED-
A0A257WS34      NVMTLR----YRSTDPELSAYIVSSVLNSYLKFM-------QATHRHSSRETLDVLTRE-
A0A2E8FLY0      NLIDVR----YRSRDPQVAATVVNHIVESYLTLM-------RGIHKNNAGNDIQFMTAE-
A0A3D2U1E1      NLIDVR----YRSRDPQTAAAIVNHVVNSYLKLM-------REIHKSTASEDVEFLTKK-
A0A1P8WP26      NVLDVS----YRSTDAKVAAAVVAHVLVAYNSFM-------NDVNRGSSDKNIERLEAQ-
A0A3L7V1F3      TVLDLS----YKSKDPKAAQAVLRSMLAAYVEFL-------DDTHNGSSEESIRKLKQQ-
A0A5B9QF68      NFINVS----FRSKSPDAAAAVVRAIIHSYLQFV-------QEKDRGTAVDALHSLLQK-
A0A5B9QGF0      NFIDVT----YRSKSPDAAAAVVRAVINSYLQFV-------QEKHQGTAGDALHSLLQK-
A0A5C6CK24      NFIDVT----YRSKHPEAAAAVVRAIINSYLQFV-------QDKHQGTAGDALHSLLQK-
A0A2E8B0L9      NIVELN----YRSKSPHAAEAVVDAVVDSYIEFM-------KENHTDVSVEIVSILEKE-
A0A5Q4GFE7      NVIEIS----YKSRSPGAAEAVVGAVVQSYLEFM-------ERSHKDVSTEIVQILDRE-
A0A2E3GWX1      NLLSVN----YRTTDPKSAAIIVTEILNSYFAFM-------QDMHQNSSREMLKLLTAE-
F0SG60          NLLSVN----YRTTDPKSAAIIVTEILNSYFAFM-------QDMHQNSSREMLKLLTAE-
A0A2E9VST2      NLLQVS----YCSESPEVASLIVTEILNSYFQFM-------HEMHESSSGELLETLTTE-
A0A356A6X2      NLLEVK----YCSESPEESSTIVTEILNSYFKFM-------HEMHESSSGQMLDTLTKE-
A0A5C5XLM3      NLLEVK----YCSESPEESSMIVTEILNSYFKFM-------HEMHESSSGQMLDTLTKE-
A0A3M1VCL4      SLIDVR----YRSRDPKAAAAMVEAILAAYLDFM-------ERTHKKGAHDNLEVLTRK-
A0A5C5V7Z9      KFIQVS----YRSHQPESAVAVVNSVINSYLRFV-------EETHRSTAADVLDVLTVE-
A0A5C5YT05      KFIQVS----YKSRRPESAVAVVNAVINSYLHFV-------EETHRSTAAEVLDVLTIE-
A0A518D7F9      NVIEVR----YRSKEPEAATAVVTSVINSYLAFV-------DRTHRGAALDIHEMLTTK-
A0A5C5ZIP0      NFVSVA----YESLHPEAAAAVVNAVINSYLEFV-------EETHRGTAADVLNVLTVE-
A0A518KBK3      NFINVG----YDSLDPEAAAAVVRAVIEAYVDFV-------GETHRGTAAEVLDVLTIE-
A0A5C6AKF9      NFINVG----YDSLDPEAAAAVVRAVIEAYLDFV-------AETHRGTAAEVQDVLTTE-
A0A2E0X4J3      EIITVS----LELPDPEEAAQLVNAVVDAYVSKY-------AGDYQDSALELLNILREE-
A0A5C5YU10      EIINVS----LTLPNPVEAAQLVNEIVAAYITQY-------AEKHNTETFKILEILNGE-
A0A517MPZ6      DIINVM----IELPSAEDAAQIVNSVVDAYISKY-------AEERRTDTVEVLNILRNE-
A0A5C6CNV7      DIINVS----AELANSADAAQLVNSVVEAYISKY-------AEERRTDTVEVLTILRNE-
A0A518K5H4      DIINIS----IELENPTDAAQIVNSVVDAYITKY-------AEERRSDVVDVVNILRSE-
A0A5C6AA28      DIINIA----IELENPTDAAVIVNSVVDAYITQY-------AEERRTNVVDVVNILRSE-
A0A2E9VK20      NILNLQ----YTTSKSKDATAILNGVIKAYDDYL-------KDDARKNHAELQTLLEQI-
A0A3D4PJK1      NILNLQ----YTTSKSKDATAILNGVIKAYDDYL-------KDDARKNHAELQTLLEQI-
A0A0S8GZ23      EFLGVS----MTSRKPRQAEQIVNAFMKEYMKVV-------DNIDLGMEDQDLANLRKL-
L0DC26          EILRIS----MTGEKPEIPMLLVNAVTQAYMDEI-------VDVEMKQSRQRYDLLKST-
A0A354PCQ3      SRLVVS----YQDSDREAAATVCNAIVQSYLRQR-------DAFDSIRVNNLERWLEPE-
A0A1I3DDV4      RSLNIA----FRHTNPDEALLILQALVAEYESFL-------DEQVSRIMSEANRLITQA-
A0A2E2N5A9      QVVAVE----VLLADSYVAMKAANALVEGYIASK-------FEAGVATSATATAWMDSR-
A0A2E3GWC6      NILNLQ----YTSTSEEDAKQILNAVVKAYDEYL-------QDDAQKSHRELTQLLNQI-
F0SLB0          NILNLQ----YTSTSEEDAKQILNAVVKAYDEYL-------QDDAQKSHRELTQLLNQI-
A0A2E0SMM6      SLIDVR----FISKSPETAAYTTNQIIACYIKFM-------QETHQYGTQNLLTLLQQD-
A0A1N6DAJ8      EILRIS----INGEKPQVPMLLVNAITQAYIDEI-------VDVETKQRRQRYDLLKET-
A0A5B9PJZ8      GVIKIS----FDGGNQKEAEQILDAVVKAFGSYI-------DSDAEEIGGQTTQLWKTL-
A0A2S8G191      EIMEVK----LSGESPQSISKIVNAVVQAYMDEV-------VDAEANMRRSRLSSLERA-
A0A2E7EGG1      ELLEVA----FEGVNPENSALLVNAIIDAYFTMR-------QEKRGQRAQSVISLLEDE-
A0A225EH48      EILEVS----MNGDDPKQILLIVNTMVDEYIKDA-------DSDERQGRQRRRKIIEAH-
A0A3L7NDH9      NLIDLK----YRAQDPRAAAMAVGAIIKAYSLFM-------QETHRGSAGTLVEVLTKE-
A0A518INW8      SVLQVS----FQSADPEDAQHVLEVIYERYCHHV-------ESRTQNVGQEAATLINQA-
A0A518JPH9      SVLQVT----YQSSDPEDAEYVLEVVYERYCHHI-------ESRTQNVGEEAAALIIQA-
A0A2E2CCW9      NILTIT----YENPNAKDARTVTQAIVDAYKRYL-------HEVREENTEDIIQQLKEA-
A0A3C0AGX3      NILTIT----YENPNAKDARTVTQAIVDAYKRYL-------HEVREENTEDIIQQLKEA-
A0A518AAQ5      NILNLT----YENPNSHDAKVIMQAIVDAYQHYL-------DEVRDQNTGEIIQQLNKA-
A0A517QBG9      NILNLT----YENPNSHDAKVIMQAIVDAYQHYL-------DEVRDQNTGEIIQQLNKA-
A0A518FTU3      NILNLT----YENPNSHDAKVIMQAIVDAYQHYL-------DEVRDQNTGEIIQQLNKA-
A0A2E7K7A9      NILNLT----YENKNSNDAKVIMQAIVDAYHHYL-------DEVRDQNTGEIIDQLNKA-
A0A517PTS5      NILNLT----YENKNSNDAKVIMQAIVDAYHHYL-------DEVRDQNTGEIIDQLNKA-
A0A517WHH5      NILNLT----YENKNSHDAKAIMQAIVDAYQHYL-------DEVRDQNTGEIIEQLNKA-
A0A5A8BGT3      NILNLT----YENKNSHDAKAIMQAIVDAYQHYL-------DEVRDQNTGEIIEQLNKA-
A0A517VTK3      NILNIL----YENPRSQDAKIVTQAIVDAYQRYL-------HEVRQVNTNEIREQLDQA-
A0A517WQT4      NILNIL----YENPRSQDAKIVTQAIVDAYQRYL-------HEVRQVNTNEIREQLDQA-
A0A517VID8      NILTIT----YENPNAKDAQAVTQAIVDAYKRYL-------SEVREENTEDIIQQLKDA-
A0A517RK10      NILSIT----YENPLSADAKAVTEAVVKAYRKYL-------NDVSDENTKDIIKQLNVA-
A0A518IH18      NILSIT----YENPLSQDAKAVTEAVVKAYRKYL-------NDVSDENTKDIIKQLNEA-
A0A5C5VEK8      EIINVG----LELPNRFEAAQLVNAIVDAYITQY-------AEKRRNDTVEVLKILRSE-
A0A532UTJ0      ELIHVT----MQTTKPEEARQIVDAFITAYMDIE-------VLSAVEGENARLTLLEDR-
A0A517NSK8      HTLQAT----YDDPSPEDCAVVLRAIFDAYDVYL-------KEHFSSNSSQAIDLLSQL-
A0A5C5Z0D6      HILQAS----YDDPSPSDCAVILRAIFDEYAAYL-------KEHFEGTSTQAVDLLTEL-
M5UE94          HTLKAT----YDDPSPVDCALILRAIFDEYKIYL-------DDHFAGTSTQAVELLTQL-
A0A1P8WN28      YVLEIK----CRSTSPESTVNVIEGLSVASGKFM-------DEYQKDLSVELMKQLERK-
A0A3B9CTT0      QDLTIS----CRSRDPESTVAVIEALQEVSEQFI-------EDYQTSLTVTLMNRLQED-
A0A5C5XLF4      NILNLQ----YTTSKSKDATAILNGIIKAYDDYL-------KDDAQKNHSELQTLLEQI-
A0A2D5NDU9      DVITLT----LDNRHKHEACALVNEVVEAYQKFQ-------RKMQRNSATELYRILDMD-
A0A286RGB6      EFMNVS----FTSTRPDETAVIVNAIVDAYMREV-------VDTEQRERRQRLSELDQL-
A0A1V5N3W2      ELIKIT----MDSLNPKEAELVVDAFVRAYMNIE-------GSRSMEGGNKNLEVLESE-
A0A3E0MY27      AVLRIS----MSGDEKEPVRMIVEAVAQAYLENV-------VRRERNDLLAKLSELERQ-
A0A2E0X9P6      ELYSVD----YVSPSASDAATVANLVVLEYLQMQ-------GQQERQRTQLVIDLLEQE-
A0A286RLF2      NIITVE----YRSKDPGVAARIVGAVVQSYLDFM-------RSTTQGTTAEIIRILTTE-
A0A5C5ZM48      ELFRLS----MESTDPQAAKDVINALARSYLDFR-------SKQESETKRRVIALLQQQ-
A0A5B9WF77      NFIKIS----LESTNPQEAADTVNAVALAYKLAT-------QPDDTQLVPPAITGLRKDT
A0A518BBX8      NVLEVS----FSGKLPEESRLILAAVIDSYRDFL-------DETYKNITDETATLMTQA-
A0A518ALT3      ELYEVA----YTSSSADDAATVANYVVAEYMTVE-------NDETDKRTNMVINTLREE-
A0A517MDV3      AYAPLTFVAEFRHNDAADCALVLSAITESYQDFM-------AATLQDANSEATGLIQQA-
A0A3M1QRP3      SILEIA----VTLPDSYDSAVVANAIADEYLRAV-------REDEQEDSESLAAERRRQ-
A0A517TMV0      NIIRLG----YESLDPETAAAVVRAVLDSYLDFV-------SESHRGAAADFLDKLIVQ-
A0A2E3RCU8      TVLNIS----ATSTQPKNAVAMVNAVIQSYLQFV-------DQTHQGTATKIIQVMTRE-
A0A3E0MY88      NIIHVR----YQSKDPDAAEAVLNSLLTSYKNFI-------KSTHGRTAEDVMEVLQQE-
A0A1C3E6N1      NVLELT----CRSRDPKAAAAILYAVLSASIDFL-------NKNHQGTSQEILQILSKE-
A0A518GJT2      NVLELT----CRSRDPKAAAAILYAVLSASIDFL-------NKNHQGTSQEILQILSKE-
A0A286RD13      EILEIS----MTGGDPEQIAAIVNAVKDAYMSEV-------GDVSRNYALERKKLLEAN-
A0A517MLW3      NVIELS----YRSASPKAAEVVLDVLVQSYLDFM-------QQHHQDTSVTVLELLKGE-
A0A5B9QVD0      NVVELS----YKSGSPEAAKAVLDTLVDAYLAFM-------QQHHQDTSIQVLELLQAE-
A0A3B8PNV4      NLIDVR----YRSRDPQVAATVVNHIVESYLTLM-------QGIHKNNAGNDIQFMTAE-
A0A3D1DR40      NLIDVR----YRSRDPQVAATVVNHIVESYLTLM-------QGIHKNNAGNDIQFMTAE-
A0A2E7RYU8      NLIDVR----YRSRDPQVAATVVNHIVESYLTLM-------RGIHKNNAGNDIQFMTAE-
A0A3B8LXG8      NLIDVR----YRSRDPQVAATVVNHIVESYLTLM-------QGIHKNNAGNDIQFMTAE-
A0A350CI62      NVMDIS----YRSRDPRAAAAMLTAMLAGYEQFL-------NETNRGLSEQGLKTLATR-
A0A4P5WQK6      NVMDIS----YRSRDPRAAAAMLTAMLAGYEQFL-------NETNRGLSEQGLKTLATR-
A0A3C1X4W5      NVMDIS----YRSRDPRAAAAMLTAMLAGYERWL-------NETNQGLSEQGLKTLGTR-
A0A3D3W3A7      NVMDIS----YRSRDPRAAAAMLTAMLAGYERWL-------NETNQGLSEQGLKTLGTR-
A0A518DRX3      NLIELS----YRAKSPEAATAVVAAILSSYLDFM-------DKNHKDVSLEIVTILDQE-
A0A518DZF9      NLIELS----YRAKSPEAATAVVAAILSSYLDFM-------DKNHKDVSLEIVTILDQE-
F0SI78          DILLFT----FTCGHPKDAQKVLEAVIASYFAFL-------DESQRTASNRTVDLIKEA-
A0A518IQ30      SIIELS----YRSKSTPAAQAVLQAVVESYLEFI-------DTSHKDVSVEIATILKDE-
A0A517LWP4      SIIELS----YRSKSTLAARAVLEAVVESYLEFI-------DTSHKDVSVEIATILKDE-
A0A518JNW8      SIIELS----YRSKSTLAARAVLEAVVESYLEFI-------DTSHKDVSVEIATILKDE-
A0A2E7ENQ5      NFIEVS----YRSRDDEAAVAILDAVVESYLDFI-------DLNQKNVATEIVRILDKG-
A0A1G3AQE9      NIITAS----YRSRDPDAAVSVVSAVVACYLKFT-------DSTLKGQAGEVFDVLSQE-
A0A3L7UQT9      TLIDVR----YRSRSPKVAAFIVQRIVTEYINNI-------NRTYGNQTQDAVAKLTEE-
A0A4P5YBU2      TLIDVR----YRSRSPKVAAFIVQRIVTEYINNI-------NRTYGNQTQDAVAKLTEE-
A0A518AKT8      SFVEVR----YRSLDPDAAAAVVSEVVNSYLSFV-------DQTHKGSAGDTIEMLDGR-
A0A5C5ZR72      ELYEVA----YTSPSAKESADVVRAVLQQYFARQ-------SDEEYQRAQRVIDLLERE-
A0A517TY85      ELFEVA----FHSRSPDDAATVVNAVVMTYLEKN-------REKETDRSKLVISELEKE-
A0A5B9QEI7      ELYEVS----FVSPSSQDAASVANVVVAEYLALQ-------NREERQRSQMVIEVLEKE-
A0A5S9IJB5      FIVRVS----FKWTDPRLPPRVVDFLQKAYIQQD-------RERRVGLSGTGIDILYRK-
A0A1G2XVR0      DIISIS----FTGTHPETLAKMCNMHAKKFLETH-------LELRFAASQDAVKWLQDQ-
A0A1G3B0P0      DIISIS----FTGTHPETLAKMCNMHAKKFLETH-------LELRFAASQDAVKWLQDQ-
A0A1E3X4X0      GVVNVS----FSGNYPDIITDILNAHVKFYKDQE-------LERRFLASQDAVEWIDGR-
A0A286U4B3      QLVKIK----VSTGYPELCKKIADTIADEYIKKN-------LEDKVLTTSGATDEIVEQ-
A0A5C6DDS2      QLVKLK----AETGSPGLCVSIVDTLADEYIKKN-------LEDKVLTTTGATGEIGKQ-
A0A0S8J591      HHVEIW----VLWPDPKMAARMVNAVTDAYTDIL-------KEWRSSAFDASVRALLNR-
A0A2E3GW02      DILLFT----FTCGHPKDAQKVLEAVIASYFAFL-------DESQRTASNRTVELIKEA-
A0A1U9NL64      -ILSVS----FDSPYPAEAAHVVNEIIDSYITYH-------SQRKRSTSAEVLKILQKE-
A0A5B9QNZ7      LTFVAE----FRHGQAADCATVLTAITESYQDFM-------AETLQDANSEATGLIQQA-
A0A1U7CZ81      VHIQVS----FDSTDAHEAAAIVNAVVASYLRSY-------KDVQQSRDESHLKRLTVY-
A0A142YNY8      EFVHVS----LESTNPEEAAAIVNAVVASYLQAQ-------NELTEGADGLMKKSLEDY-
A0A1U7GLS6      NYVVVS----LELNDPEEAALIVNAVVAAYLRNY-------KDYKAGADKILRANLKTY-
A0A1Z8N7H5      TVLNIS----YTSTKPQNAVAIVTAVIKSYLQFV-------DETHKGTAAKIINVMTQE-
A0A1G2YPI3      -IISIS----YDSPYPNEAAQLVNTVIDSYITYH-------ATQKRSTSSEILKILRAD-
A0A532UIN2      -IISLS----FNSPYPAEAAQLINEAVDSYITYH-------ATRKRSTSAEVLKILQSE-
A0A532UD06      -IITVS----FDSPYPQEAAQLVNAMVDSYVRYH-------SARQKSTVSEVLRIIEKE-
A0A660URN1      -IIKVS----FDSPYPAEAAQIVNAVVNSYVDYH-------SSRKRSTVSEVLKILQKE-
A0A0S8KNX5      ELIRIT----VLHPDREQARQIVDAFINAYTAVE-------VSASVEDEDKKLTILENE-
A0A3D3UVZ8      ELINIT----MRSANEEEAKQIVDAFIKAYMEIE-------VVSADEDENRQLAILENR-
E8R3W3          -LMMVS----IPTPYPEEASTLTNTLVNSYLRFA-------NVLEMDRKMDEFSQLRDS-
A0A517NFU9      MVLRAS----YRDTNPEDAAIVLSAIYDSYRDYV-------ESHGHNSTEQAVELMEKA-
A0A5C5YWH4      MVLRAA----YRDSSPEDAALVLSTIYDSYRDYV-------ESHGHDSTEQAVELIQQA-
A0A3D2TNK4      SFIEVT----YRSKDPKTAAAVVRAIIRAYLAFV-------EKHHKGTAGEIIADLTNE-
A0A0J1B4A0      SVLKAT----YQDPDPEVAAAALQAIFDSYQDYI-------DEQTSSVGNEAAELIARA-
A0A142WSB9      AIIEVA----YESADKAVAKTVVEAIVKAYEDWL-------GQTKDKNSADLYAALQGS-
M5SZR3          NILHVS----FEGEVPEECPVIIRGILNTYQDYL-------EETYDTMSTDTVQLISEA-
M5TW92          NILHVS----FEGEVPEECPVIIRGILNTYQDYL-------EETYDTMSTDTVQLISEA-
A0A2S8FKY2      EILQVS----MMSKDPTSAPKIVNAVVSAYKDEV-------IETERLARVTRLENLERV-
A0A517N8P6      TIVEVS----FESGDPTVATAIVNAVVDAYDKSI-------NGRHQGNIENVVGFFRDS-
A0A432MJP4      SVLRID----YRARTKEEAVLLTDALIRSFEAFL-------EESYQSNNTKVVTLITEA-
M5UQ35          NMLTAT----FQDEDPEMAAKILQAVYESYFSYI-------DNQSRAIGSEAADLIANA-
A0A5C5WTY6      RSLTVT----FDHSDPVVAQQVLQAVIDQYLQTL-------SQKVDEILERSHRVVLDT-
A0A5C5Y033      AIMNIT----LQHNSPEDVQKILAAIMRRYERFI-------VSQVESVMGEAGRMIQDA-
A0A5C6G1Y2      AIMNIT----LQHNSPEDVQKILAAIMRRYERFI-------VSQVESVMGEAGRMIQDA-
A0A354PDV6      RSLSLA----FAHTDPEESRKILESVLVEYQNYI-------AGQLESVMSKANEYITHA-
A0A5C6FZ02      RTLRIS----LNHTEPEDAQRLLTAVLQTYSRYL-------DQQISDMMDLATAKINEA-
M5TIT3          RSLSVS----FEHTNPEDAQVLLTAVMKRYEQFI-------IAQVEQLMGKANEMIHEA-
A0A5M6CY44      RTLNIS----FSHPDPEDARLILTAVMKQYEKFI-------VAQVEQVMGRANELVQKA-
F2AXG2          RTLNIT----FTHTDPDDAKRILTAVMSRYQQFL-------IDQIDQVMSHADKMVQEA-
M2BB46          RTLNIT----FTHTDPDDAKRILTAVMSRYQQFL-------IDQIDQVMGHANDMVTEA-
L7CLQ6          RSLNIT----FTHTEPDDAKLILTAVMKRYEQFI-------KDQIEQVMGQANNLVEQA-
A0A0J1B719      RSLNIT----FTHTDPDDAKLILTAVMKRYEQFI-------IDQVEQVMGRANEMVNKA-
Q7UF18          RSLNIT----FTHTEPDDAKRILTAVMKRYEQFI-------IDQVEQVMGRANEMVNKA-
A0A2G1W1E0      RSLNIT----FTHTEPDDAKLILTAVMKRYEQFI-------IDQVEQVMGRANEMVNKA-
K5E235          RSLNIT----FTHTEPDDAKRILTAVMKRYEQFI-------IDQVEQVMGRANQMVNKA-
A0A5C6FFI9      MVLSAT----FRDPNPDDAATILAAIYGSYERYV-------ESHTQDTSREAAELIDAA-
A0A3A0DET7      DIINVS----AELPNAADAAQLVNSIVDAYVSKY-------AEQRKTNTVEVLTILRNE-
A0A5C5WDJ1      MVLRVT----YRANDPEEAAMVLSSIYNSYKTYI-------DSQDQDKSKLAVELIDAA-
A0A5C5X547      ELLNVS----FRDPDPQAAMAIANAVVKNYYDKY-------VKADEQKDNKRLADLQLL-
A0A2A2W9R6      SILRAT----YRDSDPETAAKVLQAIFDSYQLYI-------DGQSRDVGAEAVELIAKA-
A0A518HKC1      SILRAT----YRDGDPETAAKVLQAVFDSYQLYV-------DGQSHDVGAEAVELIAKA-
A0A518L3P0      SILRAT----YRDGDPEVAAKVLQAIFDSYQLYI-------DGQSHDVGAEAVELIAKA-
A0A255R1S0      SILRAT----YQDGNPEVAAKVLEAVFETYFDYV-------ETRSQSVGSEAAELIANA-
A0A5B9MKP1      SLLKAT----YKDEDPEVAARVLQAIFDTYQNYV-------EGHSENVGAEAAELIAKA-
A0A0S8FY64      NLVDIL----VRAPDANVASLVANLVAQAYVDYS-------VAARQQSAGEAFEMLQRQ-
A0A1N6KFT7      KIIVLQ----YQSASTQESLQMIHAIVASYKKLL-------ETNYQKNNQEVITLVSRA-
L0DFG4          KIIVVQ----YQSASPQESLDMIRAVVASYKKLL-------ETNYQKNNQEVITLVSRA-
A0A5C5XXG1      GLASSS----SSE-------MVEEDILANHIELL-------LSR------KIVGEAMAA-
A0A518BJJ1      GVIALT----VDDSDPERAAAVANALCHNYFDLN-------VERGRKRASQTVGFIQSQ-
A0A518D182      GVLELT----VSDSDPLRAAAKANALCLNYFDLK-------VERSRRRASQSIGFIEDQ-
A0A353FIP5      GVLQIT----YKDTDPDRAAQVVNNLISSYAERS-------RERLALPAEKTVTYIEGQ-
A0A5B1CIK7      RSLKVL----FDHTDAEDTQLVLTAILKRYEEFI-------ISQVEQVVGQANQMVNQA-
A0A5C5WHS2      RSLNIA----LTHTDPEDTQLILTAVLKRYEQFI-------INQVEQVMGRANEMVNKA-
A0A5C6B6G8      RSLNVS----FKHTEPDDAQLVLTAVMKRYEQFI-------IDQVEQVMGRANELVQTA-
A0A5C5ZZN3      RSLSVT----FTHTEPDDAQIILTAVMKRYEQFI-------IAQVEQLMGRANEMVNEA-
A0A5C5XS91      RSLRVT----MTHTDPDDAQLILTAVMKRYEQFI-------IAQVEQLMGRANEMVNEA-
A0A5C6C4E6      RSLRVT----LTHTDADDAQLILTAVMKRYEQFI-------IAQVEQLMGRANEMVNEA-
A0A2E1VVJ1      GVLQIT----YSDTSPSRAQRFVNRLAEMYVAYK-------HDRLAAQAGATEAFVSKE-
A0A3M2AEL0      NVLRLS----YFDTDPERAAQVANALLRAYIEHN-------KSRLSRQASSTVQFIKDE-
A0A532UT69      DIISVS----FSSPYPDEAVEIVNAAVDSYKAHY-------VSRKRNTSAEVLKIIQSE-
A0A2D5AWU0      DRLSIA----YLSPFPDEAAKIARATVEEYIAYH-------KRKKRESAEESAAIIRGE-
M5RT57          ELYNIS----LATSDPESSAKLVNAILDTYFAVR-------AKDNEDQTARVLELLGQE-
A0A356KTN1      YLVDVS----YESTDPKRCDRYANAVAEAYREQLQTLWGEKTQIAEKKVSEQADLLYQK-
A0A518HFS8      EILTIS----MSGGNPEAVATVVNAVTEAYLEQI-------VRQEEQERVERLERLEQL-
                                                                            

A0A5S9IPR9      ------------VPNLEKKIREKRDILIKL--------QQEYPE----------------
A0A533Q9U4      ------------LKDVKIALEESEAALQRY--------KRENDL----------------
A0A1U9NNE1      ------------RASTAKQMQQQRKIIRQL--------AEEFGT----------------
A0A2G2JCA2      ------------KNSRESGLKDLRGVVKTLAIETT---GKDPYV----------------
A0A533Q6B7      ------------MENVKDAVEQSELALQKY--------KKENNI----------------
A0A351FYP6      ------------MKKTNDEITAMQANVDDL--------RAKLGI----------------
A0A2E7ESJ6      ------------KDDLLKKWQMLEREYGEF--------KASTPL----------------
A0A1G2YQB7      ------------RRVMGEKIERQRKTLNDM--------AQEFGT----------------
A0A353P687      ------------RRVMAEKIERQRKTLNDM--------AQEFGS----------------
A0A356EME5      ------------IANRKKHVEEKRRQIQTR--------T---------------------
A0A355AI52      ------------KEEVDKKIQVKQEEFLAV--------RKKVGD----------------
A0A3L7SI46      ------------KAQSEVAIRNKETDLLGL--------KRDSGI----------------
A0A3L7P4E4      ------------KEEWLTTLRKCEDEYAEF--------RKSSS-----------------
A0A3L7PEB5      ------------KDEWTTNLRKLEAEYAEF--------RKTTS-----------------
A0A2N1UCJ3      ------------KITRDQELSANFKELLEF--------TRQYGV----------------
A0A517ZCB5      ------------KDALERDLKAREAELIEM--------KSRSQL----------------
A0A432MFP3      ------------EKELGDKVEAQQKKLIEL--------FKEAEDPRRMLGNLAAMDGGVA
D5SZ21          ------------KVELEQKLATREAELIEL--------RGRSLT----------------
A0A518CHE5      ------------QTKMENQYQENANQLIEL--------QRRSDL----------------
A0A257WS34      ------------KRDLESQLTQKEQQLHGL--------KSQVGL----------------
A0A2E8FLY0      ------------KKKLDEETNQINAELLNL--------KRQMQI----------------
A0A3D2U1E1      ------------REKLDEETNAINAELLVL--------KRQMQI----------------
A0A1P8WP26      ------------FAEVTKELQELQAYRDEL--------TKRSPD----------------
A0A3L7V1F3      ------------LKDDNERLTLAEAERLRL--------RNSAPE----------------
A0A5B9QF68      ------------GAELEAKLTEKQNELQSF--------SQAVGH----------------
A0A5B9QGF0      ------------GAELEAKLTEKQNELQSF--------SQEVGH----------------
A0A5C6CK24      ------------GAELEAKLTEKQNELQDF--------SQQVGH----------------
A0A2E8B0L9      ------------RVAKEQELQAKQQEMLSL--------KRAVGA----------------
A0A5Q4GFE7      ------------RLEIEGRLSTKQEEILDV--------QRRLRD----------------
A0A2E3GWX1      ------------RKKVEQQMTDKQNELLRL--------RAESDS----------------
F0SG60          ------------RKKVEQQMTDKQNELLRL--------RAESDS----------------
A0A2E9VST2      ------------RDNIQKQIFEKQAELLNL--------QRDSDS----------------
A0A356A6X2      ------------RDNIQNQILVKQSELLDL--------QRESDS----------------
A0A5C5XLM3      ------------RDNIQNQILVKQSELLDL--------QRESDS----------------
A0A3M1VCL4      ------------QRQLEEEIRSKESQLAAL--------RSASEE----------------
A0A5C5V7Z9      ------------RDQLQEELLQKQRLLQAC--------RERCGH----------------
A0A5C5YT05      ------------RDQLQSELLRKQKLLQEA--------RERCGH----------------
A0A518D7F9      ------------HAQLVEELDAKQRELQQV--------RNEVGR----------------
A0A5C5ZIP0      ------------RDQIEQDLIVKQQLLQEF--------RQRIGH----------------
A0A518KBK3      ------------RDQLEQSLAAKQLELQQS--------RERVGH----------------
A0A5C6AKF9      ------------GTKLKQELSAKQLELQQT--------REQVGH----------------
A0A2E0X4J3      ------------KRDRQAELDAAQTALDDF--------RNAHPE----------------
A0A5C5YU10      ------------KQRRDKVLIEARRELTAF--------REANPE----------------
A0A517MPZ6      ------------KQRRDAELEQRIEALEKF--------RGQNAA----------------
A0A5C6CNV7      ------------KQRRDAELEARRQELIEF--------RQQNAA----------------
A0A518K5H4      ------------KQRSDQDLEERRQALDEF--------RRDHVT----------------
A0A5C6AA28      ------------KQRRDDELESRRKALESF--------RQEHVS----------------
A0A2E9VK20      ------------NNDLSPRLAAKTKEYHEFRRNAPLVWKAPAGA----------------
A0A3D4PJK1      ------------NNDLSPRLAAKTKEYHEFRRNAPLVWKAPAGA----------------
A0A0S8GZ23      ------------KLELENKLKNHLQELRKI-------------N----------------
L0DC26          ------------WNRYQESLREKRKQLKRL--------TELAGS----------------
A0A354PCQ3      ------------IQRWEQEVAERRRVVQKL--------SEQTLG----------------
A0A1I3DDV4      ------------QGKIESDLKSLEEQYVQA--------RQSAPI----------------
A0A2E2N5A9      ------------LEELRQKLQESENRLQAY--------RESEGL----------------
A0A2E3GWC6      ------------NNDLTPRLNAKTEEYQRFRDEAPLLWKAPPGA----------------
F0SLB0          ------------NNDLTPRLNAKTEEYQRFRDEAPLLWKAPPGA----------------
A0A2E0SMM6      ------------QANLIAQYKQNATDLIEL---------QRRSD----------------
A0A1N6DAJ8      ------------WNRYQENLREKRKELKRL--------TELAGS----------------
A0A5B9PJZ8      ------------NENMLSRTKEVQEEIEKL--------MGLPEM----------------
A0A2S8G191      ------------YSETENELRSKRSEFRRL--------ADTLGT----------------
A0A2E7EGG1      ------------RARRSEEIKLLQAEVRQLQKQLVANDPSLTST----------------
A0A225EH48      ------------LETLNRLIKSREDRLKDW----------VKLG----------------
A0A3L7NDH9      ------------KTDVDLRLQKTEAEFLVI--------RQRVGD----------------
A0A518INW8      ------------QLTNEQELQQATQAYTNF--------LSTSVG----------------
A0A518JPH9      ------------QATNEQELQDATQAYTAF--------LATSVG----------------
A0A2E2CCW9      ------------EKQIAAELELKKNEYKKFRENAPLYWESTPGS----------------
A0A3C0AGX3      ------------EKQIAAELELKKNEYKKFRENAPLYWESTPGS----------------
A0A518AAQ5      ------------NKSLLAELERKKKEYTEFRKDAPLYWESTPGS----------------
A0A517QBG9      ------------NKSLLAELERKKKEYTEFRKDAPLYWESTPGS----------------
A0A518FTU3      ------------NKSLLAELERKKKEYTEFRKDSPLYWESTPGS----------------
A0A2E7K7A9      ------------NESILSDLEKKKQEYKEFRKDAPLYWENTPGS----------------
A0A517PTS5      ------------NESILSDLEKKKQEYKEFRKDAPLYWENTPGS----------------
A0A517WHH5      ------------NKALLTELEQKKKEYKEFRKDAPLYWESTPGS----------------
A0A5A8BGT3      ------------NKALLTELEQKKKEYKEFRKDAPLYWESTPGS----------------
A0A517VTK3      ------------NKQILNDLERKKKEYREFREDAPLYWENTPGS----------------
A0A517WQT4      ------------NKQILTDLERKKKEYREFREDAPLYWENTPGS----------------
A0A517VID8      ------------EQQIATELELKRNEYQKFRENAPLYWESTPGS----------------
A0A517RK10      ------------NQQISTDLEQKKKEYKEFREKAPLYWENTPGS----------------
A0A518IH18      ------------NQQILSDLEQKKKEYKEFREKAPLYWEHTPGS----------------
A0A5C5VEK8      ------------QERRDAALAEARQDLTAF--------REANPE----------------
A0A532UTJ0      ------------RKGLYEKIDNERKTIYQL--------GQEYGD----------------
A0A517NSK8      ------------ANDTADEVREAEQNLTKH--------LASSKV----------------
A0A5C5Z0D6      ------------SDKTAQDVKDAEEAFASH--------VASSTL----------------
M5UE94          ------------SEETAQEVRDAERKLAEH--------LAGSQI----------------
A0A1P8WN28      ------------GETVLKGLLAKENELLEA--------RQNCGD----------------
A0A3B9CTT0      ------------RRGVETKLIEKNKELLEE--------RRDCGD----------------
A0A5C5XLF4      ------------NNDLSPRLAAKTKEYHEFRRSAPLVWKAPAGA----------------
A0A2D5NDU9      ------------RKRYEVEYDTALRALDEY--------CKKHPA----------------
A0A286RGB6      ------------YSEKEADVRKLENDLKSL--------SQQLET----------------
A0A1V5N3W2      ------------RKAIQDKIQRQQETIRKM--------GEEYGT----------------
A0A3E0MY27      ------------HQELEADIGRRRKRYNDM--------VAEVDV----------------
A0A2E0X9P6      ------------RHARSSRLEQLRRRVVEL--------SREVTG----------------
A0A286RLF2      ------------KDDIAARLSEKEQALQQL--------SQQIGA----------------
A0A5C5ZM48      ------------KEKYFEDIKRLRGNLVTV--ADQATKNDPYGG----------------
A0A5B9WF77      AQAEVAALEEYRKKEIDSKIKMKKDALLKLAKNGGVQFKKDANA----------------
A0A518BBX8      ------------RDVLRKELRDKEEGYREF--------RLESPL----------------
A0A518ALT3      ------------LKDREGHIEQLRTRVVDLAKD--VTGRDPFGQ----------------
A0A517MDV3      ------------RDDLTLEIDQLEQSYREF--------RRGTPL----------------
A0A3M1QRP3      ------------EELLRKQIEIKEEEVDAL------------------------------
A0A517TMV0      ------------REKFETELANKQVQLLQI--------RERIGH----------------
A0A2E3RCU8      ------------KDNLARQLSAEEVKLADA--------RLAAGD----------------
A0A3E0MY88      ------------KIQLKGEIDRKKERLLEA--------QRRFGD----------------
A0A1C3E6N1      ------------KVELEQKLATREAELIEL--------RGRSLT----------------
A0A518GJT2      ------------KVELEQKLTTREAELIEL--------RGRSLT----------------
A0A286RD13      ------------YAQTLELVKKRDQRYREL------------------------------
A0A517MLW3      ------------REKIEETLHLEQQRLIKL--------RDEAHV----------------
A0A5B9QVD0      ------------RTKVEKRLGEQQEKLVEL--------RDETRV----------------
A0A3B8PNV4      ------------KKKLDEETNRINSELLDL---------KRQMQ----------------
A0A3D1DR40      ------------KKKLDEETNRINSELLDL---------KRQMQ----------------
A0A2E7RYU8      ------------KKKLDEETNRINSELLDL---------KRQMQ----------------
A0A3B8LXG8      ------------KKKLDEETNRINSELLDL---------KRQMQ----------------
A0A350CI62      ------------LEAIEQEVKELQSRRLHL--------KASAPE----------------
A0A4P5WQK6      ------------LEAIEQEVKELQSRRLHL--------KASAPE----------------
A0A3C1X4W5      ------------LEVIEQEVKSLQARRLQL--------KASAPE----------------
A0A3D3W3A7      ------------LEVIEQEVKSLQARRLQL--------KASAPE----------------
A0A518DRX3      ------------RKQVEETLAEKQDQMLDL--------QHRVGD----------------
A0A518DZF9      ------------RKQVEETLAEKQDQMLDL--------QHRVGD----------------
F0SI78          ------------KDDLTESLTKKETAYQQF--------REDSAL----------------
A0A518IQ30      ------------LREKERDLKAKQEEWVQV--------SRDAGD----------------
A0A517LWP4      ------------LREKERNLKAKQEEWVTV--------SRDAGD----------------
A0A518JNW8      ------------LREKERDLKAKQEEWVTV--------SREAGD----------------
A0A2E7ENQ5      ------------RSDVASQLDAKEQELLVA--------QRETGD----------------
A0A1G3AQE9      ------------KNTLGVELSHKEQERLAL--------RQQCGV----------------
A0A3L7UQT9      ------------KKETSRKLTEKNQEFLEL--------QSQTGN----------------
A0A4P5YBU2      ------------KKETSRKLTEKNQEFLEL--------QSQTGN----------------
A0A518AKT8      ------------LKQVQTDIQDKQRQLIEL--------RDRVGH----------------
A0A5C5ZR72      ------------RARRQFEVERLRKHVIDLAKD--LTGMDPFGH----------------
A0A517TY85      ------------SADRSMRVELLRKEVIALARK--LTGTDPFQP----------------
A0A5B9QEI7      ------------RLERGTKVDQLRKRVVELAKD--LTGKDPFGQ----------------
A0A5S9IJB5      ------------EGELRAELETFANQIQDY--------VLKNKL----------------
A0A1G2XVR0      ------------LVDKKLKVEEAEEALILY--------KEKQNI----------------
A0A1G3B0P0      ------------LVDKKLKVEEAEEALILY--------KEKQNI----------------
A0A1E3X4X0      ------------LKDLGKDLEKDEEELQKY--------KEDEDL----------------
A0A286U4B3      ------------LKEIKIKIEDSEKKLYKY--------ARENDI----------------
A0A5C6DDS2      ------------LKEIKKRIEDSEKELYKY--------ARQNDI----------------
A0A0S8J591      ------------AQDIKREQDKASRAVQDF--------SAEREI----------------
A0A2E3GW02      ------------KDDLTESLTKKETAYQQF--------REDSAL----------------
A0A1U9NL64      ------------KTKRAKELEENLHAMMNF--------KRENEG----------------
A0A5B9QNZ7      ------------RDDMSLEIDQLENTYREF--------RRSTPL----------------
A0A1U7CZ81      ------------LDRLKKDKEEKVEALKEI--------VERGNV----------------
A0A142YNY8      ------------LKKMIDDKKEKVKELSTL--------MSKGKV----------------
A0A1U7GLS6      ------------LDEKQKERKQKEKDLAAL--------VDSG-V----------------
A0A1Z8N7H5      ------------KDDIGRQLMEEETKLADA--------RVASGD----------------
A0A1G2YPI3      ------------KTKRDKELSETLKKLLDF--------QNDNPD----------------
A0A532UIN2      ------------KTKRGKELTEKLTTMLDF--------KKENEA----------------
A0A532UD06      ------------KVRRDEELSGKFSELLAF--------TRENGV----------------
A0A660URN1      ------------KVKRDAQLTEKFQQLVQF--------TKENGI----------------
A0A0S8KNX5      ------------RKLLAEKMESQRQAIYRL--------GQEYGT----------------
A0A3D3UVZ8      ------------RDYLYEKIENDRQTIYQL--------GQEYGT----------------
E8R3W3          ------------YVKFNESLNTKRKELQKL--------AEQ-------------------
A0A517NFU9      ------------RETHELELATADREYREF--------VTSVPV----------------
A0A5C5YWH4      ------------RQTHEEELAAADIAYREF--------VKSVPV----------------
A0A3D2TNK4      ------------RNQIQASLKSKQLQLQKF--------RQEVGH----------------
A0A0J1B4A0      ------------QVQNEKALREADQAYREF--------VASVPA----------------
A0A142WSB9      ------------RTALIDDISKMEAAWKAW--------RDASPY----------------
M5SZR3          ------------RDLLLRDIRKQEFEYREF--------RRESPL----------------
M5TW92          ------------RDLLLRDIRKQEFEYREF--------RRESPL----------------
A0A2S8FKY2      ------------HSETENKARQMRSDFKQL--------AETLGT----------------
A0A517N8P6      ------------RDSIIPKLDELENEFTEF--------RANAPL----------------
A0A432MJP4      ------------RDLISKELVDLEQKYLEI--------RKKNTV----------------
M5UQ35          ------------QLKNEETLRRADKAYREF--------LASMPA----------------
A0A5C5WTY6      ------------QQQLAAKIGELEQRQKLA--------RDQAPI----------------
A0A5C5Y033      ------------KRALEADLQAAEEEYLVS--------RQNAPL----------------
A0A5C6G1Y2      ------------KRALEADLQEAEEEYLVS--------RQNAPL----------------
A0A354PDV6      ------------KDEVESELRNAEQDYLTA--------RKAAPM----------------
A0A5C6FZ02      ------------KNEVEGELHVAEKKYLEH--------RQTAPM----------------
M5TIT3          ------------KQEVESELLASEQEHLKA--------RQNAPL----------------
A0A5M6CY44      ------------KSDVEESLATAEQEQLKA--------RQEAPL----------------
F2AXG2          ------------KSVVQKNLKEAEDEYLAA--------RRKAPL----------------
M2BB46          ------------KSKVEKSLEDAENEYLAA--------RQKAPL----------------
L7CLQ6          ------------KTDVQGKLTNLEAEHLKF--------RRDAPL----------------
A0A0J1B719      ------------KTEVETDLIAAEQEHLKA--------RQEAPL----------------
Q7UF18          ------------KTEVEAELVAAEQEHLKA--------RQEAPL----------------
A0A2G1W1E0      ------------KTEVEAELVAAEQEHLKA--------RQEAPL----------------
K5E235          ------------KTEVEAELVAAEQEHLKA--------RQEAPL----------------
A0A5C6FFI9      ------------RIENEKELDAADREYREF--------ISSVPV----------------
A0A3A0DET7      ------------KHKRDAELAECRKALDDF--------RQQHME----------------
A0A5C5WDJ1      ------------RETHEKELRDADEDYRNY--------VASVPV----------------
A0A5C5X547      ------------YQEKTKELKAARTRLVDL--------AETAGS----------------
A0A2A2W9R6      ------------QVQNEIALQKADQEYRDF--------VASVPA----------------
A0A518HKC1      ------------QVQNEIALQEADQAYRDF--------VASVPA----------------
A0A518L3P0      ------------QDQNEVALQKADQEYRDF--------VASVPA----------------
A0A255R1S0      ------------QAKNEEELRAADKAYRDF--------VASVPA----------------
A0A5B9MKP1      ------------QLRNEMDLRKADEEYRNF--------VASVPA----------------
A0A0S8FY64      ------------MKEQEKALVKAEDDLLTY--------REQTTI----------------
A0A1N6KFT7      ------------RDDLKKELDLLQAEYHKF--------RKDNPG----------------
L0DFG4          ------------RDELKSELDTLQDEYHKF--------RKNNPG----------------
A0A5C5XXG1      ------------QDDDGNSLMTLPSVVEHL--------DPE-------------------
A0A518BJJ1      ------------LDEQLAALETAEHEVVDL--------QAENLD----------------
A0A518D182      ------------LDEQTAALETAEADVVAL--------RKQYPD----------------
A0A353FIP5      ------------VERIQLELAEAEAELVA-------------------------------
A0A5B1CIK7      ------------KNEVETELVAAEQEYLTA--------RQNAPL----------------
A0A5C5WHS2      ------------KTEVETDLVAAEQEYLTA--------RQEAPL----------------
A0A5C6B6G8      ------------KSEVEAELNAAEQEHLAS--------RKAAPL----------------
A0A5C5ZZN3      ------------KQEVESELLAAEQEHLQS--------RQNAPL----------------
A0A5C5XS91      ------------KQDIEADLVAAEQEHMKS--------RQSAPL----------------
A0A5C6C4E6      ------------KQDIEADLIAAEQEHLKS--------RQDAPL----------------
A0A2E1VVJ1      ------------IERIQGELDAAEDEIVK-------------------------------
A0A3M2AEL0      ------------IERVRRELEDAEQELVS-------------------------------
A0A532UT69      ------------KTKRTQELSEKLKTMTDF--------KKANEA----------------
A0A2D5AWU0      ------------LGSILKVRDDLTE---KI--------IRLRTE----------------
M5RT57          ------------KQARSVEIQNLRE---KM--------RQLGQD----------------
A0A356KTN1      ------------LTKSEQDLR-------DF--------LNQSAE----------------
A0A518HFS8      ------------FEKYQEELRAKRE---DY--------REQAQS----------------
                                                                            

A0A5S9IPR9      -IR---------------------------------------------------------
A0A533Q9U4      -ISVEAVGSE--------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      -FGIEPVGSGESG-----------------------------------------------
A0A351FYP6      ---SDA------------------------------------------------------
A0A2E7ESJ6      -MYNGQ------------------------------------------------------
A0A1G2YQB7      -IVLDN------------------------------------------------------
A0A353P687      -VILDN------------------------------------------------------
A0A356EME5      -LAETG------------------------------------------------------
A0A355AI52      -LGIKE------------------------------------------------------
A0A3L7SI46      -LLHGN------------------------------------------------------
A0A3L7P4E4      -LIYNG------------------------------------------------------
A0A3L7PEB5      -LIYNG------------------------------------------------------
A0A2N1UCJ3      -ISFEK------------------------------------------------------
A0A517ZCB5      -LFASD------------------------------------------------------
A0A432MFP3      PAASGE------------------------------------------------------
D5SZ21          -FVSNG------------------------------------------------------
A0A518CHE5      -LLNSG------------------------------------------------------
A0A257WS34      -LLSGN------------------------------------------------------
A0A2E8FLY0      -ISGPD------------------------------------------------------
A0A3D2U1E1      -ISGPD------------------------------------------------------
A0A1P8WP26      -FVGVG------------------------------------------------------
A0A3L7V1F3      -LVETG------------------------------------------------------
A0A5B9QF68      -LAVSQ------------------------------------------------------
A0A5B9QGF0      -LAMSQ------------------------------------------------------
A0A5C6CK24      -LAVGQ------------------------------------------------------
A0A2E8B0L9      -LGTEG------------------------------------------------------
A0A5Q4GFE7      -LGLSG------------------------------------------------------
A0A2E3GWX1      -L-LGT------------------------------------------------------
F0SG60          -L-LGT------------------------------------------------------
A0A2E9VST2      -L-IGT------------------------------------------------------
A0A356A6X2      -L-IGT------------------------------------------------------
A0A5C5XLM3      -L-IGT------------------------------------------------------
A0A3M1VCL4      -IVTAD------------------------------------------------------
A0A5C5V7Z9      -LAIDQ------------------------------------------------------
A0A5C5YT05      -LAIDQ------------------------------------------------------
A0A518D7F9      -LVAAG------------------------------------------------------
A0A5C5ZIP0      -LALPK------------------------------------------------------
A0A518KBK3      -LSLPD------------------------------------------------------
A0A5C6AKF9      -LSLPD------------------------------------------------------
A0A2E0X4J3      -LAVQV------------------------------------------------------
A0A5C5YU10      -LAVLV------------------------------------------------------
A0A517MPZ6      -LAVQV------------------------------------------------------
A0A5C6CNV7      -LAVQV------------------------------------------------------
A0A518K5H4      -LAVQS------------------------------------------------------
A0A5C6AA28      -LAIQS------------------------------------------------------
A0A2E9VK20      -DKGPN------------------------------------------------------
A0A3D4PJK1      -DKGPN------------------------------------------------------
A0A0S8GZ23      -EKYGA------------------------------------------------------
L0DC26          -DDKTT------------------------------------------------------
A0A354PCQ3      -YAPGS------------------------------------------------------
A0A1I3DDV4      -IYVGN------------------------------------------------------
A0A2E2N5A9      -VDLQG------------------------------------------------------
A0A2E3GWC6      -DAAPG------------------------------------------------------
F0SLB0          -DAAPG------------------------------------------------------
A0A2E0SMM6      -LLLNN------------------------------------------------------
A0A1N6DAJ8      -DDKKT------------------------------------------------------
A0A5B9PJZ8      -LIVDG------------------------------------------------------
A0A2S8G191      -GDTAS------------------------------------------------------
A0A2E7EGG1      -SLIGS------------------------------------------------------
A0A225EH48      -QAPGE------------------------------------------------------
A0A3L7NDH9      -LGIKS------------------------------------------------------
A0A518INW8      -MFDGD------------------------------------------------------
A0A518JPH9      -MLDGE------------------------------------------------------
A0A2E2CCW9      -EAAVA------------------------------------------------------
A0A3C0AGX3      -EAAVA------------------------------------------------------
A0A518AAQ5      -EAAVA------------------------------------------------------
A0A517QBG9      -EAAVA------------------------------------------------------
A0A518FTU3      -EAAVA------------------------------------------------------
A0A2E7K7A9      -EAAVA------------------------------------------------------
A0A517PTS5      -EAAVA------------------------------------------------------
A0A517WHH5      -EAAVA------------------------------------------------------
A0A5A8BGT3      -EAAVA------------------------------------------------------
A0A517VTK3      -DAAVA------------------------------------------------------
A0A517WQT4      -DAAVA------------------------------------------------------
A0A517VID8      -EAAVA------------------------------------------------------
A0A517RK10      -EAAVA------------------------------------------------------
A0A518IH18      -EAAVA------------------------------------------------------
A0A5C5VEK8      -LSVQV------------------------------------------------------
A0A532UTJ0      -IVLEG------------------------------------------------------
A0A517NSK8      -MWDGS------------------------------------------------------
A0A5C5Z0D6      -MWDGQ------------------------------------------------------
M5UE94          -MWDGE------------------------------------------------------
A0A1P8WN28      -IALSK------------------------------------------------------
A0A3B9CTT0      -IVINK------------------------------------------------------
A0A5C5XLF4      -DKGPN------------------------------------------------------
A0A2D5NDU9      -MRLDM------------------------------------------------------
A0A286RGB6      -GDSQA------------------------------------------------------
A0A1V5N3W2      -IALTG------------------------------------------------------
A0A3E0MY27      -FDGGQ------------------------------------------------------
A0A2E0X9P6      -TDPFG------------------------------------------------------
A0A286RLF2      -LDVGV------------------------------------------------------
A0A5C5ZM48      -LMSGG------------------------------------------------------
A0A5B9WF77      -KGEPV------------------------------------------------------
A0A518BBX8      -LGRSS------------------------------------------------------
A0A518ALT3      -GAIVG------------------------------------------------------
A0A517MDV3      -LTLGP------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      -LALPD------------------------------------------------------
A0A2E3RCU8      -FSIDP------------------------------------------------------
A0A3E0MY88      -FTNGG------------------------------------------------------
A0A1C3E6N1      -FVSNG------------------------------------------------------
A0A518GJT2      -FVSNG------------------------------------------------------
A0A286RD13      ----AN------------------------------------------------------
A0A517MLW3      -VGFDN------------------------------------------------------
A0A5B9QVD0      -VAFDD------------------------------------------------------
A0A3B8PNV4      -IISGP------------------------------------------------------
A0A3D1DR40      -IISGP------------------------------------------------------
A0A2E7RYU8      -IISGP------------------------------------------------------
A0A3B8LXG8      -IISGP------------------------------------------------------
A0A350CI62      -LVDTG------------------------------------------------------
A0A4P5WQK6      -LVDTG------------------------------------------------------
A0A3C1X4W5      -LVDTG------------------------------------------------------
A0A3D3W3A7      -LVDTG------------------------------------------------------
A0A518DRX3      -LGMRE------------------------------------------------------
A0A518DZF9      -LGMRE------------------------------------------------------
F0SI78          -LWTSD------------------------------------------------------
A0A518IQ30      -LGLRS------------------------------------------------------
A0A517LWP4      -LGLRS------------------------------------------------------
A0A518JNW8      -LGLRS------------------------------------------------------
A0A2E7ENQ5      -LGLRN------------------------------------------------------
A0A1G3AQE9      -LRVGP------------------------------------------------------
A0A3L7UQT9      -IYDG-------------------------------------------------------
A0A4P5YBU2      -IYDG-------------------------------------------------------
A0A518AKT8      -LALGD------------------------------------------------------
A0A5C5ZR72      -RTMTN------------------------------------------------------
A0A517TY85      -GLVTD------------------------------------------------------
A0A5B9QEI7      -GVVTD------------------------------------------------------
A0A5S9IJB5      -I----------------------------------------------------------
A0A1G2XVR0      -VGLGE------------------------------------------------------
A0A1G3B0P0      -VGLGE------------------------------------------------------
A0A1E3X4X0      -ITLDNL-----------------------------------------------------
A0A286U4B3      -VAMDA------------------------------------------------------
A0A5C6DDS2      -VAMDA------------------------------------------------------
A0A0S8J591      -YALPEIR----------------------------------------------------
A0A2E3GW02      -LW---------------------------------------------------------
A0A1U9NL64      -LA---------------------------------------------------------
A0A5B9QNZ7      -LT---------------------------------------------------------
A0A1U7CZ81      -NGQSAGESKPKESTKTQGSDP-----APQ------------------------------
A0A142YNY8      -DSQSLTPNQASQANTAGPAAPADGTVQDS------------------------------
A0A1U7GLS6      -DARNVAQREPAPDR------------QGE------------------------------
A0A1Z8N7H5      -FSI--------------------------------------------------------
A0A1G2YPI3      -IV---------------------------------------------------------
A0A532UIN2      -L----------------------------------------------------------
A0A532UD06      -VS---------------------------------------------------------
A0A660URN1      -VS---------------------------------------------------------
A0A0S8KNX5      -V----------------------------------------------------------
A0A3D3UVZ8      -V----------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A517NFU9      -LI---------------------------------------------------------
A0A5C5YWH4      -LI---------------------------------------------------------
A0A3D2TNK4      -LAVS-------------------------------------------------------
A0A0J1B4A0      -LISSNI-----------------------------------------------------
A0A142WSB9      -FYPTPPVVTVN------------------------------------------------
M5SZR3          -LT---------------------------------------------------------
M5TW92          -LT---------------------------------------------------------
A0A2S8FKY2      -SDSETLSL---------------------------------------------------
A0A517N8P6      -EW---------------------------------------------------------
A0A432MJP4      -LA---------------------------------------------------------
M5UQ35          -LVDT-------------------------------------------------------
A0A5C5WTY6      -LF---------------------------------------------------------
A0A5C5Y033      -FF---------------------------------------------------------
A0A5C6G1Y2      -FF---------------------------------------------------------
A0A354PDV6      -LF---------------------------------------------------------
A0A5C6FZ02      -LF---------------------------------------------------------
M5TIT3          -FF---------------------------------------------------------
A0A5M6CY44      -FF---------------------------------------------------------
F2AXG2          -SF---------------------------------------------------------
M2BB46          -FF---------------------------------------------------------
L7CLQ6          -FF---------------------------------------------------------
A0A0J1B719      -FF---------------------------------------------------------
Q7UF18          -FF---------------------------------------------------------
A0A2G1W1E0      -FF---------------------------------------------------------
K5E235          -FF---------------------------------------------------------
A0A5C6FFI9      -LL---------------------------------------------------------
A0A3A0DET7      -LA---------------------------------------------------------
A0A5C5WDJ1      -LL---------------------------------------------------------
A0A5C5X547      -GSSESLTLNQQ------------------------------------------------
A0A2A2W9R6      -LLNV-------------------------------------------------------
A0A518HKC1      -LLNV-------------------------------------------------------
A0A518L3P0      -LLNV-------------------------------------------------------
A0A255R1S0      -LVLS-------------------------------------------------------
A0A5B9MKP1      -LVNV-------------------------------------------------------
A0A0S8FY64      -PEL--------------------------------------------------------
A0A1N6KFT7      -FAIGSNGQTLTMRKLEQWS---QGINNTTDLMIQL-KTQLELIKKMESSGSQGNAISLA
L0DFG4          -LAIGANGQTLMMRKLEQWS---QGINNTTDLMIQL-KTQLELIKKMESSGSQGNAIALA
A0A5C5XXG1      --IETVDAVDYVIDHMEVVKGGEGGAKTARTLRISLNHTEPEDAQRLLTAVLQTYSRYLD
A0A518BJJ1      -AIDSVATAESLIRNLSDLE--------VQRMRLDLQASSLSESLALLRGGDFDALGRIA
A0A518D182      -LIDLTTSAGRIVEQLSGFE--------VERLRLDLARHALEEALELTQAGDDRGLSQLS
A0A353FIP5      --F---------------------------------------------------------
A0A5B1CIK7      -FF---------------------------------------------------------
A0A5C5WHS2      -FF---------------------------------------------------------
A0A5C6B6G8      -FF---------------------------------------------------------
A0A5C5ZZN3      -FF---------------------------------------------------------
A0A5C5XS91      -FF---------------------------------------------------------
A0A5C6C4E6      -FF---------------------------------------------------------
A0A2E1VVJ1      --Y---------------------------------------------------------
A0A3M2AEL0      --Y---------------------------------------------------------
A0A532UT69      -LA---------------------------------------------------------
A0A2D5AWU0      -NN---------------------------------------------------------
M5RT57          -VV---------------------------------------------------------
A0A356KTN1      -TP---------------------------------------------------------
A0A518HFS8      -AG---------------------------------------------------------
                                                                            

A0A5S9IPR9      -------------------------------------------TYNLEKEGRAISRVEAA
A0A533Q9U4      -------------------------------------------NLTSEKQNVVLQKLMEL
A0A1U9NNE1      -------------------------------------------TSLTGRQEMMLEQVMKL
A0A2G2JCA2      -------------------------------------------VTSSSERAGTYSPVSEL
A0A533Q6B7      -------------------------------------------RIEDPQHNVVFQKLEEI
A0A351FYP6      -------------------------------------------AGEDSYSIVEPEIVRRY
A0A2E7ESJ6      -------------------------------------------ESINVHA----QRQADY
A0A1G2YQB7      -------------------------------------------R-----QQMMMNHISRM
A0A353P687      -------------------------------------------R-----QQMMMNHLAKL
A0A356EME5      -------------------------------------------KDPFA-TTLHAGSGANW
A0A355AI52      -------------------------------------------GGK-T-MHPLVERAIQL
A0A3L7SI46      -------------------------------------------DKN---SHVIIEQTVKL
A0A3L7P4E4      -------------------------------------------ENV---TSLSESRMAGI
A0A3L7PEB5      -------------------------------------------ESV---TSVSESRMAGI
A0A2N1UCJ3      -------------------------------------------SGG----NEVFQRLKAL
A0A517ZCB5      -------------------------------------------EDR-M-ISVLNQRVIKL
A0A432MFP3      -------------------------------------------EGQRAAFQVDVDEYERL
D5SZ21          -------------------------------------------TDN-A-TNVAVARVVRL
A0A518CHE5      -------------------------------------------SET---VSLVGQRILSL
A0A257WS34      -------------------------------------------GTSESGTHIAADRARQL
A0A2E8FLY0      -------------------------------------------NQN---INPAAERVAAL
A0A3D2U1E1      -------------------------------------------NQN---INPAAERLQEL
A0A1P8WP26      -------------------------------------------DGESV-VNLSVANMKHL
A0A3L7V1F3      -------------------------------------------DKNSG-LSIVSETIRLL
A0A5B9QF68      -------------------------------------------DDS-A-VEPTIQRALRL
A0A5B9QGF0      -------------------------------------------DDS-A-VEPTIQRALRL
A0A5C6CK24      -------------------------------------------DDS-A-VEPIIQRALRL
A0A2E8B0L9      -------------------------------------------STT-V-VHPMVQRVITL
A0A5Q4GFE7      -------------------------------------------NQN-V-VHPAVQRVIRL
A0A2E3GWX1      -------------------------------------------GDS-V-VSVVNERVVEL
F0SG60          -------------------------------------------GDS-V-VSVVNERVVEL
A0A2E9VST2      -------------------------------------------GDN-V-MSVVNERVIEL
A0A356A6X2      -------------------------------------------GDN-V-MSVVNERVIEL
A0A5C5XLM3      -------------------------------------------GDN-V-MSVVNERVIEL
A0A3M1VCL4      -------------------------------------------GRQ---ISLIAEQIARL
A0A5C5V7Z9      -------------------------------------------KDS-V-VDPLIGRAIHL
A0A5C5YT05      -------------------------------------------KDG-V-VDPMIGRAIHL
A0A518D7F9      -------------------------------------------DSD-A-VDPMVARALKL
A0A5C5ZIP0      -------------------------------------------DNE-V-VDPIIGRALQL
A0A518KBK3      -------------------------------------------RDD-V-VDPIISRAIQY
A0A5C6AKF9      -------------------------------------------HEN-V-VDPIVGRAIQY
A0A2E0X4J3      -------------------------------------------R---S-SDIVSDRFSAL
A0A5C5YU10      -------------------------------------------D---N-QDVASDRFSRL
A0A517MPZ6      -------------------------------------------G---E-ENVITKRFAAL
A0A5C6CNV7      -------------------------------------------G---E-ENVITKRFSSL
A0A518K5H4      -------------------------------------------KEGRE-GNVVTELFAAL
A0A5C6AA28      -------------------------------------------K---E-GNVVNELFSAL
A0A2E9VK20      -------------------------------------------NVTNIHH----QRVDAI
A0A3D4PJK1      -------------------------------------------NVTNIHH----QRVDAI
A0A0S8GZ23      -------------------------------------------DSLEGLQRVALGDITSL
L0DC26          -------------------------------------------LASIHQH--ELDRLGRA
A0A354PCQ3      -------------------------------------------KTSILENQGAIALLTRL
A0A1I3DDV4      -------------------------------------------ESSNVYL----DTFRRL
A0A2E2N5A9      -------------------------------------------ISTIAAT-----ELTLT
A0A2E3GWC6      -------------------------------------------DVTNIHH----QRVDAI
F0SLB0          -------------------------------------------DVTNIHH----QRVDAI
A0A2E0SMM6      -------------------------------------------GTETVSL--VGQRIIAL
A0A1N6DAJ8      -------------------------------------------IANIHQH--ELDRLGRA
A0A5B9PJZ8      -------------------------------------------RVQNPYQ----LQQARL
A0A2S8G191      -------------------------------------------LSLVQQN--ALQQFAAL
A0A2E7EGG1      -------------------------------------------DVVISES-----PLKSM
A0A225EH48      -------------------------------------------QASVLKMKLLTDEVSKF
A0A3L7NDH9      -------------------------------------------DGKVMHP--LVERAIQL
A0A518INW8      -------------------------------------------QLQSVSH----NRLQSI
A0A518JPH9      -------------------------------------------QLHSVSH----DRLQTL
A0A2E2CCW9      -------------------------------------------GSTNVHQ----ERVKAI
A0A3C0AGX3      -------------------------------------------GSTNVHQ----ERVKAI
A0A518AAQ5      -------------------------------------------GSTNMHQ----ERVKAI
A0A517QBG9      -------------------------------------------GSTNMHQ----ERVKAI
A0A518FTU3      -------------------------------------------GSTNMHQ----ERVKAI
A0A2E7K7A9      -------------------------------------------GSTNMHQ----ERVKTI
A0A517PTS5      -------------------------------------------GSTNMHQ----ERVKTI
A0A517WHH5      -------------------------------------------GSTNMHQ----ERVKTI
A0A5A8BGT3      -------------------------------------------GSTNMHQ----ERVKTI
A0A517VTK3      -------------------------------------------GSTNVHQ----ERVKAI
A0A517WQT4      -------------------------------------------GSTNVHQ----ERVKAI
A0A517VID8      -------------------------------------------GSTNVHQ----ERVKAI
A0A517RK10      -------------------------------------------GSTNVHQ----ERVKAI
A0A518IH18      -------------------------------------------GSTNVHQ----ERVKAI
A0A5C5VEK8      -------------------------------------------DNQDVAS----DRFSRL
A0A532UTJ0      -------------------------------------------RQEM-----MRERVIAL
A0A517NSK8      -------------------------------------------KTTNIYK----KRLESI
A0A5C5Z0D6      -------------------------------------------KARNIHK----DRLMKI
M5UE94          -------------------------------------------KTRNIHK----ERLEKI
A0A1P8WN28      -------------------------------------------ESEDSHP--LVQRVSHL
A0A3B9CTT0      -------------------------------------------NSTQSHP--LVERVGQI
A0A5C5XLF4      -------------------------------------------NVTNIHH----QRVDAI
A0A2D5NDU9      -------------------------------------------QGARASV----EEHGRV
A0A286RGB6      -------------------------------------------LSLKQQI--TLQQFSTY
A0A1V5N3W2      -------------------------------------------RQDM-----MLARVSDL
A0A3E0MY27      -------------------------------------------ADANRELLMAEQKSLRE
A0A2E0X9P6      -------------------------------------------QGAVFNLDRALSPVDTL
A0A286RLF2      -------------------------------------------NSQTVHP--LVERAKAF
A0A5C5ZM48      -------------------------------------------GGVSPLVEDSVRRLIEI
A0A5B9WF77      -------------------------------------------DTPQATSDDLLEQFRST
A0A518BBX8      -------------------------------------------EGVDTNL----ESLASI
A0A518ALT3      -------------------------------------------VTAFSPS---TSVYQEL
A0A517MDV3      -------------------------------------------DSLTKNQ----IRLAML
A0A3M1QRP3      ---------------------------------------------------RKMLRVHTA
A0A517TMV0      -------------------------------------------RENVVDP--IVARAIHL
A0A2E3RCU8      -------------------------------------------ESDVIHP--VVQTVVTL
A0A3E0MY88      -------------------------------------------ETDHVHP--LVERALAL
A0A1C3E6N1      -------------------------------------------TDNATNV--AVARVVRL
A0A518GJT2      -------------------------------------------TDNATNV--AVARVVRL
A0A286RD13      -------------------------------------------AVGSADSEVARKKALTA
A0A517MLW3      -------------------------------------------DSLKSHP--ALQRVNSL
A0A5B9QVD0      -------------------------------------------QSLASHP--AVQRVNSL
A0A3B8PNV4      -------------------------------------------DNQSINP--AAERVAAL
A0A3D1DR40      -------------------------------------------DNQSINP--AAERVAAL
A0A2E7RYU8      -------------------------------------------DNQSINP--AAERVAAL
A0A3B8LXG8      -------------------------------------------DNQSINP--AAERVAAL
A0A350CI62      -------------------------------------------ERNQNSLNTISKNIEML
A0A4P5WQK6      -------------------------------------------ERNQNSLNTISKNIEML
A0A3C1X4W5      -------------------------------------------ERNQNSLNTISKNIELL
A0A3D3W3A7      -------------------------------------------ERNQNSLNTISKNIELL
A0A518DRX3      -------------------------------------------GSTVVHP--AVQRVVEL
A0A518DZF9      -------------------------------------------GSTVVHP--AVQRVVEL
F0SI78          -------------------------------------------EGNNLHQARLAQIEGQR
A0A518IQ30      -------------------------------------------GSNVVHP--LVQRAVKM
A0A517LWP4      -------------------------------------------GSTVVHP--LVQRAVKM
A0A518JNW8      -------------------------------------------GSSVVHP--LVQRAVKM
A0A2E7ENQ5      -------------------------------------------GSTITHP--LVHNVVRI
A0A1G3AQE9      -------------------------------------------EGEVQHP--LVQAAIAL
A0A3L7UQT9      -------------------------------------------EGKSTNL--LSLRVVEL
A0A4P5YBU2      -------------------------------------------EGKSTNL--LSLRVVEL
A0A518AKT8      -------------------------------------------EKEAIDP--IVQRALSL
A0A5C5ZR72      -------------------------------------------ADRAFSP--LSGYHRQL
A0A517TY85      -------------------------------------------VG-AITA--AGSFHQGI
A0A5B9QEI7      -------------------------------------------AV-AFSP--AGSLYQSL
A0A5S9IJB5      -------------------------------------------NVESRQ-NIIFQRLNDI
A0A1G2XVR0      ------------------------------------------------TAGIIEQKLEGL
A0A1G3B0P0      ------------------------------------------------TAGIIEQKLEGL
A0A1E3X4X0      -------------------------------------------GTVEQRQNIVLEKLSEL
A0A286U4B3      ------------------------------------------------SQSIILKELTTI
A0A5C6DDS2      ------------------------------------------------SQNIFMKELITI
A0A0S8J591      --------------------------------------------------SVVLTNERWL
A0A2E3GW02      -------------------------------------------TSDEGN-NLHQARLAQI
A0A1U9NL64      -------------------------------------------FENNGN-NIILDRLANL
A0A5B9QNZ7      -------------------------------------------LGPDSL-NKNQIRLAAL
A0A1U7CZ81      -------------------------------------------TKDASIEKFSIEQYRNF
A0A142YNY8      -------------------------------------------SKARNLGDVSIEQYRKW
A0A1U7GLS6      -------------------------------------------DPATTLQDVSMEELRTI
A0A1Z8N7H5      -------------------------------------------SAESNIVHPVVQSVITL
A0A1G2YPI3      -------------------------------------------LEDSRG-NILIEQLQRW
A0A532UIN2      -------------------------------------------AFEGSRGNIVITRLERL
A0A532UD06      -------------------------------------------FNDNGG-NIVLERLTRL
A0A660URN1      -------------------------------------------FDDKNG-PIVFQRLAKL
A0A0S8KNX5      -------------------------------------------ALGSRT-DMMLQRVGSL
A0A3D3UVZ8      -------------------------------------------ALEGRQ-DMMLQRVASL
E8R3W3          -------------------------------------------YGSGDP-IILEMRYQFH
A0A517NFU9      -------------------------------------------EGSTVQ-DVHKDRLENL
A0A5C5YWH4      -------------------------------------------EGDSVQ-DIHKERLANL
A0A3D2TNK4      -------------------------------------------TEDGVI-DPKIQRVMKL
A0A0J1B4A0      -------------------------------------------NGRDSLEDVHRLRLNNI
A0A142WSB9      -------------------------------------------GVATPQMSPQAQALDRV
M5SZR3          -------------------------------------------TDEGGS-NPVYSRIAAI
M5TW92          -------------------------------------------TDEGGS-NPVYSRIAAI
A0A2S8FKY2      -------------------------------------------AQQGSV-QHYGLVRNEL
A0A517N8P6      -------------------------------------------NGKGEAINPYRDDAIRL
A0A432MJP4      -------------------------------------------TDQSGR-SFITRRVDGW
M5UQ35          -------------------------------------------NQDGEA-SLQDVHRIRL
A0A5C5WTY6      -------------------------------------------DGSNTT-NVYEERYRSL
A0A5C5Y033      -------------------------------------------QGEGSS-NVYQDRYRRL
A0A5C6G1Y2      -------------------------------------------QGEGSS-NVYQDRYRRL
A0A354PDV6      -------------------------------------------QGEGSS-NVYQDKYRRV
A0A5C6FZ02      -------------------------------------------QGEGSS-NVYQDKYRRL
M5TIT3          -------------------------------------------QGEGSS-NVYQDRYRRL
A0A5M6CY44      -------------------------------------------QGEGSS-NVYQDRFRRL
F2AXG2          -------------------------------------------QGEGSS-NIYQDRYRRL
M2BB46          -------------------------------------------QGEGSS-NIYQDRYRRL
L7CLQ6          -------------------------------------------QGEGSS-NIYQDRYRRL
A0A0J1B719      -------------------------------------------QGEGSS-NIYQDRYRRL
Q7UF18          -------------------------------------------QGEGSS-NIYQDRYRRL
A0A2G1W1E0      -------------------------------------------QGEGSS-NIYQDRYRRL
K5E235          -------------------------------------------QGEGSS-NIYQDRYRRL
A0A5C6FFI9      -------------------------------------------EGERVR-DVHKTRLEQL
A0A3A0DET7      -------------------------------------------VQLEQG-NVVTQRFSSL
A0A5C5WDJ1      -------------------------------------------EGDKVR-DIHKERLADI
A0A5C5X547      -------------------------------------------STLSER-EILEKQRHEL
A0A2A2W9R6      -------------------------------------------SGSGVG-SLEDIHRTRL
A0A518HKC1      -------------------------------------------SGSGVG-NLEDIHRTRL
A0A518L3P0      -------------------------------------------SGSGVG-NLEDIHRTRL
A0A255R1S0      -------------------------------------------GG--------NIQRDRL
A0A5B9MKP1      -------------------------------------------SGSGVG-TLEDVHRARL
A0A0S8FY64      -------------------------------------------GTPNEQ-SPVLTRRRAL
A0A1N6KFT7      LSQFPTM-----TPGGSNGQIPQS-------------------SGTA-------GSYEQL
L0DFG4          LNQFPTV-----SSNGAGHLTQGM-------------------TGAAIG-TSGTGSYEQL
A0A5C5XXG1      QQISDMMDLATAKINEAKNEVEGELHIAEKKYLEHRQTAPMLFQGEGSS-NVYQDKYRRL
A0A518BJJ1      QELDDPL---------AKSLLEQLSVLHMRLLLKGRS------DGDPYA-LLLAQRSELL
A0A518D182      SELADPL---------SKGLVERLETLGLERFAAARA------DGGPYR-TLLQQRAVEL
A0A353FIP5      -------------------------------------------QEEEKA-SVLSDTAQAI
A0A5B1CIK7      -------------------------------------------QGEGSS-NIYQDRFRSL
A0A5C5WHS2      -------------------------------------------QGEGSS-NIYQDRYRRL
A0A5C6B6G8      -------------------------------------------QGTGSS-NVYQDRYRRL
A0A5C5ZZN3      -------------------------------------------QGEGSS-NVYQERYRRL
A0A5C5XS91      -------------------------------------------QGEGSS-NVYQDRYRRI
A0A5C6C4E6      -------------------------------------------QGEGSS-NVYQDRYRRI
A0A2E1VVJ1      -------------------------------------------QEANET-PVLPEVAKAI
A0A3M2AEL0      -------------------------------------------QEAEGA-VALSEEASLL
A0A532UT69      -------------------------------------------LEGERG-NVVTERLARL
A0A2D5AWU0      -------------------------------------------ITQGGE-TLIQARLTQT
M5RT57          -------------------------------------------GMDPYT-GMPQKNGGQA
A0A356KTN1      -------------------------------------------LLEEHE-KLLVERIRIN
A0A518HFS8      -------------------------------------------ASDQKG-SAL--RQQMV
                                                                            

A0A5S9IPR9      KSDLYELERSMYDVKLRYGKCQE-----------------VKKKKSLEAIL---------
A0A533Q9U4      NTAVTYARTERIKLEVLYNKLKDFKS--------------IQYKDDIIQSIPAVVQS---
A0A1U9NNE1      QNELTTLETKRIALEANVQ---------------------MKVNGDKVLLA--PTDRMKL
A0A2G2JCA2      QSRLVSAKVEKLVLEVEHQALKEIHEKETFIVPETGLNQAVEQHPDVLTLR---------
A0A533Q6B7      NAAITKAKIERLRLETLYNKLAI-----------------LKNAQNQAEII--QSIAPVV
A0A351FYP6      ESELITAKGLYTQQATLLQGLQEQ------------------SLEELRESI---------
A0A2E7ESJ6      ENERVSLQKQMTELGAQIKSVEEA----------------LERDDNLESIL--LLAEKDG
A0A1G2YQB7      QEKLTELELERIVLQTKIDLHSSK----------------EEKTITPEMMA--KLRHDFI
A0A353P687      QEKVTELELERIVLQTKIDLHSSQ----------------KEKTITPEVMA--KLRHDFI
A0A356EME5      PHPLAGLQTRLTEVEVEREVLEAE----------------WKALNEMPNPL--AQQVDEA
A0A355AI52      NSTLIETQKKRLLLEASYQSLTEA----------------IKAGQNIRQSL--IAIEETL
A0A3L7SI46      NDALIEAQKKTLESRALLISVQHA----------------LAEGNDIQPYL--QQAAGDI
A0A3L7P4E4      EIERSKVMIAQTEIQSQIDAIQKA----------------LERGGSREAIT--LMLESFN
A0A3L7PEB5      EAERSKVLIAQTEVQSQIDAIKKA----------------LDRGGSREAIT--LMLESFN
A0A2N1UCJ3      GDSLTIAQLDTIKAKATLEAVKK-----------------FDSPQKVRQYA--MAQPGIS
A0A517ZCB5      NESLVKAQHEAIDARSFLLAIEEA----------------IRQGEDIQQFA--SRMSEGL
A0A432MFP3      SQALLELEYEEIEARADLEAVRRQ----------------AAATDPRVWVD--RRIEQVF
D5SZ21          NEEFMKAKEETLRATAQLAALEQA----------------ISRGEDVLQFA--MASLDVV
A0A518CHE5      QTAYTEAQNQMIKLESLIKVLKQA----------------IEKGSNAQQYA--EEILGPG
A0A257WS34      NLTLTTAVEQTAEARAFYEAVAYA----------------VRSGGDIQQFI--TQVADVV
A0A2E8FLY0      NKELIVAQNRTRENRATLEAIENA----------------AAQGQSIEQFA--MQQIEVV
A0A3D2U1E1      NKHLIDAMNRTREARATMQAIREA----------------AARGEDIHQFA--LQQIEVV
A0A1P8WP26      LARLSEAQQEAANAQATLETLRQA----------------VANGEDVLQYA--SEL----
A0A3L7V1F3      NIDYSAARRISEQSRTQFDGLQRA----------------IASREDILQFA--NKTLDTA
A0A5B9QF68      NDALMDEQQRRLELQATLLSVEGA----------------LDRGENIHQYL--VAMEESV
A0A5B9QGF0      NDALMDVQQRRLELQATLASIDGA----------------LERGEDINQYL--VAMEESV
A0A5C6CK24      NDALMDVQQRRLELQATLVSVEGA----------------LERGEDINQYL--VAMEESV
A0A2E8B0L9      NNALVEVQQERMQLEASLGAVRMA----------------VRNGSDLRQHM--IDLEPLV
A0A5Q4GFE7      NETLLKVQQDRLQLEASLWAIRTA----------------IRDGNDLRQHL--TAIEPLI
A0A2E3GWX1      NRSLAAAQKETIESRSFYTAVEQA----------------IRNGENLQQLM--AQTNSSV
F0SG60          NRSLAAAQKETIESRSFYTAVEQA----------------IRNGENLQQLM--AQTNSSV
A0A2E9VST2      NRALAKAQQDSIQAQSHYTAVEQA----------------IRNGESLQQLM--NQSNQTL
A0A356A6X2      NHALAKAQQESIQARSYYTAVEQA----------------VRNGESLQQLM--NQSNQTL
A0A5C5XLM3      NHALAKAQQESIQARSYYTAVEQA----------------VRNGESLQQLM--NQSNQTL
A0A3M1VCL4      NQALLEAKKETINARVFLNAVENA----------------LATGQDVFQLM--QGELEPV
A0A5C5V7Z9      NDSLMQAQQQRLDLQASLASVSAA----------------LARGEDMRNYL--SVVEEAV
A0A5C5YT05      NDALMEAQQRRLDLQGSLASVAMA----------------MARGDDMRNYL--SVVEEAV
A0A518D7F9      NDALMDAQAKRLEVEASLATVREA----------------LASGQDLRRYV--ALVEEAV
A0A5C5ZIP0      NTALMEAQQERIGMQASLATVRRA----------------MSQGEDLRQYL--SLVQEAV
A0A518KBK3      NDALLEAQRRRLDLQSSLTTIQMA----------------IDRGDDLSQHL--GLVEQSI
A0A5C6AKF9      NDALMGAQRRRLDLTASLATIQVA----------------IARGEDLSQHM--GLVEESI
A0A2E0X4J3      TNELNETEIELLEAKALHNRVQRM----------------YESPTLRPLLA--DMAMDGK
A0A5C5YU10      MSELNQTELEQLTAKAEYERVKEM----------------AASPTLRPMLL--DMALDSV
A0A517MPZ6      ASELDRVELALLDSKARHNRTQQM----------------LESPSLRPFLL--ELASGQQ
A0A5C6CNV7      AQELDRVELELLDAKARYNRTKSM----------------YETPSQRPFLL--ELASSQQ
A0A518K5H4      SRELNATQIELLEAKTRYARAQKM----------------LENPDQIPFLM--ELARTAQ
A0A5C6AA28      SQELNATQIQLLESKTRYARAKKM----------------LENPDQAPFLM--ELARSAH
A0A2E9VK20      ATERVKVELLYEEISSRLSTLKSA----------------IERGESHEALM--LLVKTFL
A0A3D4PJK1      ATERVKVELLYEEISSRLSTLKSA----------------IERGESHEALM--LLVKTFL
A0A0S8GZ23      REQLRNLELVISDTLTQIELLSDP----------------NHPIDIPPDML--KNRSDSI
L0DC26          EDELSRIQSELRSLRVEAEVLEEQ----------------ATLNETMVTPA--MIEDAIS
A0A354PCQ3      RSQIAELTVELSVRDAQSAMQNNL----------------MQAESDGAGEVLQVAAEALV
A0A1I3DDV4      QDELVTVDIERSAVATRLQNVLTS----------------LDQIKQNKGNS--LEMLALI
A0A2E2N5A9      SDRLINARRQRAESESQFRQVEAMKA---------------------------SRLDELA
A0A2E3GWC6      AAERVKVELKYQEITSRIQTLRNA----------------VQRGESSEALL--LLVRTFL
F0SLB0          AAERVKVELKYQEITSRIQTLRNA----------------VQRGESSEALL--LLVRTFL
A0A2E0SMM6      QNSYMEAQNQMIKMQTLIDALTEA----------------IENGSNVQQYAEEILGAGPV
A0A1N6DAJ8      EDELARVQSELRSLRIEHEVSQEK----------------VTQTASMITPV--MIEDAIS
A0A5B9PJZ8      HEELHQLRRERTRLEARVTSIQQA----------------KAMGKNPESLV--IGVLQEF
A0A2S8G191      RSELTRVQLDLLRAKGKLAGIQSS------------------VAANLTEPV--VAKKPVV
A0A2E7EGG1      QENLAKAQIEHKVLAAQVQALEDS----------------VQTGPAVPDVL--IEREIAG
A0A225EH48      NSTVSSLSLEIVSHETNLITLQHKQS--------------VIDMQEVSLDE--LEKAVAK
A0A3L7NDH9      NAALIEAQKKRLSLQASQASFQTA----------------IQNKQNIRQSL--MAIEESL
A0A518INW8      EQELANVRSQLTYAKSKLETIAEIQAEDVEHQRTDIERLALLNPRDTERLR--FFMDVAS
A0A518JPH9      EQEIAEVRSQLVYAKSKLESIAEIEASGSDQEQMDIERLALLNARDADRLK--FFMDIAN
A0A2E2CCW9      DNERRLNLLKLTELKSKIDSLKAA----------------IASGESKETLE--LLAQQYL
A0A3C0AGX3      DNERRLNLLKLTELKSKIDSLKAA----------------IASGESKETLE--LLAQQYL
A0A518AAQ5      DNERRQNLLKLTELKSKINTLKAA----------------IASGESKETLE--LLAQQFL
A0A517QBG9      DNERRQNLLKLTELKSKINTLKAA----------------IASGESKETLE--LLAQQFL
A0A518FTU3      DNERRQNLLKLTELKSKINTLKAA----------------IASGESKETLE--LLAQQFL
A0A2E7K7A9      DNERRQNLLKLTELKSKINTLKSA----------------IASGESKETLE--LLAQQFL
A0A517PTS5      DNERRQNLLKLTELKSKINTLKSA----------------IASGESKETLE--LLAQQFL
A0A517WHH5      DNERRQNLLKLTELKSKINTLKSA----------------IASGESKETLE--LLAQQFL
A0A5A8BGT3      DNERRQNLLKLTELKSKINTLKSA----------------IASGESKETLE--LLAQQFL
A0A517VTK3      DNERRLNLLKLTELKSKISSLKAA----------------IASGESKETLE--LLAQQFL
A0A517WQT4      DNERRLNLLKLTELKSKISSLKAA----------------IASGESKETLE--LLAQQFL
A0A517VID8      DNERRLNLLKLTELKSKIDSLKAA----------------IASGESKETLE--LLAQQFL
A0A517RK10      DNERRLNLLKLTELKSKIDSLKAA----------------IASGESKETLE--LLAQQFL
A0A518IH18      DNERRLNLLKLTELKSKIDSLKAA----------------IASGESKETLE--LLAQQFL
A0A5C5VEK8      MNELNQTELEQLTAKAEYERVKQ-----------------MAASPSLRPML--LDTALDA
A0A532UTJ0      LDRLTAVQLDKISLEAQVQLLERS----------------TERAIAPEELL--RMRQEYI
A0A517NSK8      EIDLLELTENEAHIESRLAVISDFVENADPEKVSDFDRLALLSEKEVNRLK--VLFDVTR
A0A5C5Z0D6      EESLLELTEQEAEVESRLAVITDFLQNTDPNSITDFNRLALLSEKEVNRLK--LLYEITR
M5UE94          EDDLHELTEREAESSSRLTVISDFLASKDASEITDVDRFSLLSEKEVNRLK--LMIEMTR
A0A1P8WN28      NENLTTVQSRRLQLEATLVSAREL----------------VATNSDLTSAL--KKLEEIV
A0A3B9CTT0      NQRFTELRSQRMELEAAMKSARRL----------------VATQADLTPAV--QALQRIV
A0A5C5XLF4      ATERVKVELLYEEISSRLSTLKAA----------------IERGESHEALM--LLVKTFL
A0A2D5NDU9      RKLIHDVDQRLLTARTEAATAADF----------------VDNPKLLAQLN--LGATETG
A0A286RGB6      RNELINVQLRMLRLQGELSIKKAI----------------RDKAAQIPVTD--REIEAAA
A0A1V5N3W2      RQQLTQIESKKLALQSLVQLSEQT----------------KDKTIVPEKLL--ERRYDFI
A0A3E0MY27      EIGLIRIDILRQQLQISQLQRLEA-------------------------------NDPEQ
A0A2E0X9P6      YQSLNEIDVNQEVLKAELQALNDAP---------------IVYGDETASSG--LFALEIS
A0A286RLF2      NQALVEVQKERVQLAASLQALENA----------------VQQGADIRQYL--FAADDTL
A0A5C5ZM48      DLARVSLTAERENLKQDT----------------------PNHAADYAAAE--AAVVELI
A0A5B9WF77      NELLMQTDFQLIEAEAKLTARQ------------------AQAAGDVASQS--QAPDSNV
A0A518BBX8      QREISQLKLERAEVESDLLTLQRA----------------IQEKEPFDALL--VMATEIA
A0A518ALT3      TETEVSLEVAKAELQALKTSDIIS----------------ADNAIATGHFE--LEISNRA
A0A517MDV3      HNELIRLQLRESELQSRASILARTQNDESLQDFSDLERLGLIDNRDVERLA--LLVNVER
A0A3M1QRP3      DDLVNTQRLYLDKLESRREDLLLA----------------ISNREARLKRL--ELLAASG
A0A517TMV0      NESLLEAQRERIEIEASQATIQSA----------------IDNGSDLSRHL--ALVEESL
A0A2E3RCU8      NEAFLDAKKDRLVQQSLVEGIQRA----------------IVRGEDLKQYA--MAIEETL
A0A3E0MY88      HTELTVAETERIKHQAALESIRAA----------------IHSGADLNQFL--MSAEQSV
A0A1C3E6N1      NEEFMKAKEETLRATAQLAALEQA----------------ISRGEDVLQFA--MASLDVV
A0A518GJT2      NEEFMKAKEETLRATAQLAALEQA----------------ISRGEDVLQFA--MASLDVV
A0A286RD13      LETLADHRKHVNELRQQISGLERR----------------IAILQSRLRYM--EEHRPQT
A0A517MLW3      NESLTQAQKTRIELQAISAVVSDA----------------IREGRDPRPHM--HAVDPDA
A0A5B9QVD0      NASLTDAQKTRIELQAIAGVVEQS----------------IREGRDPRPHM--HAVDPEA
A0A3B8PNV4      NKELIVAQNRTRESRATLEAIVDA----------------AARGQNIEQFA--MQHLEVV
A0A3D1DR40      NKELIVAQNRTRESRATLEAIVDA----------------AARGQNIEQFA--MQHLEVV
A0A2E7RYU8      NKELIVAQNRTREARATLEAIVDA----------------AARGQNIEQFA--MQHLEVV
A0A3B8LXG8      NKELIVAQNRTREARATLEAIVDA----------------AARGQNIEQFA--MQHLEVV
A0A350CI62      TQEYTNSRRRTEEARTTSQELQRA----------------IASGEDILQFA--METLDSA
A0A4P5WQK6      TQEYTNSRRRTEEARTTSQELQRA----------------IASGEDILQFA--METLDSA
A0A3C1X4W5      TQEYINARRRTEEARTTSQELQRA----------------IAGGEDILQFA--MEALDSA
A0A3D3W3A7      TQEYINARRRTEEARTTSQELQRA----------------IAGGEDILQFA--MEALDSA
A0A518DRX3      NRTLIEAQKNRVHLEALQTAVGDA----------------VREGRDLRQHL--LTFSPEI
A0A518DZF9      NRTLIEAQKNRVHLEALQTAVGDA----------------VREGRDLRQHL--LTFSPEI
F0SI78          SELLIKSSQVRAELEA----IQNA----------------LNRGTSRQALL--MMADQA-
A0A518IQ30      NDILVAAREKRLKLQASEVAVKHA----------------VETGGDLRQYL--VELEPTI
A0A517LWP4      NDILVAAREKRLKLQASEVAVKHA----------------IQTGGDLRQYL--VELEPTI
A0A518JNW8      NDILVAAREKRLKLQASEVAVKHA----------------VQTGGDLRQYL--VELEPTI
A0A2E7ENQ5      NEALIDVRKERMRLDASLAAVRRA----------------ISQGQDVRQFM--LSMEDAG
A0A1G3AQE9      SEQLIESQSRRAKLEASLAAIEAA----------------VHDGEDLEKCI--LLAAEVV
A0A3L7UQT9      NKLLIEAQRVTLDAWSFLQTVEQA----------------ARTGQDLQQLM--FQAVETL
A0A4P5YBU2      NKLLIEAQRVTLDAWSFLQTVEQA----------------ARTGQDLQQLM--FQAVETL
A0A518AKT8      NESWIEAQQQRVDLEARLAAVNSS----------------IARGDDMRQHL--MSLEETL
A0A5C5ZR72      AEIEVKKEVLRAELESIQEAEVVN----------------TDFRERSGAID--LEVDMNG
A0A517TY85      VEAEVGAEIARAELEAIKR-PIAS----------------DDQGSVSGILT--LEVANRP
A0A5B9QEI7      TETDVEFEVLKAELQAINNSPMLG----------------EDRAVASGLLE--LEISNRA
A0A5S9IJB5      NEKLTEIELKRISAYTSYRETIDN----------------Y-------------------
A0A1G2XVR0      KSNLTETKIEKVKLKALSDQIKQY----------------S-------------------
A0A1G3B0P0      KSNLTETKIEKVKLKALSDQIKQY----------------S-------------------
A0A1E3X4X0      STELTRAKTQRIGVETLYNEIQKL----------------S-------------------
A0A286U4B3      SDELTRAEAERIGKEIRFLAVQNS----------------D-------------------
A0A5C6DDS2      SEELTKAEAVRIAKEVRFLAVQNS----------------D-------------------
A0A0S8J591      QEAAAQANVEMIAAQSLYDAVNKA----------------VEE-----------------
A0A2E3GW02      EGQRSELLIKSSQVRAELEAIQNA----------------LNRGTSRQALL--MM-----
A0A1U9NL64      SQAVTDAQLALIEAKSEYDTVKAM----------------VSDPKKVKQ-----------
A0A5B9QNZ7      HSELIRLQLRESELESRAIILKNT----------------AGQESLRE-----FSDLERL
A0A1U7CZ81      KADILKKKLELNELEFALQKRVAD----------------SQ---EQDSEV--AETTGFQ
A0A142YNY8      KDRLLETQVDLFQAKALLEQRTAD----------------YQNGAEIEQLE--SGLRP-S
A0A1U7GLS6      KAQLLDVQIELMTAKSRLQSRTQD----------------YQDLGQIEPTA--AETATLP
A0A1Z8N7H5      NEAFLDAKKDSLIQQSLVEGIQRA----------------IVRGEDLKQYA--MAVEETI
A0A1G2YPI3      STLLTEAKLKTIERNSAYESTKEM----------------VSDPVKLQQ-----------
A0A532UIN2      SQELTEAQLATIESKSAYESVGEM----------------VSDPVKLKQ-----------
A0A532UD06      SNALTETQLAALNAKADFEATKKM----------------ANEPAKIRQ-----------
A0A660URN1      STALTDAQLATINAKADFEAILSM----------------VDEPEKIKQ-----------
A0A0S8KNX5      LSTLTEVEAERIKLEAQVQLLELT----------------KTQPIA--------------
A0A3D3UVZ8      LDTLTSVEAKRIELEAQVLLLERT----------------REQPIS--------------
E8R3W3          QNKVARLEQLLEEVNQRIRLAEIR----------------RQILLEEQRTN--RTGTGLT
A0A517NFU9      EAELNIVTTSLAESRSRLEVIKSY----------------LATRDSSK-----INSMDHL
A0A5C5YWH4      EKELHLVTNSLAESRSRLEVIATY----------------LADRNGQE-----INNIDHL
A0A3D2TNK4      NEVLLTAQEKRLSLQANLATVETA----------------YNRGEDLNQHL--MHLEAPL
A0A0J1B4A0      EQQLGGIRESLSHAKSRRVVIREF----------------VK---GKDPDS--LSDVHVM
A0A142WSB9      IREQESIQTQRANVQGKIATLKKM----------------IAANESPDEIQ--FWVMHAL
M5SZR3          QRQQSELLLRRTELESLIQSLENA----------------IESGLEPK----------HL
M5TW92          QRQQSELLLRRTELESLIQSLENA----------------IESGLEPK----------HL
A0A2S8FKY2      AQVRFELMRAEGELDFLLSSNKAQ----------------IESVSRSGGDG--GLTTENA
A0A517N8P6      EDNLYNLQSQARQLDSKLRLIREA----------------VKGGRHP-------------
A0A432MJP4      DSVINQTLVRAVELRTQLELGKS-------------------------------------
M5UQ35          AQIESELSETRKKLAQVRARRQTI----------------RDFVGGRSRDE--ITDAEVL
A0A5C5WTY6      QSELVSADLEVSKLRSRLEQVNST----------------IEQIAASDRKS---DHIDKL
A0A5C5Y033      SEELLELDIQQSTMRTRLERVRES----------------LKHIGGGSDLS---DHLDKL
A0A5C6G1Y2      SEELLELDIQQSTMRTRLDRVRES----------------LKHIGGGSDLS---DHLDKL
A0A354PDV6      EEELLNVDIEESSLKTRLERVRET----------------LGDMDLDGPLS---EHLDKL
A0A5C6FZ02      QDELIDLQIQESTIKTRLARVENE----------------LEDLDGKTLSM--TESMDKL
M5TIT3          QEELLDVDIKESTVRTRLQRVADT----------------LNEMDDSGDAF---DHLDKL
A0A5M6CY44      QDEMLDLDIQESTLRTRLDRVQAV----------------LAELEESNDPV---DNLDKL
F2AXG2          QDELLDLDIQESTVKTRLARVDET----------------LKEMDGSVDPI---DQLDKL
M2BB46          QDELLDLDIQESTVKTRLTRVDET----------------LKEMDESVDPI---DQLDKL
L7CLQ6          QDELLDLDIQESTVKTRLTRVDET----------------LKEMDESVDPI---DQLDKL
A0A0J1B719      QDELLDLDIQESTVKTRLTRVDQT----------------LKEMDESTDPI---DQLDKL
Q7UF18          QDELLDLDIQESTVKTRLTRVDET----------------LKEMDESTDPI---DQLDKL
A0A2G1W1E0      QDELLDLDIQESTVKTRLTRVDET----------------LKEMDESTDPI---DQLDKL
K5E235          QDELLDLDIQESTVKTRLTRVDET----------------LKEMDESTDPI---DQLDKL
A0A5C6FFI9      ESELNTVRTSLAEAKSRLKVIEAF----------------TDENE----TS--VNDFDKL
A0A3A0DET7      AEELNSTEIELLQAKALFHRVKSM----------------YDTPKQRP------------
A0A5C5WDJ1      EKELNDVRSGLAESKSRLEVIEST----------------LERNGGTT------GDMGHL
A0A5C5X547      RFKRMELEAQLFALLETQKHRQAV----------------GETAPNEDGQP--VVSEEPV
A0A2A2W9R6      KSIEVELATVRAALASARSRRLVI----------------ADAVKGKRADE--LTDAGVM
A0A518HKC1      KSIEGELASVRTALASARSRRLVI----------------ADAVKGKRPED--LTDAEVM
A0A518L3P0      KSIESELANVRTALASARSRRLVI----------------ADAVKGKTPED--LTDAAVM
A0A255R1S0      TAIEAELNTIRRTIAEIETRRQKI----------------SSSVKGQRPEE--LTDAQLA
A0A5B9MKP1      KSIEEELASVRRVLAETRSRRSVI----------------AEAVDGKAPEE--ITDADVM
A0A0S8FY64      NDEFTRVQLKRIELGVVVQANLGT----------------GEEPQDLE------------
A0A1N6KFT7      QKELAEVKLKRSITQRMVDNLKAG----------------RP------------------
L0DFG4          QKELADVKLKRAMTQRLVENLKGA----------------RP------------------
A0A5C5XXG1      QDELIDLQIQESTIKTRLARVENE----------------LEDLDGKTLSM--TESMDKL
A0A518BJJ1      EERAGELAMQIVAVRETIQAIDDG----------------VP------------------
A0A518D182      DERADEARVELAALRAVLTAAEAD----------------EQ------------------
A0A353FIP5      VGRMSEIDLEQAKLVMMAERQNQL----------------AESLRKG--SP--VEEVGAA
A0A5B1CIK7      QEQLLDIDIQESSIKTRLKRVEVT----------------LNEIDETNTSA--VDQLDKL
A0A5C5WHS2      QEQLLDIDIQESTIRTRLERVEET----------------LSEMDEEKSTA--ADQLDKL
A0A5C6B6G8      QEELLDLDIKESTLRTRMERVQAT----------------LEDMDTST-DP--VDHLDKL
A0A5C5ZZN3      QEELLDIDIQESTVRTRLTRVEDT----------------LKEMDDSG-DA--FDHLDKL
A0A5C5XS91      QEELLDLDIKESTVRTRLQRVDAT----------------LKEMDGSD-NP--VDHLDKL
A0A5C6C4E6      QEELLDLDIKESTVRTRLQRVDAT----------------LKEMDGSD-DP--ADHLDKL
A0A2E1VVJ1      VEQQSSLTLELARLRLTIRAHELV----------------AERLQDPE-AS--LMSLAGA
A0A3M2AEL0      VQRLSELDLRDADLDLRIRTVKNL----------------IETVRTSD-SG--LERLVSV
A0A532UT69      SSVLTEAQLATVEARHTYESMKAM----------------VSDPAKLSQFI--EAQRAT-
A0A2D5AWU0      RELWTDAHFDMLRERATFELFSRA----------------EADAEKFLDLG--RNRRSTK
M5RT57          ----GAGPLERLRERLTAAEVDRK----------------MLEMEITAIRE--AMAKEDL
A0A356KTN1      ----NNALSDIQRQRIQLNAQL----------------------------E--SIQRVLE
A0A518HFS8      ----AEHLGQSRRELVQLQSEIRK----------------ARAEVTVLAED--AATPAAA
                                                                            

A0A5S9IPR9      -------------------------------------------------------SSDLF
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      KYEFINAD----------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      QN----------------------------------------------------------
A0A351FYP6      -------------------------------------------------------MTANP
A0A2E7ESJ6      HQGLKEKF----------------------------------------------------
A0A1G2YQB7      NSDLMVQT-----------------------------------------------TASN-
A0A353P687      NSDLMVQT-----------------------------------------------TTSN-
A0A356EME5      LAGNVTSA-----------------------------------------------VETNP
A0A355AI52      GKEAFLDS-----------------------------------------------MGLGD
A0A3L7SI46      SREFLLQE-----------------------------------------------LGVGA
A0A3L7P4E4      DKKKSGDG-----------------------------------------------LETSL
A0A3L7PEB5      DKNNSGEA-----------------------------------------------VEKAL
A0A2N1UCJ3      SNLF--------------------------------------------------------
A0A517ZCB5      ATELLKRH-----------------------------------------------AGIAS
A0A432MFP3      LSDERVNA-----------------------------------------------LRGAI
D5SZ21          GKQFMMGE-----------------------------------------------LGLDS
A0A518CHE5      PVGNELLS-----------------------------------------------QEMGL
A0A257WS34      GSQVLLRE-----------------------------------------------LGMGS
A0A2E8FLY0      GKEFLLRR-----------------------------------------------MGLDS
A0A3D2U1E1      GKEVFLRQ-----------------------------------------------MGLNP
A0A1P8WP26      GEQVLAEV-----------------------------------------------MGVSG
A0A3L7V1F3      GRQLIEQS-----------------------------------------------MGLGS
A0A5B9QF68      GRQMMLSS-----------------------------------------------LGLSS
A0A5B9QGF0      GRQLMLSS-----------------------------------------------LGLSS
A0A5C6CK24      GRQMMLSS-----------------------------------------------LGLSS
A0A2E8B0L9      GRQLVMSG-----------------------------------------------LGLSP
A0A5Q4GFE7      GRELTMSV-----------------------------------------------MGLNS
A0A2E3GWX1      ASELMKIG-----------------------------------------------IGVDS
F0SG60          ASELMKIG-----------------------------------------------IGVDS
A0A2E9VST2      ANELMKLS-----------------------------------------------AGVDS
A0A356A6X2      ANELMKLS-----------------------------------------------AGVDS
A0A5C5XLM3      ANELMKLS-----------------------------------------------AGVDS
A0A3M1VCL4      GRQMLESE-----------------------------------------------LGFSQ
A0A5C5V7Z9      GEQMMLAS-----------------------------------------------LGLSH
A0A5C5YT05      GEQMMLAA-----------------------------------------------LGLSH
A0A518D7F9      GQQMLMSA-----------------------------------------------MGVAP
A0A5C5ZIP0      GEQMLLSA-----------------------------------------------LGMGE
A0A518KBK3      GEAAMLAA-----------------------------------------------MGMGP
A0A5C6AKF9      GQAAMLAA-----------------------------------------------MGMAP
A0A2E0X4J3      PVDT---L-----------------------------------------------EERSV
A0A5C5YU10      GKAN------------------------------------------------------LN
A0A517MPZ6      SVAQDISL-----------------------------------------------ENRLQ
A0A5C6CNV7      QVANEIRS-----------------------------------------------ESQLS
A0A518K5H4      AGSR-------------------------------------------------------S
A0A5C6AA28      SNSR-------------------------------------------------------G
A0A2E9VK20      QKDQTSNS-----------------------------------------------QTVVS
A0A3D4PJK1      QKDQTSNS-----------------------------------------------QTVVS
A0A0S8GZ23      NNDPYVRE----------------------------------------------------
L0DC26          RDRSIELY----------------------------------------------------
A0A354PCQ3      PDPVFQPR----------------------------------------------RKHPSE
A0A1I3DDV4      DSESLTRL-----------------------------------------------GTFGS
A0A2E2N5A9      SVPAVLSD----------------------------------------------------
A0A2E3GWC6      QRDQQSNT-----------------------------------------------QTVMT
F0SLB0          QRDQQSNT-----------------------------------------------QTVMT
A0A2E0SMM6      GNELLGQE-----------------------------------------------LGLQD
A0A1N6DAJ8      RDRSIELL----------------------------------------------------
A0A5B9PJZ8      SETNM-------------------------------------------------------
A0A2S8G191      EEEENAPD-----------------------------------------------AKQDV
A0A2E7EGG1      REEVQRVL-----------------------------------------------VALNQ
A0A225EH48      NEKVAPKV----------------------------------------------------
A0A3L7NDH9      GKEAFLDS-----------------------------------------------VGLSS
A0A518INW8      GDPSGSGA-----------------------------------------------LRDDP
A0A518JPH9      GDVGSTGA-----------------------------------------------SREDP
A0A2E2CCW9      MGQTR-GQ-----------------------------------------------AANGN
A0A3C0AGX3      MGQTR-GQ-----------------------------------------------AANGN
A0A518AAQ5      MGQAR-GQ-----------------------------------------------AGAAA
A0A517QBG9      MGQAR-GQ-----------------------------------------------AGAAA
A0A518FTU3      MGQAR-GQ-----------------------------------------------TGTAA
A0A2E7K7A9      MGQAR-GQ-----------------------------------------------SGATT
A0A517PTS5      MGQAR-GQ-----------------------------------------------SGATT
A0A517WHH5      MGQAR-GQ-----------------------------------------------AGAVT
A0A5A8BGT3      MGQAR-GQ-----------------------------------------------AGAAT
A0A517VTK3      MGQTRGGQ-----------------------------------------------PGSTS
A0A517WQT4      MGQTRGGQ-----------------------------------------------PGSTS
A0A517VID8      MGQTR-GQ-----------------------------------------------AANKN
A0A517RK10      MGQTR-GQ-----------------------------------------------AGNAN
A0A518IH18      MGQTR-GQ-----------------------------------------------AGSAN
A0A5C5VEK8      -------------------------------------------------------FGSKS
A0A532UTJ0      NQDPTVVA----------------------------------------------------
A0A517NSK8      GDTMSEAF-----------------------------------------------VQDNP
A0A5C5Z0D6      GDVASEAF-----------------------------------------------QAEQP
M5UE94          GDVASEAF-----------------------------------------------QADQP
A0A1P8WN28      GEDVLERI-----------------------------------------------PGAGA
A0A3B9CTT0      GPEVMQQV-----------------------------------------------PGRPG
A0A5C5XLF4      QKDQTSNS------------------------------------------------QTVV
A0A2D5NDU9      KPLISPPE-----------------------------------------------ELSTP
A0A286RGB6      RTDPVILQ-----------------------------------------------LQLRE
A0A1V5N3W2      NSDPTLQM----------------------------------------------------
A0A3E0MY27      VRQRLISN-----------------------------------------------TLAAD
A0A2E0X9P6      NREDIREL----------------------------------------------------
A0A286RLF2      GQQILLGV-----------------------------------------------LGFSR
A0A5C5ZM48      GRDEQLRA----------------------------------------------------
A0A5B9WF77      PNEQIREE-----------------------------------------------FTRDP
A0A518BBX8      QKSKQTDT----------------------------------------------------
A0A518ALT3      DVRRLEDQ----------------------------------------------------
A0A517MDV3      GDANSDES----------------------------------------------FVAQQP
A0A3M1QRP3      DGAASAPA-----------------------------------------------PDRRF
A0A517TMV0      GEQAVLAA-----------------------------------------------MGMGP
A0A2E3RCU8      GRELLAKG-----------------------------------------------LGFST
A0A3E0MY88      GRSVLMTA-----------------------------------------------LGIND
A0A1C3E6N1      GKQFMMGE-----------------------------------------------LGLDS
A0A518GJT2      GKQFMMGE-----------------------------------------------LGLDT
A0A286RD13      SEEERRQRDEA-------------------------------------VIQQIVENALRA
A0A517MLW3      ARSLTAAV-----------------------------------------------LGVAP
A0A5B9QVD0      ARSLTAAV-----------------------------------------------LGVAP
A0A3B8PNV4      GKEFLLRR-----------------------------------------------MGLDS
A0A3D1DR40      GKEFLLRR-----------------------------------------------MGLDS
A0A2E7RYU8      GKEFLLRR-----------------------------------------------MGLDS
A0A3B8LXG8      GKEFLLRR-----------------------------------------------MGLDS
A0A350CI62      GRQLVEQS-----------------------------------------------MGLGT
A0A4P5WQK6      GRQLVEQS-----------------------------------------------MGLGT
A0A3C1X4W5      GRQLVEQS-----------------------------------------------MGLGT
A0A3D3W3A7      GRQLVEQS-----------------------------------------------MGLGT
A0A518DRX3      GRELLVSS-----------------------------------------------MGLGP
A0A518DZF9      GRELLVSS-----------------------------------------------MGLGP
F0SI78          -----RQR-----------------------------------------------AGQSS
A0A518IQ30      GRELMLNE-----------------------------------------------LGMSP
A0A517LWP4      GRELMLNG-----------------------------------------------LGMSP
A0A518JNW8      GRELMLNG-----------------------------------------------LGMSP
A0A2E7ENQ5      GREMALGM-----------------------------------------------LGMST
A0A1G3AQE9      GWEVLRNH-----------------------------------------------LGSSA
A0A3L7UQT9      GASILSKQ-----------------------------------------------MGLGE
A0A4P5YBU2      GASILSKQ-----------------------------------------------MGLGE
A0A518AKT8      GQQVLISS-----------------------------------------------LGMSS
A0A5C5ZR72      EVQQRERQ-----------------------------------------------ISQLR
A0A517TY85      DVRRLEEE-----------------------------------------------IEQLQ
A0A5B9QEI7      DVRRLEER-----------------------------------------------GDFIH
A0A5S9IJB5      ------------------------------------------------NKAKIISTPEIL
A0A1G2XVR0      ------------------------------------------------KDPTLTKLIPEI
A0A1G3B0P0      ------------------------------------------------KDPTLTKLIPEI
A0A1E3X4X0      ------------------------------------------------ERPEMIEAITPV
A0A286U4B3      ------------------------------------------------D----LSSLPGI
A0A5C6DDS2      ------------------------------------------------D----LSSLPGI
A0A0S8J591      ------------------------------------------------GTYENTRDTDLL
A0A2E3GW02      ------------------------------------------------ADQARQRAGQSS
A0A1U9NL64      ------------------------------------------------FVEAKRVSGLYV
A0A5B9QNZ7      GLIDARDVERL----------------------ALLVTVERGD-----ATTDESFVAQQP
A0A1U7CZ81      ------------------------------------------------KSQLEARINETF
A0A142YNY8      ------------------------------------------------EEELTERIQAAF
A0A1U7GLS6      ------------------------------------------------EEEVARRIEAEF
A0A1Z8N7H5      G-----------------------------------------------KELLIKGLGFNT
A0A1G2YPI3      ------------------------------------------------FIEAQRARGMYI
A0A532UIN2      ------------------------------------------------FIEAQRARGIYV
A0A532UD06      ------------------------------------------------FAGAAAGAGAQV
A0A660URN1      ------------------------------------------------FAMAQPNAGVRV
A0A0S8KNX5      ------------------------------------------------PGELLSMRQSYI
A0A3D3UVZ8      ------------------------------------------------PEELLKMRQDYI
E8R3W3          PRRDAEGKS------------------------DSNAASRSPAATSPGRLDSREIDDLVE
A0A517NFU9      ALLSQKEVERL----------------------KLFLDVTRG------ETQSEAFQAEQP
A0A5C5YWH4      ALLSHNEVERL----------------------KLFLDMTRG------ETQSEAFQAEQP
A0A3D2TNK4      G-----------------------------------------------QQVLLSSVGVSP
A0A0J1B4A0      SLLDADEIDRV----------------------NAFLAISANR-----DDQTNDEMLSRA
A0A142WSB9      SAGTGGGAEG--------------------------------------GGGGGGGGGGVL
M5SZR3          AMLISNAGVQL----------------------AAMDDDAEPMGLDRLRMDQKFHSLELE
M5TW92          AMLISNAGVQL----------------------AAMDDDAEPMGLDRLRMDQKFHSLELE
A0A2S8FKY2      PGVGDDATPRVPVSDADDSVDEVAENGDGDSNDGEVADLKLS------DVEMDEAIANDP
A0A517N8P6      -----------------------------------YAVFQEVQYLLDDVRDIEQMHQAIV
A0A432MJP4      --LREKGVGLA----------------------GIAYALGQF------RGDPGESLAISS
M5UQ35          AILTEEELSRL----------------------KTLVTLNRGD-----QDDLESVMLSRY
A0A5C5WTY6      ALIDVESLQRM----------------------GVFTDMQRD------AASSTEARAELP
A0A5C5Y033      ALIDSDSLERL----------------------GAFAGLQVS------ASNSAEFKAAMP
A0A5C6G1Y2      ALIDSDSLERL----------------------GAFAGLQVS------ASNSAEFKAAMP
A0A354PDV6      ALIDSESMQRL----------------------GLYASLQVN------AASTADFQATQP
A0A5C6FZ02      ALIDSESLERL----------------------GLFAGLQIS------ASNTAEFKATMP
M5TIT3          ALIDSESLERL----------------------GVFAGLQMN------AADSPEFKAAMP
A0A5M6CY44      SLIDSESLERL----------------------GLFTGLQMN------SSNTAEFKAAMP
F2AXG2          ALIDSESLERL----------------------GVFAGLQMN------SANTAEFKAAMP
M2BB46          ALIDSESLERL----------------------GVFAGLQMN------SANTAEFKAAMP
L7CLQ6          ALIDSESLERL----------------------GVFAGLQMN------SANTAEFKAAMP
A0A0J1B719      ALIDSDSLERL----------------------GVFAGLQMN------SANTAEFKAAMP
Q7UF18          ALIDSESLERL----------------------GVFAGLQMN------SANTAEFKAAMP
A0A2G1W1E0      ALIDSDSLERL----------------------GVFAGLQMN------SANTAEFKAAMP
K5E235          ALIDSDSLERL----------------------GVFAGLQMN------SANTAEFKAAMP
A0A5C6FFI9      ALLSQKDVTRL----------------------KLFLDMTRG------ESQSETFQAEQP
A0A3A0DET7      ------------------------------------------------FLLDMAGDDQQA
A0A5C5WDJ1      ALLSQKEVERL----------------------KFFLDMARG------GAQSEAFQAAQP
A0A5C5X547      DPSLRAPLPPL----------------------PVGQSTNQWVLTEEILEEEYAFDPEIR
A0A2A2W9R6      ALLTEEDIARL----------------------ETLVSIAKER-----KGGDSGMDIARI
A0A518HKC1      TLLTEDDMARL----------------------QTLVSIAKER-----KAKDDGLDIARI
A0A518L3P0      TLLTEEDIARL----------------------QTLISIAKER-----KAGDDSLDIARI
A0A255R1S0      TLLSKEDISRL----------------------QMFMDFAEGRSKVEEKALTEEERMALA
A0A5B9MKP1      TLLSDTEVTRL----------------------QALISIKKQR-----QPGSAGESESQA
A0A0S8FY64      ----------------------------------------------------ELLSISIV
A0A1N6KFT7      ---------------------------------NSEATVSED------DVAGSFKLDPNV
L0DFG4          ---------------------------------NAEGKVTED------HVAGSFKLDPYV
A0A5C5XXG1      ALIDSESLERL----------------------GLFAGLQIS------ASNTAEFKATMP
A0A518BJJ1      ---------------------------------GAYGFLSAN------SNAPGITVDPLT
A0A518D182      ---------------------------------GAFAGLSSS------PSS-GATVDPLT
A0A353FIP5      VELDPQ------------------------------------------------------
A0A5B1CIK7      ALIDSESLERL----------------------GVFAGLQMS------ASNTAEFKSAMP
A0A5C5WHS2      ALIDSESLERL----------------------GVFAGLQMN------SANTAEFRAAMP
A0A5C6B6G8      ALIDSESLERL----------------------GLFAGLQMN------SSNTAEFKAAMP
A0A5C5ZZN3      ALIDSESLERL----------------------GVFAGLQSN------AADTAEFKAAMP
A0A5C5XS91      ALIDSESLERL----------------------GVFAGLQMN------ASNTAEFKAAMP
A0A5C6C4E6      ALIDSESLERL----------------------GVFAGLQMN------ASNTAEFKASMP
A0A2E1VVJ1      IELDPL------------------------------------------------------
A0A3M2AEL0      PDLDPV------------------------------------------------------
A0A532UT69      --------G---------------------------------------PYGTNGEKAALE
A0A2D5AWU0      QNPNLE-----------------------------------------------PELQEIE
M5RT57          RIAEVDVEM---------------------------------------AVGESQEVLDLR
A0A356KTN1      QGRPLESAS---------------------------------------PIATNHIVLNLR
A0A518HFS8      AHRDLGFEG---------------------------------------LIGRDPVVAKLR
                                                                            

A0A5S9IPR9      VQN--------------AMIDDLQKKKFLYENQLR-DLKTRY--KPAH-PSIKKTINNIA
A0A533Q9U4      -----------------PLIQNLKADYARVENDFS-LYSQRY--GMKH-PKIAGLKAELD
A0A1U9NNE1      -----------------LTIKALTEDMAKLERDVLGDQQTMV---SGN-PRLEQRKEILT
A0A2G2JCA2      -----------------ARIATNGSTALEYEKTAV---------NFKDNATYQKLQKQIL
A0A533Q6B7      -----------------DLIQNLKGESIRIQNEIS-LYSNRY--GPKH-PKVVQLNTELH
A0A351FYP6      DAQ----------------LDALIREYQTGQTTLA-NKSIDL--GEGH-PTIKSLKAAME
A0A2E7ESJ6      ----------------SSRLALMQDRYMALVLQQE-ELEGRY--GKDH-PDVLTVRRQLE
A0A1G2YQB7      -------------------VANLEQVLITAKQQLA----------STN-PELARKESLLS
A0A353P687      -------------------VANLEQVLITAKQHLA----------PTN-PELARKESLLN
A0A356EME5      Q------------------VQALVQQIWMAETTLREMAALAR--NPSQDPQCVKLSQDLE
A0A355AI52      RDK--------------QTRISVEKQLLEDRAQLD-TLQEYY--GPNH-PKVIERTRKIE
A0A3L7SI46      NDA--------------YTVAKHQDELLQDQAELQ-NRLMTL--GPKH-PTIRQLEDRIQ
A0A3L7P4E4      TPT--------------QKFTREIFQLELEEALAL----QDH--GEDH-PKVRSIRKRIE
A0A3L7PEB5      TPM--------------QKFTREIFQLELEEELAL----LDL--GEDH-PKVQSIRKRIE
A0A2N1UCJ3      -AR--------------DMETKLRDELQSLETELE-NALIQC--SEGH-PTVKALKSRIE
A0A517ZCB5      GDV--------------YTQSRMQQELLSAQTELR-NKLSFY--GPKH-PEILELQDKIR
A0A432MFP3      RDV--------------E------ARIAEARTRIR---------NPGD-PALSRLMSQRQ
D5SZ21          QEG--------------MAISRMTEQLLQEQAKMR-TALESY--GPNH-PKVMELRDAIQ
A0A518CHE5      QDR--------------LIVSRLQDQLKVDQAELK-SKLTTL--DYNH-PDVMVLTNRIQ
A0A257WS34      QDG--------------FILARFEQQLQEYQAQLQ-SLLAKL--GPAH-PEVQALEERIA
A0A2E8FLY0      QDS--------------WMVMRVRQQLINDQVELR-NKSGEF--GPNH-PAIQRLVARIR
A0A3D2U1E1      QDS--------------YLDGRTRQQLINDQVAYR-NDSAEL--GPNH-PRMQMLSARIK
A0A1P8WP26      QSV--------------FQTTQITQDLFDLEAQLQ-TAMKSY--GAKH-PTIIDLQNQIA
A0A3L7V1F3      QDA--------------FLIQRINQELLDLESQLS-DARTRY--GENH-SKIKALTENIQ
A0A5B9QF68      EDL--------------NVIEEQQKQILASQAELS-SLSKFY--GPNH-PRILDLQNRIA
A0A5B9QGF0      EDL--------------SVIEEQQKQILTLQAELS-SLSKFY--GPNH-PRILDLQTSIA
A0A5C6CK24      EDL--------------SVIEEQQKQVLAAQAELS-SLSNFY--GPNH-PRILDLQKSIA
A0A2E8B0L9      EAT--------------DLVNSVERKLLADRARLD-TARDYL--GPTH-PEVQELVRNIR
A0A5Q4GFE7      KDM--------------ETRAQIERRLMEDQTRLE-SLQQHY--GRAH-PKVIELMQQIQ
A0A2E3GWX1      RDQ--------------YVYARLQQQMIEDKAKLRDKLNNKL--GPNH-PEVQELQQRID
F0SG60          RDQ--------------YVYARLQQQMIEDKAKLRDKLNNKL--GPNH-PEVQELQQRID
A0A2E9VST2      RDS--------------YAYARLQQQLIEDEASLRDKLNGKL--GPNH-PEILELKERVK
A0A356A6X2      RDS--------------YAYARLQQQLIEDESSLRDKLNGKL--GPNH-PEVLELQERVK
A0A5C5XLM3      RDS--------------YAYARLQQQLIEDEASLRDKLNGKL--GPNH-PEVLELQERVK
A0A3M1VCL4      QDA--------------LVLSRVEQQLRSDYAELQ-RRLAFL--GPNH-PRILSLRDRIR
A0A5C5V7Z9      QDL--------------EMLSSQQKRLMETQDELR-RLTPHY--GPNH-PRVVSLTEQAA
A0A5C5YT05      QDM--------------EMLTSQQQRLMETQDELR-RLSPHY--GPNH-PQIKELTEQVA
A0A518D7F9      DDL--------------ALIAQQRQKLLEDEQELR-RVAPFL--AENN-PTVTALNERIA
A0A5C5ZIP0      NDV--------------RAMADQQTRLFDVEAQLS-RLEPFY--GPAH-PEVVALSTQAQ
A0A518KBK3      NDM--------------EVLAKQQAKLIDLRDELG-RLEPFY--GPSH-PQVATLKSQID
A0A5C6AKF9      NDI--------------EVLAAQQSKLIGVRDELR-RVEPFY--GPSH-PQVVTLRSQIE
A0A2E0X4J3      LAL--------------Q---EQVQAIEMQIVAEQ----SRW--GEGH-PRVEVLLTSLE
A0A5C5YU10      DDL--------------EALLNQQQELELLLMAEQ----AKW--GDAY-PTVKSIQRSLD
A0A517MPZ6      VDL--------------E---KQIQDIQLQIDALR----ATW--GDGH-TRVKLALQSKA
A0A5C6CNV7      LDL--------------E---NKIRDLDLQIASLQ----STW--GDGH-PRVRIMLESRE
A0A518K5H4      GDL--------------D---GQIQMMEQNLIAQQ----AKW--GPGY-PAVRLLEESLA
A0A5C6AA28      SDL--------------E---GQIQSVEQSLVSQQ----TKW--GPGY-PSVRLLQDSLD
A0A2E9VK20      GAT---------------ERQQLDSQLIPLLLEEQ-AALKRY--GSGH-PDVINVRKRID
A0A3D4PJK1      GAT---------------ERQQLDSQLIPLLLEEQ-AALKRY--GSGH-PDVINVRKRID
A0A0S8GZ23      ----------------------TTAILVQLQMELS-SYKQRL--TLKN-PEIERITKSIE
L0DC26          -----------------KEKEGLAQRAIDRVYRIA-R-------NKND-PAIKKHRDDLE
A0A354PCQ3      SEIEQLVDRDPKVAEAKTRISRYKSIMINMEDSDL-VRVRREYYEENR-AKMKDWEQRLQ
A0A1I3DDV4      FSSAQTQDFQENQATRLKEAETKFGKLIELQAEMS-RLNGLF--GPNH-PTVENLRKNIE
A0A2E2N5A9      -----------------PVIQQFKATKAQAAARVD-EVSQRY--GPGH-PELIAAKADLD
A0A2E3GWC6      GTS---------------ERQQLDSQLLPLLLEEQ-VLLQRY--NDGH-PDVINIRKRID
F0SLB0          GTS---------------ERQQLDSQLLPLLLEEQ-VLLQRY--NDGH-PDVINIRKRID
A0A2E0SMM6      RVV----------------VSRLQDQLKADQAELK-SKLATL--DYNH-PDVVVLTNRIS
A0A1N6DAJ8      -----------------KARESAAIKAIERVYHIA-R-------NRSD-PSLKKYRDELE
A0A5B9PJZ8      -----------------GAYTSTHNKYVELKMLEQ-ELLQQY--GSNH-PELKNVRKQIA
A0A2S8G191      PLEEDSDVELQNILASDEVIAALKSQIMQLEAEIL-NVEQTAVPGIQE-QYVGKYRDTIV
A0A2E7EGG1      KKA---------------------------LRDQA-LNASSR--GGTD-PRIIKLNQDIE
A0A225EH48      -----------------EARNIAIAQFEKLKTAVK-EDSPLY--AREK-DHLAKLEEDLR
A0A3L7NDH9      RDK--------------DTRTSLEKQLFEERTQLE-TMLEFY--GPQH-PKVIERTNKIR
A0A518INW8      QRT--------------AALNLEHTKVLGLMLREQ-ALTADY--GDDH-PLVQRVRDELA
A0A518JPH9      LRA--------------AAINLEHTKVLGLMLREQ-ALTADY--GDEH-PLVQRVRDELT
A0A2E2CCW9      ASE-GHHLATPGTSQLDRARTALETHLMPLLIQKN-RLERDF--QKNH-PDLDAVNRSIE
A0A3C0AGX3      ASE-GHHLATPGTSQLDRARTALETHLMPLLIQKN-RLERDF--QKNH-PDLDAVNRSIE
A0A518AAQ5      GGV-ETQALAPGNTQVERARAALETHLMPLLIQKN-RLERDF--KKNH-PDLDAVNRSIE
A0A517QBG9      GGV-ETQALAPGNTQVERARAALETHLMPLLIQKN-RLERDF--KKNH-PDLDAVNRSIE
A0A518FTU3      GGV-ETQALAPGNTQVERARAALETHLMPLLIQKN-RLERDF--KKNH-PDLDAVNRSIE
A0A2E7K7A9      GGV-ESQAITPGNTQVERARLALETHLMPLLIQKN-RLERDY--KKNH-PDLDAVNRSID
A0A517PTS5      GGV-ESQAITPGNTQVERARLALETHLMPLLIQKN-RLERDY--KKNH-PDLDAVNRSID
A0A517WHH5      GGV-ESQAIAPGNTQVERARLALETHLMPLLIQKN-RLERDY--KKNH-PDLDAVNRSID
A0A5A8BGT3      GGV-ESQAIAPGNTQVERARLALETHLMPLLIQKN-RLERDY--KKNH-PDLDAVNRSID
A0A517VTK3      SA--GASISAPGTSNLDRARTALETHLMPLLIQKN-RLERDF--GENH-PDLDAVNRSIK
A0A517WQT4      SA--GASISAPGTSNLERARTALETHLMPLLIQKN-RLERDF--GENH-PDLDAVNRSIK
A0A517VID8      TS--EGRIATPATSQLDRARTALETHLMPLLIQKN-RLERDF--QKNH-PDLDAVNRSIE
A0A517RK10      AN--QGQIATPNTTQVDRARAALETHLMPLLIQKH-RLERDY--QKNH-PDLDAVNRSIE
A0A518IH18      GNTSQGQIATPNTTQVDRARTALETHLMPLLIQKH-RLERDF--QKNH-PDLDAVNRSIE
A0A5C5VEK8      DLD--------------RDLERLRNQAQDLELALM-TEQSKW--GDEY-PTVKSIQRSLD
A0A532UTJ0      ----------------------FTNHITQADQELI-SMRLIL--QPEN-PDLKRKAELLE
A0A517NSK8      IRQ--------------ETAKAEYNDYLNLVMREK-KLTENF--GDDH-PTVVSIREQIT
A0A5C5Z0D6      IRQ--------------ETARAEYDEYLQLVMKEK-KLAEKF--SEGH-PQVVSIREQID
M5UE94          IRQ--------------ATAQAEYDEYLTLVMKEK-KLREKF--SDGH-PQIVSLREQIE
A0A1P8WN28      TDP--------------KAIEELRAKVALLETELN-GLRRHF--GSGH-SDIIRREQQLV
A0A3B9CTT0      LDV--------------KAIETLEDKLNDEQGELS-VLRRHY--GSGH-PEIISRTSKIQ
A0A5C5XLF4      SGA--------------TERQQLDSQLIPLLLEEQ-TALKRY--GSGH-PDVINVRKRID
A0A2D5NDU9      SAE--------------AAILAQVEKLGNQRVEL----LVEL--QPEH-WRVAALDRDIA
A0A286RGB6      SEL--------------KNLVAQTRDVLRPEIAAR-YGNRYV--QELA-DVQSRIKARRE
A0A1V5N3W2      ----------------------LTQRVAQLEETLV-MAQQTL--APTN-PEIEQQTKTLE
A0A3E0MY27      QQY--------------GQLRGVVERLRDQEQEMM-KLIKN---PDRS-EVMKRLREQIA
A0A2E0X9P6      --E--------------SRLAAQRDRLTRIRKGTQ-KYAETL--ADVH-DAQSALNERKR
A0A286RLF2      EET--------------AARLEVERKVVEDRVELA-RLLQEF--GNNH-PRVQALQQRIA
A0A5C5ZM48      --------------------WREQQMLMESRVESY-RQTMRR--PEQS-REYRDLNAGLQ
A0A5B9WF77      EVI--------------ELVDRIKQVKNELDHLES-ISRKK-----SD-PSRKAAQTQLS
A0A518BBX8      -KD--------------DSRLNLDNQLFPLLLSER-ELAVDF--GPDH-PKLKMLRDRIQ
A0A518ALT3      -------------------IRDIEQQITEIKSKPR-PRISDT--WEKD-PDYLRVNALLI
A0A517MDV3      MRT--------------TAANTEMDSLLSLKVRLR-EERSRL--GDAH-PKVQDLQDAVQ
A0A3M1QRP3      SED--------------SVWRTLSAELKKAEFEVE-SARDQF--GESH-PTMVRLRRQVD
A0A517TMV0      NDL--------------EVLAVQQSRLLDLRMELQ-KVAPFY--GPAH-PQVATLQQQVA
A0A2E3RCU8      DTI--------------HTRSQLEQGLIEDIARLK-SLSSDF--GPSH-PKIIEIQNRIQ
A0A3E0MY88      RDV--------------VGHTNLERTLLQDRATVQ-GLLENL--GPNH-PRVKEMTEKIR
A0A1C3E6N1      QEG--------------MAISRMTEQLLQEQAKMR-TALESY--GPNH-PKVIELRDAIQ
A0A518GJT2      QED--------------MAISRMTEQLLQEQAKMR-TALESY--GPNH-PKVMELRDAIQ
A0A286RD13      DPW--------------IAAAQARLSYLETRWFEE-RQRAAQ--GEKA-PSAQRIQEEME
A0A517MLW3      EQM--------------RSIHVLEQKLLSDRAEVM-RLEKHL--GPTH-PSMVALQGEIS
A0A5B9QVD0      EQM--------------RSVHALEQKLLNDRAELQ-TLAAHY--GPTH-PEIQQLNAEIA
A0A3B8PNV4      QDT--------------WMVMRIRQQLINDQVELQ-NKSGEY--GPNH-PLIQKLTARIR
A0A3D1DR40      QDT--------------WMVMRIRQQLINDQVELQ-NKSGEY--GPNH-PLIQKLTARIR
A0A2E7RYU8      QDS--------------WMVMRVRQQLINDQVELQ-NKSGEY--GPNH-PLIQKLTTRIR
A0A3B8LXG8      QDS--------------WMVMRVRQQLINDQVELQ-NKSGEY--GPNH-PLIQKLTTRIR
A0A350CI62      QDS--------------YHVQRIMQEILDRQSALT-EARQKY--GAKH-ARIRALETELA
A0A4P5WQK6      QDS--------------YHVQRIMQEILDRQSALT-EARQKY--GAKH-ARIRALETELA
A0A3C1X4W5      QDS--------------YHVQRIMQEILDLQSHLT-EARQKY--GARH-ARIRALEAELQ
A0A3D3W3A7      QDS--------------YHVQRIMQEILDLQSHLT-EARQKY--GARH-ARIRALEAELQ
A0A518DRX3      EFA--------------TNLRQIERQLIDERGQLN-NMLAHY--GEAH-PKVIALRNSIV
A0A518DZF9      EFA--------------TNLRQIERQLIDERGQLN-NMLAHY--GEAH-PKVIALRNSIV
F0SI78          AEG--------------VQNASITSQLIPLMLEES-MLLEKL--GEQH-PKVSEVRRRTE
A0A518IQ30      RFA--------------EVADRMEQRLLADRALLQ-SQAKHF--GPVH-PKIQMLQQKIA
A0A517LWP4      RFA--------------QVADEMEQKLLADRALLQ-SQAKHL--GPVH-PTIQMLQQKIA
A0A518JNW8      RFA--------------QVADEIEQKLLSDRALLQ-SQAKHL--GPVH-PKIQMLQQKIA
A0A2E7ENQ5      KDE--------------DFAKQLKRELNDDYARLE-SIQDYY--GSNH-PTFIEVRQSIL
A0A1G3AQE9      DDG--------------LQAA-LEKNLVDYRAEWE-TKRKNL--GDNH-PELIALEDKIR
A0A3L7UQT9      QDA--------------WAVAKLNEELQKLRNDWN-DRRNVL--GDNN-PDLLELAQRIR
A0A4P5YBU2      QDA--------------WAVAKLNEELQKLRNDWN-DRRNVL--GDNN-PDLLELAQRIR
A0A518AKT8      DDL--------------SSIRERERERLEAEREMQ-SLSPYL--GPNN-PRMLELKARID
A0A5C5ZR72      SGL--------------RELRKTVKHP-----Q-------------SN-RDYMALSERVR
A0A517TY85      DQM--------------SAIKVKSRTKIGDSWS-------------SD-PEYLSLEAAAK
A0A5B9QEI7      QQM--------------AEIKSQPRLKKDVTWE-------------ED-PQYIQLQEQAK
A0A5S9IJB5      KSR--------------TIQELKVQSLVVDQEIQSLVTGRNL--GINH-PQVVALKSKKK
A0A1G2XVR0      VKD--------------GSINTLKAKYADLQANKTMLS-EKY--GEKH-PNIANIDLQLK
A0A1G3B0P0      VKD--------------GSINNLKAKYADLQANKTMLS-EKY--GEKH-PNIANIDLQLK
A0A1E3X4X0      IEN--------------RLIQDLKADYARLEAQVSNLS-EKY--GPRH-PQMVRLLTQME
A0A286U4B3      ADN--------------KLINELKLEYTRLNAKYASEL-GRV--KEDH-PLVQRLKTEKS
A0A5C6DDS2      TDN--------------VLINELKLEYTKLQAKYAGEL-DRV--KEDY-PLVQRMKAEKD
A0A0S8J591      QRL--------------RERLYAYQEIVELEKEDKT---RRY--RDQD-RLSRNMEVRVE
A0A2E3GW02      AEG--------------VQNASITSQLIPLMLEESMLL-EKL--GEQH-PKVSEVRRRTE
A0A1U9NL64      SSG--------------TENTRLKAELDRLELRLADLK-RQV--TEDH-PSVIALEEKIA
A0A5B9QNZ7      QRT--------------TTATTEMDSLLTLKVRLREEQ-SRL--GSEH-PRVLELRDTVR
A0A1U7CZ81      RRD--------------PSVASLIQQILETDEELAHTV-GVA--RKGYDPARQAAEKRKA
A0A142YNY8      LAD--------------PAIADLRDEILTVRDRLSHVV-SNA--RKGNDPSKRAHEARLK
A0A1U7GLS6      RSD--------------PMIADLYGQKQEVERRRDHVQ-KGA--RKVADPSRVAHDARLA
A0A1Z8N7H5      ENI--------------QVRNQLEQGLLADISSLKSLS-SDF--GPAH-PRIIEIQNRIQ
A0A1G2YPI3      PQD--------------SEKAKIKSRLDELQDRLAGSL-RQM--TPGH-PVVIAIESDIS
A0A532UIN2      STD--------------SAKASLRSKLDQLELRRADRR-RQL--KSSH-PAVMALETEIA
A0A532UD06      SGS--------------DRETQLRAELRRVEMDLENAR-YHC--TEDH-PSVKAIQSEIH
A0A660URN1      FVN--------------DVQSQLQSELKDLELQLANAK-LHC--TEDH-PSIEAIRGRIK
A0A0S8KNX5      NED--------------PAVVAFTANITELEQELVVAK-QTL--SPTN-PEIELKAELIQ
A0A3D3UVZ8      NQD--------------PAVVAFTGNITQLEQDLIIAQ-QTL--TAEN-PELIRKNELLK
E8R3W3          EYL--------------QRDRNLLTAQVRLQTIKDSMK--KF--RNTQDPSYKKLETELR
A0A517NFU9      IRQ--------------EVAKAQYNRMLDLIQKERGFS-DAF--GAGH-PLVEAVRQEIE
A0A5C5YWH4      IRQ--------------EVAKAQYNRLLDLIQKEQSLA-DAF--GPGH-PLVEAARQEAE
A0A3D2TNK4      QDM--------------QVLGDQQKKLFTAQQELQNLS-MHY--GPNH-PRIIELQQDVR
A0A0J1B4A0      VMQ--------------ESTRTEYQQLLTLSSKERLMA-AEF--GENH-PSVRALRTELD
A0A142WSB9      QGP--------------SGKAELDGRLLAARLVESRLS-QLV--GDNH-ADLKNVRSEIT
M5SZR3          DER--------------DLAEGLEAMLLPLKQQERELL-TLF--GPGH-PTLASVRLRIE
M5TW92          DER--------------DLAEGLEAMLLPLKQQEQELL-TLF--GPGH-PTLASVRLRIE
A0A2S8FKY2      VSV--------------K-LQAELDRFEDVRFTLTEAAYERY--RQTNSAEINAIETSLK
A0A517N8P6      EAP--------------NDNLELQTQLMDLRVQAEMLA-IQF--AANH-PQRLTVEQKLK
A0A432MJP4      SAG--------------RSQALASDYVRQLINEQQRLA-DRF--GADY-SRVRDIEEQIA
M5UQ35          LSQ--------------QSAKLEYDKMLELSSKLSFLR-LTL--GGGH-PSVREVENEIE
A0A5C5WTY6      GEV--------------ERARIEISQVLELSSERQRLV-SVF--GSKH-PKVADIEKQIT
A0A5C5Y033      AKM--------------EEARAQVTRLLMLNAEREKLT-AVF--GSGH-PKVREINNEIQ
A0A5C6G1Y2      AKM--------------EEARAQVTRLLMLNAEREKLT-AVF--GSGH-PKVREINNEIQ
A0A354PDV6      ARI--------------AEAQTQYNNVLQLMSEKQRLT-TVF--GPSH-PKVKDIQDQID
A0A5C6FZ02      VRA--------------EEARTRFAYLLKLNSEKQRLQ-AKF--GASH-PDVQDIDDEIR
M5TIT3          AKA--------------EEARTQITHLLQLSSEKQRLS-SVF--GAAH-PKVQELEGEIA
A0A5M6CY44      AKI--------------EEARTQFTHLLQLNSEKQRLN-AVF--GPGH-PKVQEIEGEIE
F2AXG2          AKA--------------EEARTQITHLLRLTSEKQRLT-SVF--GPGH-PKVQELESEIT
M2BB46          AKM--------------EEARTQITHLLRLNSEKQRLT-SVF--GPGH-PKVQELESEIT
L7CLQ6          AKA--------------EEARTQITHLLRLNSEKQRLT-SVF--GPGH-PKVQELESEIT
A0A0J1B719      AKA--------------EEARTQITHLLKLNSEKQRLT-SVF--GPGH-PKVQELESEIT
Q7UF18          AKM--------------EEARTQITHLLRLNSEKQRLT-SVF--GPGH-PKVQELESEIT
A0A2G1W1E0      AKM--------------EEARTQITHLLQLNSEKQRLT-SVF--GPGH-PKVQELESEIT
K5E235          AKM--------------EEARTQITHLLQLNSEKQRLT-SVF--GPGH-PKVQELESEIT
A0A5C6FFI9      ARA--------------EAARAQYSRLLDLLQKERTLV-SVY--GVSH-PLIKSTREEID
A0A3A0DET7      LRD--------------IELERQVQEVEQALASER----ARW--GEGH-PRVKLLRQSLA
A0A5C5WDJ1      MRA--------------EVAKAQYNRLLDLIQKEKALS-DTF--GPEH-PLVEAAREETM
A0A5C5X547      RLN--------------DEKEALEEKFQALAKRLQGSGLEKS--RQQYESDLAKIDDDLN
A0A2A2W9R6      VAN--------------TSSTSKVNRLMELLSQRQVMR-ASY--GAGH-PSVVALDTEIA
A0A518HKC1      VAN--------------TSSTSKVNRLMGLLSQRQVMR-ATY--GAGH-PSVVALDTEIA
A0A518L3P0      VAN--------------TSSTSKVNRLMGLLSQRQVMR-ATY--GAGH-PSVVALDTEIA
A0A255R1S0      LER--------------QAQQEEFRRLMALTTRRDVMR-ATF--GDSH-PSVRSLDSEIV
A0A5B9MKP1      IAR--------------SSRQSAAQRLLELTSKRRVLV-TAF--GMGH-PSVVALDAEIR
A0A0S8FY64      RSD--------------PAVAELYGRLTQIDLDLQGAL-RSF--GLKH-PEVVALNDERE
A0A1N6KFT7      A--------------------ELYRDLKRAQLRYDTAKRATR--NTND-PSLKYARERKV
L0DFG4          A--------------------ELYRDLKRAQVRYNTAKRATR--NTND-PSLQYARDRKE
A0A5C5XXG1      VRA--------------EEARTRFAYLLKLNSEKQRLQ-AKF--GASH-PDVQDIDDEIR
A0A518BJJ1      T--------------------GYLSEIARLEGEIASLQ-HEF--LPGY-PPLAQAIAALD
A0A518D182      L--------------------GYLAELGRLQSQREVLA-STY--TVEH-PERARIERAIV
A0A353FIP5      -------------------TSSMLQELAGLIAQARALE-EKH--TEKW-PPLIRLRGQIK
A0A5B1CIK7      AKM--------------EGARAEITHLLQLNSEKQRLT-AVF--GPGH-PKVQDIQGQIE
A0A5C5WHS2      AQT--------------EKARAEITHLLQLNSEKQRLT-AVF--GPGH-PKVQDIQSEIE
A0A5C6B6G8      AKM--------------EEARTQITGLLRLNSEKQRLT-AVF--GPGH-PKVQELENEIQ
A0A5C5ZZN3      AKM--------------EEARTQITHLLQLNSEKQRLS-SVF--GPAH-PKVQELESEIT
A0A5C5XS91      AKV--------------EEAHTQITHLLELNSEKRRLS-SIF--GAAH-PKVLEIQNQID
A0A5C6C4E6      AKA--------------EEAHTQITHLLELNSERQRLA-ALF--GAGH-PKVQEIENQIA
A0A2E1VVJ1      -------------------LQSLFQALQKVDADAAELA-IEY--TDEW-PALKELRERSV
A0A3M2AEL0      -------------------TRTMLQELGDLKAKRIRLR-AVY--TDQW-PELVELNQRIE
A0A532UT69      TRL--------------EQLQLRLSDRLQWVTREF--------------PAITALEAEIL
A0A2D5AWU0      KDL--------------LEKELQLQ-------------RRER--DQGD-LLLAELRDEVA
M5RT57          ALI--------------ADRKSMMHRVES---------TAAG--GRND-PSYLRLEAEVE
A0A356KTN1      NRL--------------SEAELDLAGLRQRFSDEWHEVRIAR--ARRD-QIKLQLQSEIE
A0A518HFS8      ADL--------------AEYSGRLEQVR----------RIVR--NPGE-PSRKRLEQAVA
                                                                            

A0A5S9IPR9      QVKKQIFH----------------------------------------------------
A0A533Q9U4      TMRDNIMK----------------------------------------------------
A0A1U9NNE1      ALKTRLDQ----------------------------------------------------
A0A2G2JCA2      ADKEDLAK----------------------------------------------------
A0A533Q6B7      TMRNHIIK----------------------------------------------------
A0A351FYP6      SLNQQIDN----------------------------------------------------
A0A2E7ESJ6      RYETTYPE----------------------------------------------------
A0A1G2YQB7      ALKQRLEE----------------------------------------------------
A0A353P687      ALKQRLEE----------------------------------------------------
A0A356EME5      RNKKSLEQ----------------------------------------------------
A0A355AI52      QMQGYLAQ----------------------------------------------------
A0A3L7SI46      QTQTWLSE----------------------------------------------------
A0A3L7P4E4      MTRKYLSN----------------------------------------------------
A0A3L7PEB5      MTRKYLSN----------------------------------------------------
A0A2N1UCJ3      AAQNKLA-----------------------------------------------------
A0A517ZCB5      ITQQYLTD----------------------------------------------------
A0A432MFP3      ILMEQYEQ----------------------------------------------------
D5SZ21          AKEQWMAS----------------------------------------------------
A0A518CHE5      SAEDALQQ----------------------------------------------------
A0A257WS34      ATQNYIVN----------------------------------------------------
A0A2E8FLY0      DRQKWLAD----------------------------------------------------
A0A3D2U1E1      ARQQWLSK----------------------------------------------------
A0A1P8WP26      TKRNFMTQ----------------------------------------------------
A0A3L7V1F3      LKKKYLEE----------------------------------------------------
A0A5B9QF68      NSQQYVRD----------------------------------------------------
A0A5B9QGF0      NSERYVRE----------------------------------------------------
A0A5C6CK24      NSERYVRE----------------------------------------------------
A0A2E8B0L9      NAEQHIQE----------------------------------------------------
A0A5Q4GFE7      AGRQYLMN----------------------------------------------------
A0A2E3GWX1      GTNEWLEN----------------------------------------------------
F0SG60          GTNEWLEN----------------------------------------------------
A0A2E9VST2      AARDWMNG----------------------------------------------------
A0A356A6X2      AARDWMNG----------------------------------------------------
A0A5C5XLM3      AARDWMNG----------------------------------------------------
A0A3M1VCL4      ANEQYVTQ----------------------------------------------------
A0A5C5V7Z9      ALQQYLSN----------------------------------------------------
A0A5C5YT05      ALQQYLSS----------------------------------------------------
A0A518D7F9      ATKQYLAG----------------------------------------------------
A0A5C5ZIP0      AIKKYLAE----------------------------------------------------
A0A518KBK3      STQQFLAS----------------------------------------------------
A0A5C6AKF9      ATEQYLAS----------------------------------------------------
A0A2E0X4J3      TLQLRLAE----------------------------------------------------
A0A5C5YU10      QSGLRIEA----------------------------------------------------
A0A517MPZ6      AMEERLAK----------------------------------------------------
A0A5C6CNV7      KLQARLDK----------------------------------------------------
A0A518K5H4      KLRERRAE----------------------------------------------------
A0A5C6AA28      KLRSKQAE----------------------------------------------------
A0A2E9VK20      LVKSYYRQ----------------------------------------------------
A0A3D4PJK1      LVKSYYRQ----------------------------------------------------
A0A0S8GZ23      TFEKDLEI----------------------------------------------------
L0DC26          AARAGLAA----------------------------------------------------
A0A354PCQ3      EAKLAARD----------------------------------------------------
A0A1I3DDV4      IVEGLLKE----------------------------------------------------
A0A2E2N5A9      AATASLKT----------------------------------------------------
A0A2E3GWC6      IILSYYRK----------------------------------------------------
F0SLB0          IILSYYRK----------------------------------------------------
A0A2E0SMM6      AAEESLNQ----------------------------------------------------
A0A1N6DAJ8      AARAELVA----------------------------------------------------
A0A5B9PJZ8      MVDSMRMQ----------------------------------------------------
A0A2S8G191      ELEEHVRL----------------------------------------------------
A0A2E7EGG1      SLESTLES----------------------------------------------------
A0A225EH48      TTLEEFRS----------------------------------------------------
A0A3L7NDH9      KIEQYLDQ----------------------------------------------------
A0A518INW8      SVRQYIRE----------------------------------------------------
A0A518JPH9      SVRNYINE----------------------------------------------------
A0A2E2CCW9      TIINLYRR----------------------------------------------------
A0A3C0AGX3      TIINLYRR----------------------------------------------------
A0A518AAQ5      TIVNLYRR----------------------------------------------------
A0A517QBG9      TIVNLYRR----------------------------------------------------
A0A518FTU3      TIVNLYRR----------------------------------------------------
A0A2E7K7A9      TIINLYRR----------------------------------------------------
A0A517PTS5      TIINLYRR----------------------------------------------------
A0A517WHH5      TIINLYRR----------------------------------------------------
A0A5A8BGT3      TIINLYRR----------------------------------------------------
A0A517VTK3      TIVNLYRK----------------------------------------------------
A0A517WQT4      TIVNLYRK----------------------------------------------------
A0A517VID8      TIINLYRR----------------------------------------------------
A0A517RK10      TVINLYRR----------------------------------------------------
A0A518IH18      TVINLYRR----------------------------------------------------
A0A5C5VEK8      QAEQRIVQ----------------------------------------------------
A0A532UTJ0      TLKNHLKQ----------------------------------------------------
A0A517NSK8      MMRKFIDD----------------------------------------------------
A0A5C5Z0D6      LMRQFIDE----------------------------------------------------
M5UE94          MMRKFIDN----------------------------------------------------
A0A1P8WN28      GQKQRLAN----------------------------------------------------
A0A3B9CTT0      LFEQRVKA----------------------------------------------------
A0A5C5XLF4      LVKSYYRQ----------------------------------------------------
A0A2D5NDU9      ALNSQLSK----------------------------------------------------
A0A286RGB6      EIRQELEQ----------------------------------------------------
A0A1V5N3W2      AFKERTQK----------------------------------------------------
A0A3E0MY27      EAEKDLAK----------------------------------------------------
A0A2E0X9P6      EVQEELSS----------------------------------------------------
A0A286RLF2      ANEAFLLA----------------------------------------------------
A0A5C5ZM48      DIVSAMAG----------------------------------------------------
A0A5B9WF77      KLEKQYYD----------------------------------------------------
A0A518BBX8      LARNFFAR----------------------------------------------------
A0A518ALT3      ETRRSLTA----------------------------------------------------
A0A517MDV3      DVEQFLTA----------------------------------------------------
A0A3M1QRP3      FYKQQLAE----------------------------------------------------
A0A517TMV0      GVEQYLAS----------------------------------------------------
A0A2E3RCU8      TTKQYIEY----------------------------------------------------
A0A3E0MY88      MTERHLAE----------------------------------------------------
A0A1C3E6N1      AKEQWMAS----------------------------------------------------
A0A518GJT2      SKEQWMAS----------------------------------------------------
A0A286RD13      TLRKGLEQ----------------------------------------------------
A0A517MLW3      NAETYLSD----------------------------------------------------
A0A5B9QVD0      NGQNYLEN----------------------------------------------------
A0A3B8PNV4      DRQKWLTE----------------------------------------------------
A0A3D1DR40      DRQKWLTE----------------------------------------------------
A0A2E7RYU8      DRQKWLAE----------------------------------------------------
A0A3B8LXG8      DRQKWLAE----------------------------------------------------
A0A350CI62      VKEKYLRE----------------------------------------------------
A0A4P5WQK6      VKEKYLRE----------------------------------------------------
A0A3C1X4W5      VKEKYLAD----------------------------------------------------
A0A3D3W3A7      VKEKYLAD----------------------------------------------------
A0A518DRX3      SGEQYMAD----------------------------------------------------
A0A518DZF9      SGEQYMAD----------------------------------------------------
F0SI78          VMRTLLSQ----------------------------------------------------
A0A518IQ30      DSERYLAE----------------------------------------------------
A0A517LWP4      DSERYLLE----------------------------------------------------
A0A518JNW8      DSERYLLE----------------------------------------------------
A0A2E7ENQ5      KKEEYLAE----------------------------------------------------
A0A1G3AQE9      VTEQSLLE----------------------------------------------------
A0A3L7UQT9      AHEDLVNN----------------------------------------------------
A0A4P5YBU2      AQEDLVNN----------------------------------------------------
A0A518AKT8      GIDQYLTN----------------------------------------------------
A0A5C5ZR72      QEEQSLSE----------------------------------------------------
A0A517TY85      EANAALEQ----------------------------------------------------
A0A5B9QEI7      NVEAELKE----------------------------------------------------
A0A5S9IJB5      VIEERLTA----------------------------------------------------
A0A1G2XVR0      EIENRIKL----------------------------------------------------
A0A1G3B0P0      EIENRIKL----------------------------------------------------
A0A1E3X4X0      AIKDKIDF----------------------------------------------------
A0A286U4B3      LIEQEIKD----------------------------------------------------
A0A5C6DDS2      FIEQQINS----------------------------------------------------
A0A0S8J591      QVNQQIAV----------------------------------------------------
A0A2E3GW02      VMRTLLSQ----------------------------------------------------
A0A1U9NL64      SIETDLEE----------------------------------------------------
A0A5B9QNZ7      DVEQFLEA----------------------------------------------------
A0A1U7CZ81      QLMAKYNSLWDERYGEIRQLVMA-------------------------------------
A0A142YNY8      QLEGQHADFWAQRYPEIRAQILA-------------------------------------
A0A1U7GLS6      ELQAEIEGHWRDRYHDIRRRVLA-------------------------------------
A0A1Z8N7H5      TTKQYIEY----------------------------------------------------
A0A1G2YPI3      RSKAQIAN----------------------------------------------------
A0A532UIN2      HVKAQIAD----------------------------------------------------
A0A532UD06      RINKELNE----------------------------------------------------
A0A660URN1      YIKQLLGE----------------------------------------------------
A0A0S8KNX5      TLKAHLEE----------------------------------------------------
A0A3D3UVZ8      TLKKHLED----------------------------------------------------
E8R3W3          YREIDFLRLQNEAREAIRRDLEASRLGNRL------------------------------
A0A517NFU9      ITRRFISS-----------------------------------------NQPAET-----
A0A5C5YWH4      ITRQFIAK-----------------------------------------NAPTNA-----
A0A3D2TNK4      SLDQYINN----------------------------------------------------
A0A0J1B4A0      NMRRFVDE--------------------------------------SRENRPEED-----
A0A142WSB9      TILSAYRS----------------------------------------------------
M5SZR3          EAKNFYKTLEKEYEEHHVAIREYADEAVDVGGYRKWKDASGTMEVSARLISEEESKVTLE
M5TW92          EAKNFYKTLEKEYEEHHVAIREYADEAVDVGGYRKWKDASGTMEVSARLISEEENKVTLE
A0A2S8FKY2      ERRAHLEK---------------------------------------LVIERIAQ-----
A0A517N8P6      ATEKALRE---------------------------------LQQTRNNVSPEKID-----
A0A432MJP4      RVQQVAAD----------------------------------------------S-----
M5UQ35          SLKQYVAK---------------------------------------QQQDKPEV-----
A0A5C5WTY6      LTKQFLFD--------------------------------------QAKREEDSS-----
A0A5C5Y033      LVEDFVRK--------------------------------------SKEQTSPEM-----
A0A5C6G1Y2      LVEDFVRK--------------------------------------SKEQTSPEM-----
A0A354PDV6      LVKNFLDE--------------------------------------KKDGTSVGA-----
A0A5C6FZ02      LVRKFIDE--------------------------------------SNEDTVAEA-----
M5TIT3          LVKQFLQD--------------------------------------KQDLMNPAS-----
A0A5M6CY44      LVKQFLQD--------------------------------------NEELTNPDG-----
F2AXG2          LVKEFLQD--------------------------------------QKDLTSPAE-----
M2BB46          LVKEFLQD--------------------------------------QKDLTSPAE-----
L7CLQ6          LVKEFLQD--------------------------------------QKDLTSPAE-----
A0A0J1B719      LVKEFLQD--------------------------------------QKDLTSPAE-----
Q7UF18          LVKEFLQD--------------------------------------QKDLTSPAE-----
A0A2G1W1E0      LVKEFLQD--------------------------------------QKELTSPAE-----
K5E235          LVKEFLQD--------------------------------------QKELTSPAE-----
A0A5C6FFI9      VIERFVAA-----------------------------------------NAPAAL-----
A0A3A0DET7      ELRDKLTK----------------------------------------------------
A0A5C5WDJ1      ITRQFIDA-----------------------------------------NRPENT-----
A0A5C5X547      FRKSLIKRSFKKEYERENRRLQEQFEQDQLAYELDWRRIEAERLRALKAQGGGTL-----
A0A2A2W9R6      SIEKFTPQ------------EGDESSEK-----------------KES------------
A0A518HKC1      SIQKFAPQ------------EGDEPSEE-----------------KES------------
A0A518L3P0      SIQKFSPQ------------DGDEQPDS-----------------AKS------------
A0A255R1S0      NLRKYVDN------------FRAGSEKD-----------------AGEEIVETVE-----
A0A5B9MKP1      AFEKIGEL------------SDAEQAGG-----------------AGE------------
A0A0S8FY64      HVLSGLRE----------------------------------------------------
A0A1N6KFT7      ELESEIEDLWRQRRPLLLRQLTREMANE-----------------GDLALQKAEA-----
L0DFG4          EIESEIEDLWRQRRPLLLRQLSREMADE-----------------GDQAIQKAEA-----
A0A5C5XXG1      LVR-------------------KFIDES-----------------NE--DTVAEA-----
A0A518BJJ1      ELRAKVRDSLRGR----LTGLQRLFEDR-----------------SELAKTAALA-----
A0A518D182      ELRARLTQNLAQR----AEALAALADDR-----------------DELAATARDA-----
A0A353FIP5      KLRTNISN--------------------------------------A-------------
A0A5B1CIK7      GVKEFLQS--------------------------------------NENLAESAS-----
A0A5C5WHS2      SVKAFLQE--------------------------------------NDELAEPAA-----
A0A5C6B6G8      LVKQFLQD--------------------------------------NEELTNVST-----
A0A5C5ZZN3      LVKQFLQD--------------------------------------NQDLTSPTS-----
A0A5C5XS91      LVKEFLQD--------------------------------------KQELTNPAM-----
A0A5C6C4E6      LVKQFLQE--------------------------------------KRELTTPSL-----
A0A2E1VVJ1      ELRGSIRD--------------------------------------N-------------
A0A3M2AEL0      ELEGRLLL--------------------------------------A-------------
A0A532UT69      RTKSKIA-----------------------------------------------------
A0A2D5AWU0      VLKERKR-----------------------------------------------------
M5RT57          GYEASLKR----------------------------------------------------
A0A356KTN1      KIRERLR-----------------------------------------------------
A0A518HFS8      SLAESLRM----------------------------------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------YAKRIIMQEEEKYENFKS
A0A533Q9U4      ------------------------------------------EVEQICDSIATEYEVAIN
A0A1U9NNE1      ---------------------RREDIGKKFEELIEEQINRSSEF--QVAELKAELAKVRE
A0A2G2JCA2      ------------------------------LKIDLKTIGKEDLEARYLASKEEELSHVEI
A0A533Q6B7      ------------------------------------------EVERLCNHITIEYEIAKS
A0A351FYP6      ------------RIKG------------------------------ILAGLELRVNSSLA
A0A2E7ESJ6      ------------LVNGTIKPSRQ---------------ELFDYVTRYLASLKQKQIQLKG
A0A1G2YQB7      ------------LKEQASKNFDE--MATM---------EFKESDLLEMQSYNDKLNQLSK
A0A353P687      ------------LRQQADKNFDE--MAEK---------EFKESDMLEIQEYKYKLEQISL
A0A356EME5      ------------MRRELATQYQVQ-YRTA---------ISAKR---EADLASKKFEIESR
A0A355AI52      ------------FDVIGSPRSFG--GDDT---------QLANT---VANILNQRLESAER
A0A3L7SI46      ------------RRHVVSSAMKD--VRER---------ELGPK---LLEMVKQRLYQAGA
A0A3L7P4E4      ------------ELSD--QIAPP--AKKM---------DFLQV---YIESLHQQKKAGEE
A0A3L7PEB5      ------------ELDETSSTTGP--AKKI---------DFLEV---YVESLQQQKKAGEE
A0A2N1UCJ3      -------------------------AQIE---------EFAKN---YIELLEIEYDAAKQ
A0A517ZCB5      ------------QPRMTSESVKR--ASTE---------DLGPR---LLQMARHRYLMAAN
A0A432MFP3      ------------LWSDLEPTLRAQLAAEE---------THPVQ---IVLRAEQRLLRLER
D5SZ21          ------------RRQVTIDRLKQ--LRME---------ELTPR---LLQMARQRVQHSQQ
A0A518CHE5      ------------RLQSNQSSYHV--QQNR---------RQAQR---LLEIAEQKLVQYEE
A0A257WS34      ------------RNVIVTERLKE--MRSN---------ELAPR---LLQMAQQRLLQAQA
A0A2E8FLY0      ------------RPKNLIKQMQQ--LSTA---------QLTPS---LIDMARQRLSYAQS
A0A3D2U1E1      ------------RPTDISAQMSS--LAKD---------RLTPT---LIDMSAQKLRYAEL
A0A1P8WP26      ------------NPAMRMQAAEE--NSRG---------YLGPK---LIEKTEQRLRMARQ
A0A3L7V1F3      ------------YPRQQQQEMKR--LAET---------ELAPR---MIQYLRQQMESNQQ
A0A5B9QF68      ------------YRANLGNPSNG--MAES---------HLGPV---VKRMLEQSVQQAWQ
A0A5B9QGF0      ------------YRANLGNQSNG--MAQN---------HLGPV---VKRMLEQSVEQTWQ
A0A5C6CK24      ------------YRANLGKQQNG--MVQQ---------HIGPV---VKRMLEQSVQQTWQ
A0A2E8B0L9      ------------FQANVNRRLDG--VQSE---------QMAPM---LLGMVEERLSKTWE
A0A5Q4GFE7      ------------YQEMVNQRLAG--LSDG---------RLGPM---LLARVEEQLSNLRE
A0A2E3GWX1      ------------RSAQVAEGSDK--INA----------ELGPR---LLQMAKQRYQHAML
F0SG60          ------------RSAQVAEGSDK--INA----------ELGPR---LLQMAKQRYQHAML
A0A2E9VST2      ------------RGQQASQDSKQ--LTH----------DMGPQ---MLEMAKQRYQHAVT
A0A356A6X2      ------------RGQQASQDSKQ--LTR----------DMGPQ---MLEMAKQRYQHAVT
A0A5C5XLM3      ------------RGQQATQDSKQ--LTR----------DMGPQ---MLEMAKQRYQHAVT
A0A3M1VCL4      ------------YRAGMAQQLRA--ATET---------HIKPR---LRQMAIRRLMVALE
A0A5C5V7Z9      ------------YHAASGSRYAS--INNQ---------DLGPM---IKRTLEQSVAQAIE
A0A5C5YT05      ------------YHAASGSRYAS--INNG---------DLGPM---IKRTLEQSVAQAME
A0A518D7F9      ------------RHVGAGEALGG--IGDS---------ELGPL---LISMLQQSAQQLAR
A0A5C5ZIP0      ------------YRNGASGRADF--LGQE---------ELGSM---LSTMLNQALAQAGE
A0A518KBK3      ------------YRSDASGRPTG--LTAA---------ELGPF---LVGMLNQAMSQSVE
A0A5C6AKF9      ------------YRSDASGRPTG--LSRE---------ELGPL---LIGMLNQALAQSNE
A0A2E0X4J3      ------------KQAEIAENRAT--MIA--------------A---YVDSVKSAYELLEH
A0A5C5YU10      ------------KRESIEAEKEA--ALR--------------A---YAFNVKERFEFHTN
A0A517MPZ6      ------------QLEATEERKKA--IVS--------------A---YVETVSQEHQLLEQ
A0A5C6CNV7      ------------QQADIEKNKEA--IVS--------------A---YVETMSQEYQLLEQ
A0A518K5H4      ------------Q-------QQA--TLN--------------A---YVDGLRQNYELLAQ
A0A5C6AA28      ------------Q-------QQA--ILN--------------A---YVDGLRQDYELLTQ
A0A2E9VK20      ------------MGIDLPTMTTKVNPATG-ESELVTGNDPIAT---YVVALEQQQAELKN
A0A3D4PJK1      ------------MGIDLPTMTTKVNPATG-ESELVTGNDPIAT---YVVALEQQQAELKN
A0A0S8GZ23      ------------YRAKAGEKFDEAMVRFM-EQKR-------EA---DLTKAKVQLANYQA
L0DC26          ------------QHRKLYPIVA--------RQLQDAGRESSGS---KTTLLQHRISILSK
A0A354PCQ3      ------------PAIEKLNRLADEELARRTAQAEFDRRLAEVQ---RQAEAEQGEINRKL
A0A1I3DDV4      ------------SQAKTQNNPLFEKLTPE---------LLLNA---YTGFLRHDLSALDQ
A0A2E2N5A9      ------------QV---------------------------SQ---VVSGIQRNYQLAVA
A0A2E3GWC6      ------------RGIELPVNPANGKAIVGPNGQVEPGSDMIST---YMTALTQQQAEMKN
F0SLB0          ------------RGIELPVNPANGKAIVGPNGQVEPGSDMIST---YMTALTQQQAEMKN
A0A2E0SMM6      ------------RLQSTNNEYHQQHNRKQ-----------AER---LLRIAEQKLSQLKG
A0A1N6DAJ8      ------------QRRKLYPIIQ--------QQLQDMGRDDDDS---SEALLPHRISILAK
A0A5B9PJZ8      ------------ELSSLR---GEENELQGKPDMV-------AD---FVERVAGQIAMISA
A0A2S8G191      ------------RKDQIVKGRAQWQAANF------------KA---SVDKARSEVVLLEQ
A0A2E7EGG1      ------------LRDTNRPRIR--------EEMKAMSGLQRQQ---ELAMLKTQLETQKL
A0A225EH48      ------------KVE---------------ADIRAALKREIKS---DIEREKQFVTYKTT
A0A3L7NDH9      ------------FDGVAAP-----------REFAGDDEKFAQM---ISQILDQKVSAAVQ
A0A518INW8      ------------KAPEGIEELVASNLSPT---------EILDA---FSTLLKNDVKELTK
A0A518JPH9      ------------KAPTGLEEIVSSGMTPS---------QILTA---FSTLLNNDIKDLSK
A0A2E2CCW9      ------------QGLDISADNLESGEFQV-AETK--DVDFVNV---YLKSMEQQLKELEN
A0A3C0AGX3      ------------QGLDISADNLESGEFQV-AETK--DVDFVNV---YLKSMEQQLKELEN
A0A518AAQ5      ------------QGLEISAENLESGEFQV-SKMK--DVDFVNI---YLKSMEQQLKELEN
A0A517QBG9      ------------QGLEISADNLESGEFQV-SKMK--DVDFVNI---YLKSMEQQLKELEN
A0A518FTU3      ------------QGLEISAENLESGEFQV-SKMK--DVDFVNI---YLKSMEQQLKELEN
A0A2E7K7A9      ------------QGIEISADNLESGEFQV-SKVK--DVDFVNI---YLKSMEQQLKELEN
A0A517PTS5      ------------QGIEISADNLESGEFQV-SKVK--DVDFVNI---YLKSMEQQLKELEN
A0A517WHH5      ------------QGIEISADNLESGEFQV-SKMK--DVDFVNI---YLKSMEQQLKELEN
A0A5A8BGT3      ------------QGIEISADNLESGEFQV-SKMK--DVDFVNI---YLKSMEQQLKELEN
A0A517VTK3      ------------QGIEISADNLNSGDFKL-SNVK--EADFVNI---YLKSMEQQLKELHN
A0A517WQT4      ------------QGIEISADNLNSGDFKL-SNVK--EADFVNI---YLKSMEQQLKELHN
A0A517VID8      ------------QGLDISAENLESGEFQV-AKTK--DVDFVNV---YLKSMEQQFKELEN
A0A517RK10      ------------QGLDISAENLESGDFKI-AKVK--DVDFVNV---YLKSMEQQLKELNN
A0A518IH18      ------------QGLDISAENLESGDFKI-AKVK--DVDFVNV---YLKSMEQQLKELNN
A0A5C5VEK8      ------------KEADI----AKSKEMAL------------KA---YAFDIKERYEFQTN
A0A532UTJ0      ------------REQEASQAFDERVTKEI-AEAG-------HK---ELVAARSKLDETTV
A0A517NSK8      ------------KAAEVGDG-AVIEKMKP-DEML-------QT---YVGLLENDLAGLQR
A0A5C5Z0D6      ------------NSAKITAS-EIRERMEP-AEML-------QT---YVGLLKNDLSGIQK
M5UE94          ------------NSSKIQAR-DAQERITP-AEML-------QT---YVGLLKNDVMGLQR
A0A1P8WN28      ------------MQLQLG---ENVNVGVRDPQVG-------QW---LIKQIEAEVQATRQ
A0A3B9CTT0      ------------ARADLD---RRLQIGIRGPEAG-------QW---LMDSLQAELNSIQQ
A0A5C5XLF4      ------------MGIDLPTMTTKVNPVTG-EPELVTGNDPIAT---YVVALEQQQAELKN
A0A2D5NDU9      ------------MRSVDAENL---------ESYA-------AT---LLAALDRRVASIQA
A0A286RGB6      ------------RRVRDL-----------------------DE---EIENLNFELSILAQ
A0A1V5N3W2      ------------QREDLEKTFDEMVAKEL-TENS-------QL---QLDKAKAELEQIIV
A0A3E0MY27      ------------READVTLEIEEQEIIPP-EVAQ-------------LNLLQNSLTATQE
A0A2E0X9P6      ------------ARRAERQLQRDRDIVEK----------------------KQELQSLAT
A0A286RLF2      ------------YQDRLR---ARLDNLNI-PELS-------QM---LLGTLRQRVNELWQ
A0A5C5ZM48      ------------RVEMLRSQVMS-------ESIGSMKPSGPSE---ESEAIDLRLAALDL
A0A5B9WF77      ------------LWETKK---GQIRERLLVTTSGVASNGERGE---SIPELMQQIAVLKT
A0A518BBX8      ------------PTAAFAAFSGDHESAETLLSKSGSAAEAVEM---HLDYLNQKLDYLKV
A0A518ALT3      ------------LREHARTELAQQQLERN-KQES-------EQ---AILSKQQEITTLAK
A0A517MDV3      ------------KRDAIK-PLADSPEVRS-GTLV-------NA---YAKVIEKDLEDVTQ
A0A3M1QRP3      ------------RERELELAPPATVGVKRDDEFA-------GM---SPRELRWELEDLRA
A0A517TMV0      ------------YRSDTT---GRPGGLAD-AELG-------PM---LMGMLDQAWRQAVQ
A0A2E3RCU8      ------------HDAQLK---TQVDNLES-NQLG-------PV---LLRMAQQGLNKAKQ
A0A3E0MY88      ------------YGERIR---AQVGTLQS-TTFG-------PT---LTHMMEQALASAWH
A0A1C3E6N1      ------------RRQVTI---DRLKQLRM-EELT-------PR---LLQMARQRVQHSQQ
A0A518GJT2      ------------RRQVTI---ERLKQLRT-EELT-------PR---LLQMARQRVQHSQQ
A0A286RD13      ------------RRAELT---PQLVEFAR-EQLAKGRAVAPPT---ETEQIQAEIAQAEL
A0A517MLW3      ------------FQARVN---GRSSNQSG-GQFA-------AL---LGDLVQQKLNESTQ
A0A5B9QVD0      ------------FQERVN---GQVSQTSG-QQFA-------RL---LGDLVVQKLDEAKQ
A0A3B8PNV4      ------------RPKSVV---DQMQKLSK-AQLT-------PS---LIDMSRQRLRYAES
A0A3D1DR40      ------------RPKSVV---DQMQKLSK-AQLT-------PS---LIDMSRQRLRYAES
A0A2E7RYU8      ------------RPKSVV---DQMQKLSE-AQLT-------PS---LIDMSRQRLRYAES
A0A3B8LXG8      ------------RPKSVV---DQMQKLSE-AQLT-------PS---LIDMSRQRLRYAES
A0A350CI62      ------------FPELQR---TRTDTMTR-EVLA-------PR---LVQYLSQQILKLEL
A0A4P5WQK6      ------------FPELQR---TRTDTMTR-EVLA-------PR---LVQYLSQQILKLEL
A0A3C1X4W5      ------------FPEMQR---TRTDTMTR-DVLA-------PR---LVQYLNQQILKLEL
A0A3D3W3A7      ------------FPEMQR---TRTDTMTR-DVLA-------PR---LVQYLNQQILKLEL
A0A518DRX3      ------------IRFKAE---TQQNSIAG-QQLA-------PL---LTSLIAQRLAETRA
A0A518DZF9      ------------IRFKAE---TQQNSIAG-QQLA-------PL---LTSLIAQRLAETRA
F0SI78          ---------------EAGERTSTKPASAR-PDLL-------TL---YMQSLQEELRTNQE
A0A518IQ30      ------------YRAKMQ---AANGPGQE-QQLG-------EM---LLSMIREALAETQA
A0A517LWP4      ------------YRAKIN---AANGPQQE-QQLG-------EM---LLSMISEALTETQA
A0A518JNW8      ------------YRAKMN---AANGPQQE-QQLG-------EM---LLSMIGEALAETQA
A0A2E7ENQ5      ------------H----GTEGAEIDGFQN-QQLG-------EM---LLSSIQGKLNTAIV
A0A1G3AQE9      ------------YPGRIRQRM------QD-AGLG-------PM---LIGLVHHKLAEAQW
A0A3L7UQT9      ------------YFQRAKMNLTA----NS-ADLG-------PQ---LLGMARQRYQLAMS
A0A4P5YBU2      ------------YFQRAKMNLTA----NS-ADLG-------PQ---LLGMARQRYQLAMS
A0A518AKT8      ------------YRTAAGQRIAGMTGNEL-GPMM-------QE---LL---RQSIAQTLE
A0A5C5ZR72      ------------FKDKLRQSLLLSARMSR-QKSG-------KT---LADTKREELEMLSA
A0A517TY85      ------------LKATARAESLAARRADQ-EGEQ-------RK---LLAAKEQELAAWIM
A0A5B9QEI7      ------------LKELVKRELIALRREER-KAEQ-------EA---LVGAKQQELGLLSK
A0A5S9IJB5      ----------------------------EVLGIMQS--------------LKDQYYRYKK
A0A1G2XVR0      ----------------------------ETLSLITK--------------VETDYNVLLA
A0A1G3B0P0      ----------------------------ETLSLITK--------------VETDYNVLLA
A0A1E3X4X0      ----------------------------EVKKIISS--------------IETKYKVARA
A0A286U4B3      ----------------------------EQGWLGKA--------------IKAEYQEAVG
A0A5C6DDS2      ----------------------------EQGWVAKA--------------IKAEYQEAVG
A0A0S8J591      ----------------------------ENDRMRRAAQSD----------AAQKLATAQA
A0A2E3GW02      ----------------EAGERTSTKPASARPDLLTLYMQS----------LQEELRTNQE
A0A1U9NL64      ----------------------------SDQEFASAQLAV----------ARERHMAAKK
A0A5B9QNZ7      --------------KNQALQPQQDSPEIRSGTLVKAYAKV----------IDKDLEDIRK
A0A1U7CZ81      ---------------------EDASFAASAAAAGSGTVATNAL---TIEALRARVELSRH
A0A142YNY8      ---------------------ELEGRPTPTNPVRDESIK-------SIPELRADVEALER
A0A1U7GLS6      ---------------------AGDGPMAASGP-GEPRQK-------TVQELKDEVSELES
A0A1Z8N7H5      ----------------HDAELKTQLDELESNQLGPLLLQM----------AQQGLDKARQ
A0A1G2YPI3      ----------------------------LDDEFSQAQLAV----------SKQESLAAKE
A0A532UIN2      ----------------------------LDAEFARAQLAV----------AEQQYVSAKK
A0A532UD06      ----------------------------QAKEFADAYIEV----------MQLRWLAAKQ
A0A660URN1      ----------------------------KAKNFADAYLEV----------MRLRWTTAGQ
A0A0S8KNX5      --------------------RRQEASKAFDDLVEKEAAEAGTK---QLVAKRSELEQTRQ
A0A3D3UVZ8      --------------------RKQEASNAFDNLVAKESAVAGNK---QLVAKRSELEQTRE
E8R3W3          ---------------------SSSPRSATPNDLF----------------ANATLEQIER
A0A517NFU9      ---------------------KVQSRKFDAAEMLSTYTSL----------LSNDIAELEK
A0A5C5YWH4      ---------------------KVATKKLDPAEMLKTYTSL----------LQNDISELEK
A0A3D2TNK4      -------------YHSGAGDRLEAMGKSIPKEVVVNL-------------LRQSTQQAIE
A0A0J1B4A0      -----------------------KRVEAKPADILASYYQV----------LQSDISEMEK
A0A142WSB9      -------QGIVAPTIEKEDLAAVAQGAAAKSGNKKAGVDLPHV---YLYILESQLEEFKI
M5SZR3          REDNGKRVTLATASLSGDDQRLLAKIRADRIRKHEELSEMVEM---GLTQLRQELDRTVR
M5TW92          RENNGKRVTLATASLSSDDQRLLAKIRADRIRKHEELSEMVEM---GLTQLRQELDRTVR
A0A2S8FKY2      ---------------------QQAEGDVRKNSMMTTSLKLPE--------VDNTIPELKV
A0A517N8P6      ---------------------VVKRQDEAAQALLTTYVSSLRK---KQDLINEDVADTTK
A0A432MJP4      ---------------------RRSVESVEVDDLILS--------------IEQAVASVEA
M5UQ35          ---------------------ADDEVVVSTVDMLGHYFNV----------LKSDVREYEA
A0A5C5WTY6      ---------------------QASSPTLDPEAMLKAYVGF----------LRNDLASHLE
A0A5C5Y033      ---------------------TFGSQAIKPDALLRAYIGF----------IEHDIAAIGE
A0A5C6G1Y2      ---------------------AFGSQAIKPDALLRAYIGF----------IEHDIAAIGE
A0A354PDV6      -----------------------GAGMLSPEALLKAYVGF----------LEHDLATLTQ
A0A5C6FZ02      ---------------------PFGENSVNPESLLKAYVGF----------LNHDMATIAE
M5TIT3          ---------------------AFGSSTLSPEGLLKAYVGF----------LQHDLATLSE
A0A5M6CY44      ---------------------LMADTMLTPEGLLNAYTGF----------LQNDLAALAE
F2AXG2          ---------------------MFGDSALTPEGLLKAYVGF----------LQHDLAALSE
M2BB46          ---------------------MFGDSALTPEGLLKAYVGF----------LNHDLAALSE
L7CLQ6          ---------------------MFGDSALTPEGLLKAYVGF----------LNHDLAALSE
A0A0J1B719      ---------------------MFGDSALTPEGLLKAYVGF----------LQHDLAALSE
Q7UF18          ---------------------MFGDSALTPEGLLKAYVGF----------LNHDLAALSE
A0A2G1W1E0      ---------------------MFGDSALTPEGLLKAYVGF----------LNHDLAALSE
K5E235          ---------------------MFGDSALTPEGLLKAYVGF----------LNHDLAALSE
A0A5C6FFI9      ---------------------EEEKSTMNPRTMLTTFTRL----------LKNDIAEYEM
A0A3A0DET7      ----------------------------MQEIVIEAYVES----------VRQQYELLDQ
A0A5C5WDJ1      ---------------------AREQKDMDPAEMVMTYVML----------LKNDISEFEM
A0A5C5X547      ---------------------IVGDTGENQDQLMAQFNEVD---------LRSRIKKIIE
A0A2A2W9R6      ------------------------EFDVPPAEILATYYTV----------LKSDISEFAK
A0A518HKC1      ------------------------DFDVPPAEILAAYYAV----------LKSDINEFAK
A0A518L3P0      ------------------------EFDVPPAEILATYYAV----------LKSDINEFAR
A0A255R1S0      ---------------------AGRVFDVPPSEILKTYYSV----------LKGDIAGLKK
A0A5B9MKP1      -----------------------KAFDVPPSEILGTYYAV----------LKSDLNEFAR
A0A0S8FY64      ---------------------------------------AMAR---AVDSIHSEYAVLVA
A0A1N6KFT7      ---------------------ELTSLAAEEASLYETLKESKEK---SIEGLKTRHETLVK
L0DFG4          ---------------------ELTSLEAEENSLYETLKESKEK---AIASLREKHENLTK
A0A5C5XXG1      ---------------------PFGENSVNPESLLKAYVGF----------LNHDMATIAE
A0A518BJJ1      ---------------------ATDLPDANARVDRAALEDLRER---VERQLASRLDAVAL
A0A518D182      ---------------------AMAQSGRDLESIDAALAATRAR---IADHLASRREALGR
A0A353FIP5      --------------------------------------------------VEARGVALKK
A0A5B1CIK7      ---------------------MFGESTLTATGLLKAYVGF----------LNHDLATLGE
A0A5C5WHS2      ---------------------MFADSTLTPTGLLRAYVGF----------LNHDMSALNE
A0A5C6B6G8      ---------------------GFSDTMLTPESLLKAYIGF----------VNHDIAALGE
A0A5C5ZZN3      ---------------------AFGESALTPEGLLKAYVGF----------LQHDLAALAE
A0A5C5XS91      ---------------------AFTDTALNPEGLLKAYVGF----------LNHDLATLTE
A0A5C6C4E6      ---------------------SFNESSLSPEGLLKAYVGF----------LNHDLATLTE
A0A2E1VVJ1      --------------------------------------------------LASRLEGLRS
A0A3M2AEL0      --------------------------------------------------VQDTLAALEA
A0A532UT69      ---------------------------EQDTKFAQTQLAVAEQ---QYLNARE-------
A0A2D5AWU0      ---------------------------DILLQYARNYKIDAEI---AYNEAKN-------
M5RT57          --------------------AVASSRPKITDQLKSLAELDRRD---TLHELEARLETQLV
A0A356KTN1      --------------------------------SERDEKVAVEQ---GLLERDR-------
A0A518HFS8      --------------------RYEELRGFHGAQQSGDRPAARDP---GLEQAGRYLEILEE
                                                                            

A0A5S9IPR9      R------------------------------RAYYQ-------KKLKELEEQNLAFHQKI
A0A533Q9U4      R------------------------------ETTLV-------TILEQQKNEVFALGDKA
A0A1U9NNE1      N------------------------------ERRIR-------EKLEGTNAELITLGKRH
A0A2G2JCA2      R------------------------------LNGLNISVTKIQEMLDKEMKLAKKTSGDT
A0A533Q6B7      N------------------------------EATLL-------SLFEQQKNEVFTQGDRS
A0A351FYP6      Q------------------------------VRELQ-------KSVDDAKAKEAKVQEEG
A0A2E7ESJ6      Q------------------------------YESLT-------GLFNQEEDAAKELQILQ
A0A1G2YQB7      H------------------------------EQQLR-------DMLKSEDSKTIELGRKQ
A0A353P687      H------------------------------QQQLR-------DMLVHEDSKTIELGRKQ
A0A356EME5      RRM----------------------------EEALR-------ERYEKELKKVAPGVADM
A0A355AI52      Q------------------------------EEWLQ-------KSFERAKEESIGLTSDI
A0A3L7SI46      H------------------------------EQAIR-------EDFEIIRSQALSLNGQM
A0A3L7P4E4      R------------------------------LLQLN-------SLFEEEQRIAKEQLDLQ
A0A3L7PEB5      R------------------------------LLHLN-------QLFEEEKRIAKEQLDLQ
A0A2N1UCJ3      K------------------------------EAELS-------ASYEQYKQESQSLNIKA
A0A517ZCB5      Q------------------------------EQQLL-------AEFERERDNALQLNQQL
A0A432MFP3      E------------------------------RQLLQ-------QKLDLIELADRSESVEQ
D5SZ21          H------------------------------EASVS-------AQFDIERQNALSLNGEL
A0A518CHE5      R------------------------------YRALK-------ESYLSEEEKGRESTLVM
A0A257WS34      R------------------------------ENSLR-------LQFDQAHAAALAMNSQL
A0A2E8FLY0      R------------------------------ETALR-------QDFERENRIVSSYEFQM
A0A3D2U1E1      R------------------------------EQALR-------DDFNRESQVVSSFEALM
A0A1P8WP26      Q------------------------------VAQIG-------QDIRAEKTQAMELSMTL
A0A3L7V1F3      N------------------------------EDAIR-------AQLDTEKNKAQRLGQIL
A0A5B9QF68      K------------------------------EQQMS-------ASFEEARQEAAKHSGDL
A0A5B9QGF0      K------------------------------EQQMS-------ASFEEARKEAARHSGDL
A0A5C6CK24      K------------------------------EQQMS-------DSFEEARQEAAKHSGDL
A0A2E8B0L9      L------------------------------EADLE-------REYVAAEASAIRLNDRH
A0A5Q4GFE7      H------------------------------EERLD-------LQYEQAESEAVMLNDRM
A0A2E3GWX1      N------------------------------EQEIT-------TRFNHEKTLAADMNQRL
F0SG60          N------------------------------EQEIT-------TRFNHEKTLAADMNQRL
A0A2E9VST2      L------------------------------EQDIY-------QRFMQEKQVASQMNQRL
A0A356A6X2      H------------------------------EQDIY-------QRFMQEKQLASQMNQRL
A0A5C5XLM3      H------------------------------EQDIY-------QRFMQEKQLASQMNQRL
A0A3M1VCL4      E------------------------------ERSLV-------EQFEQLKKQAIELNNRH
A0A5C5V7Z9      R------------------------------ERVLS-------SSFDEARIEAAKQSGEL
A0A5C5YT05      Q------------------------------ERILA-------ESFEDARVNAARQSGDL
A0A518D7F9      L------------------------------ETQLT-------DSFEAARAHALEQSSGL
A0A5C5ZIP0      R------------------------------ERQLD-------HSFELARDEAARQSGDF
A0A518KBK3      R------------------------------ERQLE-------EAFQVARADAARQSGDL
A0A5C6AKF9      R------------------------------ERQLA-------EAFEVARSEASRQSGDL
A0A2E0X4J3      K------------------------------YAELQ-------RSYDRQFSEAKQVSALA
A0A5C5YU10      K------------------------------LNGLR-------SKYQDQFEAAKESSANS
A0A517MPZ6      K------------------------------REELQ-------RSYDKQFKLAMQVNSQA
A0A5C6CNV7      K------------------------------RAELQ-------RNYDSQFKLALQVNSQA
A0A518K5H4      R------------------------------RDELQ-------KAYDKQFALATEVSQQA
A0A5C6AA28      R------------------------------RDELQ-------RAYDKQFALATAVSQQA
A0A2E9VK20      R------------------------------IGELQ-------KLFDRSADQAKDFAQYE
A0A3D4PJK1      R------------------------------IGELQ-------KLFDRSADQAKDFAQYE
A0A0S8GZ23      M------------------------------ESEYS-------RRLVEELEQNKDMGNVQ
L0DC26          L------------------------------EGAME-------DDVKRLNGRTRSITQNS
A0A354PCQ3      S------------------------------RDQLVTKIAVLREQYDEELTRMEQFGGTS
A0A1I3DDV4      R------------------------------KRELL-------TLAAEAEKNSKSLIEFE
A0A2E2N5A9      N------------------------------EQSQQ-------ALFDSNKYQIQNLSSKE
A0A2E3GWC6      R------------------------------LDELQ-------KLYDESTKQAKSFARFE
F0SLB0          R------------------------------LDELQ-------KLYDQSTKQAKSFARFE
A0A2E0SMM6      R------------------------------YTALK-------KSYDEEEEAGRESTLVM
A0A1N6DAJ8      L------------------------------ETLLA-------SDVKRLSERSASITQNS
A0A5B9PJZ8      Q------------------------------EKSLE-------ESILDEQRKAAQTSVNI
A0A2S8G191      M------------------------------EKQLV-------DSVTTFEKEAKQFGRSS
A0A2E7EGG1      I------------------------------VQSMR-------SNYDAMVEDISQSGGQT
A0A225EH48      L------------------------------TKKLG-------EEIKRLEKELELARGAN
A0A3L7NDH9      H------------------------------ETWLT-------QSFEQAKQDSIGLASEM
A0A518INW8      Q------------------------------LAQLT-------EEAKAVRVAAKEVESEY
A0A518JPH9      R------------------------------QQHLM-------EEAATVRVAAKAAESEF
A0A2E2CCW9      R------------------------------ELELT-------KLFTQESELAKKVGNFQ
A0A3C0AGX3      R------------------------------ELELT-------KLFTQESELAKKVGNFQ
A0A518AAQ5      R------------------------------ETELT-------RLFNQETELAKKVGNYQ
A0A517QBG9      R------------------------------ETELT-------RLFNQETELAKKVGNYQ
A0A518FTU3      R------------------------------ETELT-------RLFNQEVELAKKVGNYQ
A0A2E7K7A9      R------------------------------ETALT-------RLFDQETELAKKVGNYQ
A0A517PTS5      R------------------------------ETALT-------RLFDQETELAKKVGNYQ
A0A517WHH5      R------------------------------ETELT-------RLFDQETELAKKVGNYQ
A0A5A8BGT3      R------------------------------ETELT-------RLFDQETELAKKVGNYQ
A0A517VTK3      R------------------------------EQELT-------KLFDEETELAKKIGNYQ
A0A517WQT4      R------------------------------EQELT-------KLFDEETELAKKIGNYQ
A0A517VID8      R------------------------------ELELT-------KIFDQETELAKKIGNFQ
A0A517RK10      R------------------------------ETELT-------KLFDQETALAKNVGNFQ
A0A518IH18      R------------------------------ETELT-------KLFEQETALAKKVGNFQ
A0A5C5VEK8      K------------------------------LNELR-------SRYQEQFEEAKESSANS
A0A532UTJ0      I------------------------------EESLR-------QAISEEDTETITVGRKQ
A0A517NSK8      E------------------------------REVLV-------RRSEAELVSAKKLEEEE
A0A5C5Z0D6      R------------------------------REVLI-------RRSGAELILAKELEQVE
M5UE94          Q------------------------------RQVLQ-------TRSEQELKLAKQLEQAE
A0A1P8WN28      Y------------------------------EQSLK-------HEYSVVEADALELSGKL
A0A3B9CTT0      F------------------------------ESSLQ-------EEYNEVRAEALNISNKL
A0A5C5XLF4      R------------------------------IGELQ-------KLFDRSADQAKDFAQYE
A0A2D5NDU9      E------------------------------RQVLL-------PLLADAEREVLAVSEHE
A0A286RGB6      Q------------------------------QDQLQ-------KEVENVRRSAETFGKGS
A0A1V5N3W2      Q------------------------------ENILR-------DTLTKENADTIDLGRKQ
A0A3E0MY27      H------------------------------LAKLQ-------EQSKTLQQRINELTVFK
A0A2E0X9P6      R------------------------------RVKLA-------ERLEEQLAELKSGGAQS
A0A286RLF2      K------------------------------EMSLQ-------AQYELARQEAANLAGGL
A0A5C5ZM48      Q------------------------------EDYLR-------KSLEAEQRKRRDNAGGL
A0A5B9WF77      K------------------------------KDKLT-------ELYKKFEVTQKDSHADT
A0A518BBX8      A------------------------------EDRLD-------ELYKEEYDEARKIAAYD
A0A518ALT3      K------------------------------LELLE-------IRRQEHVAELEKGGARS
A0A517MDV3      R------------------------------IVFVK-------EEIAKEESDSVDLVDDE
A0A3M1QRP3      E------------------------------LTNLE-------AHIARKQKEFTSTFESA
A0A517TMV0      R------------------------------EQQIT-------ESFAAARAEASKQSGDL
A0A2E3RCU8      K------------------------------ESILH-------ASLEEARFKAVTHQRDT
A0A3E0MY88      R------------------------------ENQLR-------AAFAEAKEDAVRLNRDL
A0A1C3E6N1      H------------------------------EASVS-------AQFDIERQNALSLNGEL
A0A518GJT2      H------------------------------EASVS-------TQFDIERQNALALNGEL
A0A286RD13      E------------------------------KAVLEDELKVALEQFEKEAAEAEQLGKYS
A0A517MLW3      H------------------------------EALLR-------KEYDTLEKEVVAMNGSL
A0A5B9QVD0      H------------------------------EALLA-------AEYEALEKEVVAMNGNL
A0A3B8PNV4      R------------------------------EVALR-------QDFERENRTVSSYEYQM
A0A3D1DR40      R------------------------------EVALR-------QDFERENRTVSSYEYQM
A0A2E7RYU8      R------------------------------EAALR-------QDFERENRTVSSYEYQM
A0A3B8LXG8      R------------------------------ETALR-------QDFERENRTVSSYEYQM
A0A350CI62      N------------------------------EKAVG-------ERLAAEQAKAQKLSQTL
A0A4P5WQK6      N------------------------------EKAVG-------ERLAAEQAKAQKLSQTL
A0A3C1X4W5      N------------------------------EKAVS-------ERLAAEQSRAQKLSQTL
A0A3D3W3A7      N------------------------------EKAVS-------ERLAAEQSRAQKLSQTL
A0A518DRX3      N------------------------------EKQLL-------VEYQSSEAEAVSLNDRV
A0A518DZF9      N------------------------------EKQLL-------VEYQSSEAEAVSLNDRV
F0SI78          K------------------------------LKELD-------NLFLSERTHSSNLTMDE
A0A518IQ30      N------------------------------EQQLE-------HEYALAEAEAVKLNGRM
A0A517LWP4      N------------------------------EEQLE-------REYAIAEAEAVKLNGRM
A0A518JNW8      N------------------------------EEQLE-------REYAIAEAEAVTLNGRM
A0A2E7ENQ5      H------------------------------EQNLE-------REFQIAQNQAVEVNGKV
A0A1G3AQE9      L------------------------------EATLQ-------EDFQQAQNRAMEIDGQV
A0A3L7UQT9      R------------------------------QHTLQ-------QQFDREKSEVANHNTLM
A0A4P5YBU2      R------------------------------QHTLQ-------QQFDREKSEVANHNTLM
A0A518AKT8      Q------------------------------EKQKE-------AAFVAARTEAAKQSSQL
A0A5C5ZR72      L------------------------------EASVR-------EKYEAELAKVQEGGGKN
A0A517TY85      K------------------------------RKLLS-------EKLAAHVKERESGGAQS
A0A5B9QEI7      K------------------------------REMLS-------AKLAEQMNELKSGGAQS
A0A5S9IJB5      E------------------------------EDRLK-------KLVVAQQREALIFSQKV
A0A1G2XVR0      S------------------------------EESYE-------KAYNEQSLVVFDLNRKI
A0A1G3B0P0      S------------------------------EESYE-------KAYNEQSLVVFDLNRKI
A0A1E3X4X0      K------------------------------EDSIR-------ESLEKQKEEALRLNKKA
A0A286U4B3      K------------------------------EKGLR-------QHLEELKRENNRLEGKS
A0A5C6DDS2      K------------------------------ERGLR-------QRLEELKRENNELEGKS
A0A0S8J591      N------------------------------YEFLS-------DMLLTNRQRLTQISRDM
A0A2E3GW02      K------------------------------LKELD-------NLFLSERTHSSNLTMDE
A0A1U9NL64      Q------------------------------LDEVS-------TFFEEQRAAAMDLNDQL
A0A5B9QNZ7      Q------------------------------IEFTQ-------QQIKQDEQESVDLVDDE
A0A1U7CZ81      Q------------------------------LDTLN-------QLVLSMEIERKATQSDT
A0A142YNY8      E------------------------------RKAIT-------EALAQAELETKESNSET
A0A1U7GLS6      R------------------------------QASLQ-------KVLDEVKLESKESNSAT
A0A1Z8N7H5      K------------------------------ESILQ-------ASLDEARFXAVAHQRDT
A0A1G2YPI3      T------------------------------EDQIA-------KYYEDQRKQAVALNQQI
A0A532UIN2      K------------------------------EGQIA-------KYHNEQRKQALDLNEQL
A0A532UD06      R------------------------------EDELM-------TSFESQHQAARELSVKA
A0A660URN1      R------------------------------EDELL-------ASFDAERKAAQDLGVKA
A0A0S8KNX5      Y------------------------------EKGLR-------ETLSKEDTETIDLGRTQ
A0A3D3UVZ8      Y------------------------------EKRLQ-------ETLSQQDTQTIGIGRKQ
E8R3W3          SLREDYEW-----------------------AELLQ-------QDLQQQTRLLVTHNSNS
A0A517NFU9      R------------------------------KEFLL-------QESTLEMRLAKEVESDF
A0A5C5YWH4      R------------------------------KEILL-------ADSEVEMRMAKQVEGDF
A0A3D2TNK4      K------------------------------EKQIR-------QAYQQARAEAAAYSGSL
A0A0J1B4A0      R------------------------------EEQLL-------ELSEKESKLAKEVETTF
A0A142WSB9      R------------------------------EDLLA-------ARRTEAEGTAKESSLFD
M5SZR3          T------------------------------QELLR-------GIYDTEYVSAKELTDYE
M5TW92          T------------------------------QELLR-------GIYDTEYVSAKELTDFE
A0A2S8FKY2      RIGVLRQQ-----------------------QRELS-------KEVADLEKEVRTFGRSS
A0A517N8P6      R--------------------------------------------LEDVRAKALKLMEFE
A0A432MJP4      L------------------------------QQEYT-------DRFREDLEQARQILNDQ
M5UQ35          R------------------------------ERDLG-------SLAEVEAKAAKEVQMAF
A0A5C5WTY6      R------------------------------KTELQ-------RLVELAEEQAREFVAFE
A0A5C5Y033      R------------------------------RKELI-------ALTTDAESKAKELIEFE
A0A5C6G1Y2      R------------------------------RKELI-------ALTTDAESKAKELIEYE
A0A354PDV6      R------------------------------KRELT-------ILAGNAESQAKTLIDYE
A0A5C6FZ02      R------------------------------KSELT-------ALANQAETDARELIEYE
M5TIT3          R------------------------------RKELT-------FLAADAETKAKELIEYE
A0A5M6CY44      R------------------------------RKELG-------FLTADAEKKAKELIEYE
F2AXG2          R------------------------------RKELE-------YLADEAGKEAQTLITYE
M2BB46          R------------------------------RKELT-------YLADDAGTKAKELIEYE
L7CLQ6          R------------------------------RKELT-------YLAADAESKAKELIEYE
A0A0J1B719      R------------------------------RKELT-------YLAADAETKAKELIEYE
Q7UF18          R------------------------------RKELT-------YLAADAETKAKELIEYE
A0A2G1W1E0      R------------------------------RKELT-------YLAADAETKAKELIEYE
K5E235          R------------------------------RKELT-------YLAADAETKAKELIEYE
A0A5C6FFI9      R------------------------------EAILV-------ETSSEELQLAKDVENAF
A0A3A0DET7      K------------------------------RSELQ-------AAYDASFAAATQASSLL
A0A5C5WDJ1      R------------------------------KAVLL-------SESQKEMLLAKEVEADF
A0A5C5X547      Q------------------------------EAELE-------AMSSSLRDNFKLLGKTS
A0A2A2W9R6      R------------------------------ESELL-------ALSEQESKLAKEVELSF
A0A518HKC1      R------------------------------ETELL-------ALSEQESKLAKEVELSF
A0A518L3P0      R------------------------------ESELL-------ALSQQESKLAKEVELSF
A0A255R1S0      R------------------------------EEELV-------AQSEQEAKVAKEVELSM
A0A5B9MKP1      R------------------------------EAELL-------ALSDQETKLAKQVELDF
A0A0S8FY64      R------------------------------EQELV-------RVLLEETRVALEQARKV
A0A1N6KFT7      TLGADAPESIEAKSQVDRATEQLGGLGKDGLQSELH-------DRMASIEHSLKSIGSMR
L0DFG4          TLGPNSPETIQAKADVDQATEQLGGLGKDVLQSELR-------DRMTSIEHSLKSIGTMR
A0A5C5XXG1      R------------------------------KSELT-------ALANQAETDARELIEYE
A0A518BJJ1      E------------------------------NDELG-------RYVAVLEERLGNLPEQQ
A0A518D182      Q------------------------------YTELD-------RVCADLEAQLGALPEKE
A0A353FIP5      Q------------------------------IVSLD-------RAISRWQGQLDALPAVE
A0A5B1CIK7      Q------------------------------RKELN-------FLAADAETKAKDLIEYE
A0A5C5WHS2      Q------------------------------RKELT-------FLAADAEEKAKALIEYE
A0A5C6B6G8      R------------------------------RKELI-------FLSEDAETKAKELIDYE
A0A5C5ZZN3      R------------------------------RKELT-------FLASDAETKAKDLIEYE
A0A5C5XS91      R------------------------------RKELT-------FLAADAERKAKELIEYE
A0A5C6C4E6      R------------------------------RKELT-------YLSADAERKAKELIEFE
A0A2E1VVJ1      Q------------------------------ESTLL-------TALDEYDVRLDGLPRAQ
A0A3M2AEL0      Q------------------------------QVSLQ-------DTISRLRENLEELPATE
A0A532UT69      K------------------------------ENEIA-------RYYDEQRQQALSLNEQV
A0A2D5AWU0      R------------------------------ETSLD-------LDVTSLQEELGKTNRAL
M5RT57          L------------------------------ENLLG-------LRYKEMLGTAGESGNKL
A0A356KTN1      -----------------------------------------------NLREESRVFARRS
A0A518HFS8      Q------------------------------ERILR-------EEIASLEQEMGTLGIQS
                                                                            

A0A5S9IPR9      LMYEDINAE---------------------VAALRDRYNDYREKMKEYDSQRS-YQFD--
A0A533Q9U4      IQYGVLKRE---------------------ADTNRQMYETLLTRMKETNLTED-LKTS--
A0A1U9NNE1      LAIKDHQEQ---------------------LELTKELYDAINRKIQKIEMESQ-R-----
A0A2G2JCA2      FELEIKQRE---------------------LEELSDIHRMIESRILKIRTEQ--RAPS--
A0A533Q6B7      IQYGVLKRE---------------------ADTNRQMYETLLTRIKETNLAED-FKVS--
A0A351FYP6      REYFDAKRK---------------------LSNTTRMRDTILFRIMQEEVDLDLPKTS--
A0A2E7ESJ6      AKDEQFQNE---------------------IARTQQLFEVVVKSLEEISLVSD-YEGY--
A0A1G2YQB7      LAMQDVKEQ---------------------LDSSKQMLETIQKRVGELEMERK-R-----
A0A353P687      LAMQDVKEQ---------------------LDNSKDMYSTIQKRIGELEMERK-R-----
A0A356EME5      VSIEFEQAE---------------------LTRATDVLNLIEQRVVELRTER--QAPA--
A0A355AI52      SQLDIVETD---------------------LNWLRQLRNTLLNQIASVDIRQE-NGGV--
A0A3L7SI46      AQIDIMEMD---------------------LKRMRLYYDLILEQMKKIDIGA--DSGL--
A0A3L7P4E4      IKDKRYRND---------------------IARSELTFNAIVSQFKDADLAVK-AGYH--
A0A3L7PEB5      IQDKRYRND---------------------IARSELAFNTIMTQLKDTDLAIK-GGNY--
A0A2N1UCJ3      TEYAIIETK---------------------LEQSKRFCEILDDRIKELNVSEE-AGAL--
A0A517ZCB5      AEIQIAELE---------------------IQRMRTYDDVLLDAITNIDLNK--DNHL--
A0A432MFP3      LEISFAMTK---------------------LKQYQAMEQQVQRRLEVLRFES---RPA--
D5SZ21          AKLEILQMD---------------------TKRLRAFYDLVLERIRGIDLGK--DKGI--
A0A518CHE5      LKIKQLETH---------------------QTRIMAQHDTLLQKIREVDLDD--RASV--
A0A257WS34      AELERIESD---------------------VKRMRTYYDHVLDRIKDIDLGA--DDGL--
A0A2E8FLY0      SRIKLLNFD---------------------LARKRELAVALIDQINRTDLGKE-RGGL--
A0A3D2U1E1      GRIRLLNFD---------------------LARKRELAIALATRISRTDLGKE-RGGL--
A0A1P8WP26      REIQDINRE---------------------IERRHEYRASLTDKMDLIDLTG--DTFI--
A0A3L7V1F3      ADLARNERE---------------------NLRLSERIQEYQNQVDGIGINK--DKMV--
A0A5B9QF68      VQLRMLERE---------------------VTRLEAQYDLLFEKISTVNMRQM-QAPI--
A0A5B9QGF0      VQLHMLERE---------------------VTRLEAQYDLLFEKISTVDMRQM-QAPI--
A0A5C6CK24      VQLRMLERE---------------------VTRLEAQYDLLFEKISTVDMRQM-QAPI--
A0A2E8B0L9      AELSIVESQ---------------------VQRLSNVHDMLLDRIANVDLNSE-GGDV--
A0A5Q4GFE7      AEMKMIEHD---------------------LARMRNLHDTLLNRIANIDIGHS-RSDV--
A0A2E3GWX1      VLLQMAERD---------------------LARLQSDYDMLRERINALDLNQ--QTSL--
F0SG60          VLLQMAERD---------------------LARLQSDYDMLRERINALDLNQ--QTSL--
A0A2E9VST2      MMLQLAERD---------------------LSRLQNDYDMMRDRINTIDLNK--QSSL--
A0A356A6X2      MLLQLAERD---------------------LSRLQSDYDMMRDRINTIDLNK--QSSL--
A0A5C5XLM3      MLLQLAERD---------------------LSRLQSDYDMMRDRINTIDLNK--QSSL--
A0A3M1VCL4      LQMEILSLE---------------------LNRLRSLNDLFLERIKELDLGSD-SGAL--
A0A5C5V7Z9      VELDMRSRE---------------------VERLESLHDVLFEKIAAVDIHQV-QAPI--
A0A5C5YT05      VELDMRKRE---------------------VERLESLHDVLFEKIAAVDIHQV-QAPI--
A0A518D7F9      IRLSMLERD---------------------VARLEKLHDVLFEKLETVDTHQL-QAPV--
A0A5C5ZIP0      VKLEMLSRE---------------------VERLEKLHDLLFNKIATVDIRQV-QAPI--
A0A518KBK3      VKVDMLDRE---------------------VERLEKLHDLLFEKIATVDIHQV-QAPI--
A0A5C6AKF9      VKLEMLNRD---------------------VARLEKQYDAVCDKISAIDMTQV-QAPI--
A0A2E0X4J3      LKLASLQEA---------------------IERSESENELVDEQIKEVNLTEK-VGAT--
A0A5C5YU10      LKLFSLEET---------------------YARAISDSDEVEERIKELDLNKK-VGAM--
A0A517MPZ6      AKLTTLENS---------------------LARTVRDVDRVDEQIKGINLTED-VGAM--
A0A5C6CNV7      AKLALLEES---------------------LARTARLTDILDERIKEVNLIED-VGAM--
A0A518K5H4      AKLADLQEA---------------------YEQTSEYCDTLNKQIREVNLSEN-VGAM--
A0A5C6AA28      AKLDALQEA---------------------HDRTARMCDILDERIKEVNLSEE-VGAM--
A0A2E9VK20      EREQTLSDE---------------------LKRIKSLHDIVANRVEVLSLAPD-EG----
A0A3D4PJK1      EREQTLSDE---------------------LKRIKSLHDIVANRVEVLSLAPD-EG----
A0A0S8GZ23      FEIRTRQAE---------------------MARDQSEYNLVLERIDDIEIKRQ-RPA---
L0DC26          VDLFSIQEE---------------------IANADEVARTIGKEVEALTV-EL-QAPP--
A0A354PCQ3      AELQFAQEE---------------------LAVSNSVLMKLRDRVAAIRTERR-QDGA--
A0A1I3DDV4      LKDKMIQAE---------------------MTRKQTLYDSIVEQLREMDTAAG-LSGY--
A0A2E2N5A9      FKVRELALE---------------------VEANRALYDTFLVRLKETAATAD-QNSV--
A0A2E3GWC6      SQDQSYKED---------------------LQRIRSLHDVVTRRIEELSLAHD-EG----
F0SLB0          SQDQSYKED---------------------LQRIRSLHDVVTRRIEELSLAHD-EG----
A0A2E0SMM6      SMIKQKETD---------------------QERILHQHDTLLQKIREVDL-DD-RAEV--
A0A1N6DAJ8      VDLFSVQEE---------------------IANADEIARTIGKEVEALTV-EL-QAPP--
A0A5B9PJZ8      ERLLALQRE---------------------RDRLELYSDNTIDKLGEVEVLKD-FKWR--
A0A2S8G191      IDVEMMRTE---------------------IDSLEGILSRLGHEIENTKI-EL-KSDS--
A0A2E7EGG1      LDLKFKQAE---------------------LNRKQQVFDSISERAAQIAT-EM-YAPS--
A0A225EH48      VQGIIDLGD---------------------LGPLKEQRAAMEKERLDLDL-LD-RSDS--
A0A3L7NDH9      ARLDIADHD---------------------LRWLRELRNTILNQIASVDLRQE-HGGV--
A0A518INW8      LEGTALKAK---------------------MTRAQQRYDVVMERLQELELTSD-YAGY--
A0A518JPH9      LEGTALKAK---------------------MTRAQQRYDVIMGRLQELELTSD-YAGF--
A0A2E2CCW9      VIDQSYNEE---------------------IAQLKSQRDNIFKQLLVERVSQG-NSGY--
A0A3C0AGX3      VIDQSYNEE---------------------IAQLKSQRDNIFKQLLVERVSQG-NSGY--
A0A518AAQ5      VVDQAYNEE---------------------IAQLKSQRESIFKQLLLEKVAKG-NSGY--
A0A517QBG9      VVDQAYNEE---------------------IAQLKSQRESIFKQLLLEKVAKG-NSGY--
A0A518FTU3      VVDQAYNEE---------------------IAQLKSQRESIFKQLLLEKVAKG-NSGY--
A0A2E7K7A9      VVDQAYNEE---------------------IAQLKTQRESIFKQLLLEKVAQG-NSGY--
A0A517PTS5      VVDQAYNEE---------------------IAQLKTQRESIFKQLLLEKVAQG-NSGY--
A0A517WHH5      VVDQAYNEE---------------------IAQLKSQRESIFKQLLLEKVAKG-NSGY--
A0A5A8BGT3      VVDQAYNEE---------------------IAQLKSQRESIFKQLLLEKVAKG-NSGY--
A0A517VTK3      VVDQAYNEE---------------------IAQLKSQRDNIFKQLLVEKVSQG-NSGY--
A0A517WQT4      VVDQAYNEE---------------------IAQLKSQRDNIFKQLLVEKVSQG-NSGY--
A0A517VID8      VVDQSYNEE---------------------ISQLKSQRDNIFKQLLVERVSQG-NSGY--
A0A517RK10      VVDQSYNEE---------------------IAQLKSQREDIFKQLLLEKVSQG-DAGY--
A0A518IH18      VVDQSYNEE---------------------IAQLKTQREEIFKQLLVEKVSQG-DGGY--
A0A5C5VEK8      LKLMSLQEA---------------------YERAVSQADVVEQRIKELDL-TT-QAPV--
A0A532UTJ0      LTIQELQET---------------------LEFNKETYASVVRRIQDLELQRD-RPKR--
A0A517NSK8      MMAESLKLE---------------------LVRKQALYEKMSDTLSELNFVRD-YAGF--
A0A5C5Z0D6      MQTETMRRE---------------------VLRRQELFKDTQDTLKELNFVRD-YAGF--
M5UE94          VQAESMRRD---------------------LERRQAIFDDTQSTLKELNFVRD-YAGF--
A0A1P8WN28      AGIQVAERE---------------------VETLRELHSSLLKRLNSINPDHG-SGAF--
A0A3B9CTT0      ASIDFKERE---------------------IESLTELRSSLLNRLNSIKISEN-ATHF--
A0A5C5XLF4      EREQTLSDE---------------------LKRIKSLHDIVANRVEVLSLASD-EGYQ--
A0A2D5NDU9      LEYNQLNSR---------------------AERTKQTLDNAYAQLQRINIDPD-SGKT--
A0A286RGB6      IEVEFLRAE---------------------VELARKTLQTIAEERNRLAI-EL-RAKP--
A0A1V5N3W2      LAIQEQQDQ---------------------LALNQELYETIRRRIQELEVERK-RP----
A0A3E0MY27      PELERRKDE---------------------LERLESVSNELGLRLQKLQLELS-VQKP--
A0A2E0X9P6      AQLEFAKAE---------------------LAREEKVFELIAARKLALQT-EL-DAPD--
A0A286RLF2      AQLEMLKND---------------------ITGLRELYGGLVRRITSLDL----AGDL--
A0A5C5ZM48      LEVEFMRAE---------------------LTLAEEMQQEVASRITRMQV-ES-QAID--
A0A5B9WF77      VQAAFLNTE---------------------LANLTTAGQQIERRLLQLKFTQD-KSAV--
A0A518BBX8      IKDEAFRKE---------------------IDQTQQLYDSIITRLQDAGLVTQ-SGGY--
A0A518ALT3      AELDIVKSE---------------------LEREQNVFELISARKLALET-ER-GAPT--
A0A517MDV3      LRDQEIRDE---------------------LFATKQLQLAVIDRLRQLNVMQG-YGGF--
A0A3M1QRP3      GALSKALRE---------------------LQTMREQYEQIRRTRQQQEIERF-APAS--
A0A517TMV0      VRVEMLQRE---------------------INRIEEHNKLSYEKMQSIDLQQV-SAPI--
A0A2E3RCU8      AHITMLEQN---------------------VMRLRRLHDAIIDQIASVDLRHG-EGEI--
A0A3E0MY88      HEIQFLERE---------------------IGQLSNLYGALADRIASVDLAKD-QGDI--
A0A1C3E6N1      AKLEILQMD---------------------TKRLRAFYDLVLERIRGIDLGKD-KG-I--
A0A518GJT2      AKLEILQMD---------------------TKRLRAFYDLVLERIRGIDLGKD-KG-I--
A0A286RD13      ADLEAERAE---------------------VERLKAIAARMGDELERWNIELA-APPR--
A0A517MLW3      SEMLLSQRE---------------------VDRLSRAYDALLEKIHGVDLGQD-QAAV--
A0A5B9QVD0      SEMLLTQRE---------------------VERLNRSYDTLLEKIHGVDLGSD-QAAV--
A0A3B8PNV4      SRIKLLNFD---------------------LARKRELSVALIDQINRTDLGKE-RGGL--
A0A3D1DR40      SRIKLLNFD---------------------LARKRELSVALIDQINRTDLGKE-RGGL--
A0A2E7RYU8      SRIKLLNFD---------------------LARKRELSVALIDQINRTDLGKE-RGGL--
A0A3B8LXG8      SRIKLLNFD---------------------LARKRELSVALIDQINRTDLGKE-RGGL--
A0A350CI62      TELGDLDRQ---------------------IEHLYDQQKSLQSQSDGIGL-NK-DTFL--
A0A4P5WQK6      TELGDLDRQ---------------------IEHLYEQQKSLQSQSDGIGL-NK-DTFL--
A0A3C1X4W5      TELGDLDRQ---------------------IEHLYEQQSSLQSQSDGIGL-NK-DTFL--
A0A3D3W3A7      TELGDLDRQ---------------------IEHLYEQQSSLQSQSDGIGL-NK-DTFL--
A0A518DRX3      AALQLVDNE---------------------VQRLRRLHETLLNQISKIDINQN-QSDV--
A0A518DZF9      AALQLVDNE---------------------VQRLRRLHETLLNQISKIDINQN-QSDV--
F0SI78          NRGRVLRED---------------------LNRTKKLYDVVLEKLQEISLVDE-TSVL--
A0A518IQ30      TSLQLVENE---------------------LQRLRNWHDTLLNQIANIDLQTE-GGDI--
A0A517LWP4      TSLQLVENE---------------------LQRLRNWHDTLLNQIANIDLQTE-GGDI--
A0A518JNW8      TSLQLVENE---------------------LQRLRNWHDTLLNQIANIDLQTE-GGDI--
A0A2E7ENQ5      ARVAIIEHD---------------------LRMLRELHDTLRNRIANLDIRQD-QAEV--
A0A1G3AQE9      ARLDNLDRE---------------------VERLRRLHDVLCDRINDLDLSRE-GQQI--
A0A3L7UQT9      ANLIIVEME---------------------RNRLQANDESLLKQIEKLQLV-S-GEGI--
A0A4P5YBU2      ANLIIVEME---------------------RNRLQANDESLLKQIEKLQLV-S-GEGI--
A0A518AKT8      VELRTCERD---------------------LVRLENLHDSLIDRLDSADIYQS-QGPI--
A0A5C5ZR72      VELEFAKSE---------------------LAREAKVFEMIASRKLALQT-ES-KAPA--
A0A517TY85      AELEFKKSE---------------------LEREESVFELIAARKLALQT-EQ-RAPE--
A0A5B9QEI7      AELEFAKAE---------------------LEREESVFELIAARKLALQT-EQ-RAPT--
A0A5S9IJB5      TQYQLLKKK---------------------YNALEETYLSVKQRLGQLELDKD-SQGEEE
A0A1G2XVR0      TVYRRLQRE---------------------ADSERAFYDILLKRMKESNIAGD-LQTS--
A0A1G3B0P0      TVYRRLQRE---------------------ADSERAFYDILLKRMKESNIAGD-LQTS--
A0A1E3X4X0      IKYGILKRE---------------------ADTNKDLYEILLTRLKEASMTGA-LKTS--
A0A286U4B3      ISYKVLKRE---------------------VDANTQLYEGLLQRMKQATVSSQ-IKTT--
A0A5C6DDS2      IGYKVLKRE---------------------VDANTLLYEGLLQRMKEAAVSSE-IKTT--
A0A0S8J591      LQLEGLRKQ---------------------QENIEEMRAVLDKAAETVKTYRS-YEDI--
A0A2E3GW02      NRGRVLRED---------------------LNRTKKLYDVVLEKLQEISLVDE-TSVL--
A0A1U9NL64      AQYTILESE---------------------YQQSKKLNDILDERIKELNITED-VGAL--
A0A5B9QNZ7      LRDQQIRDE---------------------LYATKQLQLAVIDRLRQLNVMQS-YGGF--
A0A1U7CZ81      YAAERLKAD---------------------IETLVEQYKHISEKFENLKFAGT-TD-V--
A0A142YNY8      YTARYLQAE---------------------IDSMTHDQQIVHRRLEDLKFRTD-RDMV--
A0A1U7GLS6      YQAQFLQNE---------------------IRVMVDDERVVNRKLQELEFSTN-KDMV--
A0A1Z8N7H5      SHITMLAQN---------------------VSRLRRLHDAIIDQIAGVDLRQG-HGEI--
A0A1G2YPI3      NKYTLLQSD---------------------WEQTKKDCDILNDRMKELSVTED-VGAL--
A0A532UIN2      AQYTILQSD---------------------WEQTRRLCDILDERIKELNVTED-VGAL--
A0A532UD06      AQYAVLQSE---------------------LNRAERICEILDNRIKELNVTED-TGAL--
A0A660URN1      AEYSVLQSE---------------------LKRTERLCDILDNRIKELNVTED-VGAL--
A0A0S8KNX5      LTIQELQDG---------------------LLLAKEMYDTVQRRIQDLEMQRK-RPAR--
A0A3D3UVZ8      LTIQELQEG---------------------LESTKEAYQIVLKRIQDLELQRK-RPTR--
E8R3W3          FKIEQIKEE---------------------LNTADRISELLSNRIEEMRVELD-APP---
A0A517NFU9      MKGSSMKSK---------------------LTRAQSRYDEVILRLQELKLSRS-YAGF--
A0A5C5YWH4      MKGASLRAR---------------------HSRAQMRYDEVIRRLQELNLSRS-YAGF--
A0A3D2TNK4      VQFRALERA---------------------VARDEAKSDILTDKIANIDFRQN-QAPI--
A0A0J1B4A0      LLGSSLKAN---------------------LDRAQARYDEVFQRLHEINLTND-YSGF--
A0A142WSB9      AADQKRKDE---------------------IAAKQKELESVRMQIADYNQSRS-QEGY--
M5SZR3          IAEEEFQSN---------------------MEHTRQLYDGVVAQLQAASLSRD-YGGF--
M5TW92          IAEEEFQSN---------------------MEHTRQLYDGVVAQLQAASLSRD-YGGF--
A0A2S8FKY2      VEVEMKRSE---------------------IASLDEILQQLNTEIERTNI--E-LRGA--
A0A517N8P6      GENASFLRR---------------------IARYQETLDLYDTQLEKANLPGM-NSGL--
A0A432MJP4      AEEENIRAQ---------------------LDRQQRLFNTVVDQLKQAQLVGE-YSGV--
M5UQ35          MEGNSLKAN---------------------LDRAQARYDEVFQRLQEINLTND-YTGF--
A0A5C5WTY6      RSDRLLQNE---------------------IDRQRALFDGVMERVVNMNSAGD-TASF--
A0A5C5Y033      LKDLVLQKK---------------------IARHEAIFDGIVGQLQELNTASG-LSGF--
A0A5C6G1Y2      LKDLVLQKK---------------------IARHEAIFDGIVGQLQELNTASG-LSGF--
A0A354PDV6      LQDMVLRKK---------------------IERQEKLFDGVVQQLRELDTASG-LSGY--
A0A5C6FZ02      LTDVVLRKE---------------------VERNEALFDGVVQQLRDVDIASG-LRGY--
M5TIT3          LTEMVLQKK---------------------ILRQEALFDGVIQQLRDLDTASG-LSGY--
A0A5M6CY44      LRDLVLQKN---------------------IERQEALFDGIVTQLRELDTASS-LSGY--
F2AXG2          LNDMMLRKA---------------------IARQEALFDGVVKQLHDLDTTSE-LTGY--
M2BB46          LRDMMLRKA---------------------IERQEALFDGVVQQLQNLDTTSE-LTGY--
L7CLQ6          LNDMILQKK---------------------IAREEALFDGVVQQLRELDTAKG-LTGY--
A0A0J1B719      LTDMILQKK---------------------IGRQEALFEGVVQQLRALDTASG-LTGY--
Q7UF18          LTDMILQKK---------------------IGRQEDLFEGVVQQLRELDTASG-LTGY--
A0A2G1W1E0      LTDMILQKK---------------------IGRQEDLFEGVVQQLRELDTASG-LTGY--
K5E235          LTDMILQKK---------------------IGRQEDLFEGVVQQLRELDTASG-LTGY--
A0A5C6FFI9      LEGNAKKAK---------------------VTRAQIRYDEVIRRLQELNLAGS-YAGF--
A0A3A0DET7      VQLNSLQEA---------------------YERTANMCDILDERIKEVNLTEE-FGAM--
A0A5C5WDJ1      MKAGALRAI---------------------RSRAQSRYDQVIERLQELELSRS-YAGF--
A0A5C5X547      ADVEMLRGD---------------------IASLEQVVSNLAAELERTRVESK-GQSK--
A0A2A2W9R6      LKGTAFKAN---------------------LDRAQARYDEVFKRLQELNLTND-YSGF--
A0A518HKC1      LKGTALKAN---------------------LDRAQARYDEVFKRLQELNLTND-YSGF--
A0A518L3P0      LKGTALKAN---------------------LDRAQARYDEVFKRLQELNLTND-YSGF--
A0A255R1S0      LEGTSLKAN---------------------LERAQARYDEVFKRLQELNLTND-YSGF--
A0A5B9MKP1      LKGASLKAN---------------------LDRAQNRYDEVFKRLQELNLTND-YSGF--
A0A0S8FY64      HVYSRLERD---------------------AERQARVFDVIVDRMREVDLTKD-VGVT--
A0A1N6KFT7      EEYETKLKEDLVAAKQSELGLLEEERLHGNLDRQKALYNTVLDQLKQAQLVSD-YSSI--
L0DFG4          EEYEIKFKDDLVSAKQSELERLEEERLHGNLERQKALYNTVLDQLKQAQLVSD-YSSI--
A0A5C5XXG1      LTDVVLRKE---------------------VERNEALFDGVVQQLRDVDIASG-LRGY--
A0A518BJJ1      RRLASPMRR---------------------LETHKQIAAFLLTSLQEAEITRA-STVA--
A0A518D182      RLLAAPLRR---------------------LETHKELTALLLKSLQEAQIARA-SALS--
A0A353FIP5      RKLAKFQRK---------------------ANAYEQIYTYLLGKEQEARIAAG-AAVE--
A0A5B1CIK7      LNDMVLRKK---------------------IERQEALFDGVVQQLRDLDTASG-LSGY--
A0A5C5WHS2      LKDLVLQKK---------------------ISRQEALFDGVVQQLRDLDTASG-LSGY--
A0A5C6B6G8      LQDMVMLKK---------------------IDRQEALFEGVVSQLRDLDTASG-LSGY--
A0A5C5ZZN3      LTDMILQKK---------------------IARQEALFDGIVQQLRELDTASG-LSGY--
A0A5C5XS91      LTDMVLQKK---------------------ITRQEALFEGIVQQLRDLDTASG-LSGY--
A0A5C6C4E6      LTDMVLQKK---------------------ITRQEALFDSIVQQLRDLDTASG-LSGY--
A0A2E1VVJ1      RELIRLQRE---------------------ASSHEAVYLILMQRLQEAKIAQA-ATIE--
A0A3M2AEL0      RQLARFSRR---------------------AAAFEQIYTLLLTRLQEAQITEA-ASLA--
A0A532UT69      AEYTMLQSD---------------------WEQTKKLCDILNERIKELDVTEE-TGAL--
A0A2D5AWU0      QQIDNYESE---------------------FDSIRDFSEHLKSRLNELDVENQ-TGAL--
M5RT57          LELEFARAE---------------------LEREERVFDLIAERSMALTTESR-APG---
A0A356KTN1      RLYESLKNE---------------------VDANRTFYEEFASRLKDL---LH-AAPLAV
A0A518HFS8      LDLHWVEDE---------------------IDLSTEVARAVGSEVRAVTVELE-APP---
                                                                            

A0A5S9IPR9      -ILNPIDSAGIPGRPFSPNRTQNYLVGT---FLGVMLGVIFVFLIEFLDQSIKTVEEVQQ
A0A533Q9U4      -NIKVLDHAEVPIKPIKPKKALNILLGI---IAGLGCGVGIAFVMEYMDNTIRTQEDVEK
A0A1U9NNE1      -PARVSVAYYASSVIAKDKRQKLAIVAV---LGSICCGGFLGVMIDRSDKRMRTPTDLNK
A0A2G2JCA2      -RVALLPEIPVPTVPIEKLPYKNMLMIF---MVGLAAPFGLAVLKEALTVKVSGREQLEL
A0A533Q6B7      -NIRVIDYAEVPLGPYKPNKSINTLVGI---ITGLACGVGIAFLMEYMDKTIKTQEDVKK
A0A351FYP6      -SVEIIDKADTPLRAVRPNVPLNISLGV---IVGLILGVGLAFFIEYLDTSVKTIDDVER
A0A2E7ESJ6      -NYQTLAKPTVGDK-VAPLLLKVMPIAA---LFGVVVGFGIAYLVDVADKAFRTPDEVAS
A0A1G2YQB7      -LARISVAYLASTAPYQDRRMQFSIALM---MAGCVSGMGLALLTNKLDVRLKTPDDM-K
A0A353P687      -LARISVAYLANTAPYQDRRMQYSLAIT---MGSLVFGLGLALITNKLDLRLKTPDDITK
A0A356EME5      -RVVLFDEATPPDAPLVEIPLAKMGLAA---MVAFCVPFGLALGWERIVRRISGAEDLEH
A0A355AI52      -RTTVVREPVVAERPVSPKLSLTILAVL---TGGLASGIGIIFVIDTLDDRARSPEELQA
A0A3L7SI46      -KISVPTVAKVVPSAVAPKISTTVFLCT---LFGLMSGMAIIYVIDVLDDRFRSPDELQT
A0A3L7P4E4      -RTQVLA-PATRGYQVEPNFQKCIIVGS---VAGIAVGLLLGLLVEAADKSFRSPDDISQ
A0A3L7PEB5      -RTQVLA-PATRGVQVEPNFQKTMIMGS---ALGVLVGLLLGFLVEAADKSFRSPDDISQ
A0A2N1UCJ3      -NISILETARPAEFATSPKKAPTLAASL---ILGLLFGLALAITRERLDWRLRSAEEISM
A0A517ZCB5      -RTAVISEPQVNPVPVSPRLTVVAMLCL---IIGTGGGLATVYLMDIIDDRFRSPDQLRS
A0A432MFP3      -DTITVIDPATPGLMLSNKRDKFLALTP---LAMLGLVLGLVTLVELRSGRVGGTEELSG
D5SZ21          -RTAVVGEPKVNPRPVHPKLSLTVAVSL---MAGISLGLALVYLADLLDDRFRSPEETSL
A0A518CHE5      -LAKTVKKPEISRYPISPNKIRTAMFSL---ILGIAMGIGVIVVLEALDDRFRSPDEIKY
A0A257WS34      -RIRVVSEPRVNEQPVSPKLSTTGILCL---FLGTTLGLGVIYLRDAIDDRFKSPDELQA
A0A2E8FLY0      -RTKIVSQPKAAKSPVTPRLLVVALCAL---TTGLGLGLGLIYVLDYFDDRFRSPDELQL
A0A3D2U1E1      -RTKIVSQPKVAKAPVSPRLLIVAFAAI---VGGLGSGLGLIYVLDYFDDRFRSPEELQV
A0A1P8WP26      -RTEISSPPRVNQLPVSPRPVIVGFLSI---FFGTAGGLGIIWVLDIMDDRFRAPEELKL
A0A3L7V1F3      -ITSIPRKPTLSTRPVNPRLAITGILSL---MLGSIAGLGIIWVLDIMDDRFRTPEELKL
A0A5B9QF68      -QATVVREPVPDRVPVSPQIRFLVFFCL---ASGTAVGAVIVYVQDVLDDRFSSPEELTA
A0A5B9QGF0      -QATVVREPVPDRVPVSPQIRFLVFICL---ASGIAVGTAIVYVQDILDDRFSSPEELTS
A0A5C6CK24      -QATVVREPVPDRVPVSPQIRFLVFICL---ASGTAVGTVIVYVQDVLDDRFSSPEELTA
A0A2E8B0L9      -RVSMVNEPKANERPVSPRLALTGILSL---IGGLGIGCALVYVMDLVDDRFRSPDELRD
A0A5Q4GFE7      -RVAVVSEPKASDRPVSPKLPLVAMLCL---VGGLGIGLALVYVIDVLDDRFRSPEELQQ
A0A2E3GWX1      -RTRITKHAEPNPAPVSPRLTLTLAMSI---VAGMGLGALTVLLMDLLDDRFHSPDELKS
F0SG60          -RTRITKHAEPNPAPVSPRLTLTLAMSI---VAGMGLGALTVLLMDLLDDRFHSPDELKS
A0A2E9VST2      -RTRITKHAEPNRIPVTPKLTSTLMLSI---FAGLFLGATTVLLLDLLDDRFHSPDELKR
A0A356A6X2      -RTRITKHAEPNRTPVTPKLTNTLLLSI---LAGLFFGATTVLLLDLLDDRFHSPDELKR
A0A5C5XLM3      -RTRITKHAEPNRTPVTPKLTSTLMLSI---LAGLFFGATTVLLLDLLDDRFHSPDELKR
A0A3M1VCL4      -KTEVVSHPKVVPQPVSPRLVLVALVAL---TLGTTTGLGMIYVLDSIDDRFRSPEELQL
A0A5C5V7Z9      -RASIVEEPLPEETPVSPRFASLFGSAI---LGGLALGAVIVFVRDQLDDRFTSPDEMSA
A0A5C5YT05      -RASIVEEPLPEETPVSPRFARLFGSAL---VGGVLLGAGIVFIRDQLDDRFASPDEMSQ
A0A518D7F9      -RVTVIEEAMPNERPVSPQLRLVVLASL---CGGLAVAAGVVYAQDLLDDRFGSPEEMSR
A0A5C5ZIP0      -RATIVQEPLPSDRPSSPQLKLVLVASL---LSGLAIGLGLIYVQDLMDDRYGSPDEMAL
A0A518KBK3      -RATIVEEPLPSDLPASPQLRLVLVASL---MAGLCLGVGLVYVQDLLDDRFGSPEEMAM
A0A5C6AKF9      -RATIVQEPLPADRPASPQLRMVLMASL---LGGLCLGIGVVYVQDLLDDRFGSPEEMAL
A0A2E0X4J3      -KVNIMEVALPALEPSYPSRPKFLAAGV---MLGSLMGFGLGWLRNLLDHRLKSADEIGE
A0A5C5YU10      -NVSIIETASAPKLPTYPSRAKFLGAGV---MLGALSGFGLAWLRDMLDHRLKSVDEIQE
A0A517MPZ6      -NVSIMEVARASSEPTYPIPARFLAIGA---LLGGLTGFGLAWLRDLMDHRLKSIEEIAA
A0A5C6CNV7      -NVSILEVAGPTTVPTYPNRTRFLGVGG---LLGGLVGFGLAWLRNLMDHRLKSIDEIAQ
A0A518K5H4      -NVSILEVATP-GIQTFPGRRKTLSLGL---AFGSMLGFGLAWLRSMLDQRLKSIEEIAS
A0A5C6AA28      -NVSILEVAGP-GMQTFPDRPKTLSLGL---AFGAMLGFGLAWLRNLLDHRLKSIEEIAS
A0A2E9VK20      --YQLTQISPSRAEPDIKHVIKIVGGCL---VMTLMSTYAFLFLREMRDTSVKSLADLRA
A0A3D4PJK1      --YQLTQISPSRAEPDIKHVIKIVGGCL---VMTLMSTYAFLFLREMRDTSVKSLADLRA
A0A0S8GZ23      ---RITISDEASTGPPVTKREKLLAALA---IGALALGISFALLMGKIDKTIYDPEDIER
L0DC26          -RIRLLEKAELPHTKDEIRQIKMAGMAG---CGAFALTLLGISLWETRARRIDSAADVIQ
A0A354PCQ3      --VRTLTLATPPSSPVTALPVKHMGMAA---SAAMMVPFLFGLLWEL---RMRRITDSSM
A0A1I3DDV4      -IHEVLEEPQAGEE-VWPALNICVAGGM---FLGLCLGVLVAICNDQFDNRFRTPSEIDS
A0A2E2N5A9      -NVHVVDRAMVPEEPVKPNRPLIVAVAG---LIALFFVAGTGVVKDVLNDTFTTTEDIEN
A0A2E3GWC6      --YQLQQISPSQAELDFKRILKIVGGIT---IMLLVATYGLLFLLALRDTTIKSLADVRS
F0SLB0          --YQLQQISPSQAELDFKRILKTVGGIT---IMLLVATYGLLFLLALRDTTIKSLADVRS
A0A2E0SMM6      -LAKIVKKPEISRDPISPNKVRTALFSL---IMGISLGVGVIVVLEALDDRFRSADEIKY
A0A1N6DAJ8      -RIRLLEKAELPRTKDEIRQIKMAGMAG---CGAFALALVGVSFWEFRSRRVDSAADVIK
A0A5B9PJZ8      -KMSELNPASVAEQ-VAPSLPLCLGGGL---FLGTLLGFLFAGVKEMAEKTFRSSEDIAA
A0A2S8G191      -RVTFFQDAQPPKSKNPRSFAKIGMFG----FAGMMIPVAGFVFWDLRSQRINAPSDISK
A0A2E7EGG1      -RVELVQKATTPEVPVQNLPWKMLLVSV---LASISLPFGLFLIWERTLKRVTSSEQLQV
A0A225EH48      -RIQLRQPAVVSQLLNIQKKILCGIAAF---FAGFLLIALAVAFLEWRSRRVDSVDQVVN
A0A3L7NDH9      -KMSVVREPLVPSKPVSPNLLLTLVAVL---VGGGAVGIGMIVVVDVLDDRIRSPEDLQT
A0A518INW8      -TIDLLSPPGPGSL-VWPVLAKILLNGG---LAGLLVGGLLAFWAEHADQTFRDPSDLQH
A0A518JPH9      -TIDLLSPPGVGGQ-IWPKLSKILMNGA---LAGLLVGGLLAFWAEYADQTFRDPSDLER
A0A2E2CCW9      ---MLTQLAPVKDELVIKRQLKFLMAGA---AGGLGLILAFSYFREMRDTTMKSVDEIRN
A0A3C0AGX3      ---MLTQLAPVKDELVIKRQLKFLMAGA---AGGLGLILAFSYFREMRDTTMKSVDEIRN
A0A518AAQ5      ---TMTQLSPVKDELVIKRQLKFLMAGG---AAGLGLVLALSYFREMRDTTIRTVDEIRN
A0A517QBG9      ---TMTQLSPVKDELVIKRQLKFLMAGG---AAGLGLVLALSYFREMRDTTIKTVDEIRN
A0A518FTU3      ---TMTQLSPVKDELVIKRQLKFLMAGG---AAGLGLVLALSYFREMRDTTIKTVDEIRN
A0A2E7K7A9      ---TMTQLSPVKDELVIKRQLKFLMAGG---AAGLGLVLAFSYFREMRDTTMKSVDEIRN
A0A517PTS5      ---TMTQLSPVKDELVIKRQLKFLMAGG---AAGLGLVLAFSYFREMRDTTMKSVDEIRN
A0A517WHH5      ---TMTQLSPVKDELVIKRQLKFLMAGG---AAGLGLVLAFSYFREMRDTTMKSVDEIRN
A0A5A8BGT3      ---TMTQLSPVKDELVIKRQLKFLMAGG---AAGLGLVLAFSYFREMRDTTMKSVDEIRN
A0A517VTK3      ---TLTQLSPVKDVLVIKRQLKFLLAGG---AVGLGLVLAISFFREKQDTTLKSVDEIRN
A0A517WQT4      ---TLTQLSPVKDVLVIKRQLKFLLAGG---AVGLGLVLAISFFREKQDTTLKSVDEIRN
A0A517VID8      ---ILTQLAPVKDELVIKRQLKFLMAGT---AAGLGLILAFAYFREMRDTTMKSVNEIRN
A0A517RK10      ---TLTQLAPVKDELVIKRQLKFLMAGG---AVGLGLVLAISYFREMRDTTVKSVDEIRN
A0A518IH18      ---TLTQLAPVKDELVIKRQLKFLIAGG---AVGLGLVLAISYFREMRDTTVKSVDEIRD
A0A5C5VEK8      -NVSIIETASVAPDPSYPSRPKFLGAGV---MLGALCGFGIAWLRDMLDHRLKSVDEIQE
A0A532UTJ0      -ISVYYHADVANINDKRIKLSVAVI------FGALVCGMGLAYLRDKADLSLRTPDDVAK
A0A517NSK8      -DTDVIGDADIQEQSSWPDPKIVLPLGM---IAGLALGVMLAFIADLCDTTFADPEDVEK
A0A5C5Z0D6      -STDVIGDAETQRRPSWPNPLIVLALGI---FAGGLLGFGTALLADVMDTTFVDPDDVQH
M5UE94          -STDVIGDAESQERPAWPRPLIVLALGI---FAGGMFGMGMALLADLMDTTFVDPDDVQA
A0A1P8WN28      -KVAPLSDPRIPKFAVYPVLTNTLVMFC---VAAVALALGVIYVIDLMDDRLRSPEEVRD
A0A3B9CTT0      -KVAVLSDAMVPRTPSLESLNSRLIFYC---VLAVMAAMGVIYVLDLMDDRLRTPEDVQD
A0A5C5XLF4      -LTQI------SPSRAEPDIKHVIKIVGGCLVMTLMSTYAFLFLREMRDTSLKSLADLRA
A0A2D5NDU9      -VAHVLDYAEPNEAKLASGQPIRLPTGI---LLGLLAGIALAWFQGMLDTRVRTAEELQR
A0A286RGB6      -RITVVQRAEVPRVADSDRRIQLAIMGG---LAGFILPGAVLLWWDVRRKPVNTAHELPH
A0A1V5N3W2      --ARISVAYNASSLPLPSKRIKLMGAAL---FGALAAGIFLAFVRDKADKNLYTPEDLAR
A0A3E0MY27      -KVSLRGEATVPAMYDSSNRDRYTVLAA---LAGFGLAIVGVSLYEFQFRRLSSAHDMTE
A0A2E0X9P6      -RITLKQSAAVPARPLNPIPYELLLVVC---AASLATPFAVGALREVSVRRIATADDLER
A0A286RLF2      -RASVITEPRENRSPVSPSLPRVLIMVI---LGGLTLGMFVVYVMDVLDDRFRSVEEIQW
A0A5C5ZM48      -RVELLREGEIEQTPVVGMPWKKMAAAA---LGCWFLPFAVALIAERSLRRVCDVRSLEA
A0A5B9WF77      -TIPRIDRAKAPRDSFNNKRLKFMAIVP---VVVLGALLGLFLLLEIRAERVVNPDSLSS
A0A518BBX8      -EAKIIAPPELGEQ-VWPMAIIIFPVAG---LLGIMSGLGLVYLVDMADTSFRTSQEIQR
A0A518ALT3      -RASLMHTASPPRLSIEPIPFKLLAIAC---LSALIAPLGLATVREVVVKRVCNADELAN
A0A517MDV3      -VTEILRAPEFGEL-VWPIIPLVLIAGL---CFGSMTGGGLGLLIDLGDRSFRSTKEIES
A0A3M1QRP3      -IRKIADARPSGAADVDKRPKLSLAAVFGAAFAGLLAGLARAYFTGALFEVEGLHDRTVS
A0A517TMV0      -QTTIVEEPLPSERPASPQLRMVLAASL---LGGLVLGVGVVYTQDLLDDRFGSPEEMAH
A0A2E3RCU8      -RATIIKEAAASGQIVSPRLSRVIVFWF---LATIGIGFALVYVQDTIDDRFRTPDEMSK
A0A3E0MY88      -RSEIIKEPAASRVPVSPRLKTVAAACL---FSGLVIGGVVIFVLDTLDDRFRSPEDVTM
A0A1C3E6N1      -RTAVVGEPKVNPRPVHPKLSLTVAVSL---MAGISLGLALVYLADLLDDRFRSPEETSL
A0A518GJT2      -RTAVVGEPKVNPRPVHPKLSLTVAVSL---MAGISLGLALVYLADLLDDRFRSPEETSL
A0A286RD13      -VRVLEEASTPRISNINDKYRLVSFLGL---MAFLGTGAAVV-LLDFFLRPVSSAYQISY
A0A517MLW3      -RVAVIGKPKALIAAVSPRLRLVVLAAG---FFSTLLSVGLVYIADLRDDRFASLEEAER
A0A5B9QVD0      -RVAVIGDPKAGMGAVAPRLKVTAALAL---MLAMGISVGLVFFLDLRDDRFASLDDIER
A0A3B8PNV4      -RTKIVSHPKAAKLPVTPRLLVVALCAL---ACGLGAGLGMIYILDVLDDRFRSPEELRL
A0A3D1DR40      -RTKIVSHPKAAKLPVTPRLLVVALCAL---ACGLGAGLGMIYILDVLDDRFRSPEELRL
A0A2E7RYU8      -RTKIVSHPKAAKLPVTPRLLVVALCAL---ACGLGGGLGVIYILDVLDDRFRSPEELRL
A0A3B8LXG8      -RTKIVSHPKAAKLPVTPRLLVVALCAL---ACGLGGGLSVIYILDVLDDRFRSPEELRL
A0A350CI62      -STKVSSRPTVPIRPVSPRLPIAVLLSL---LIGTGTGLAVIWVLDIMDDRFRTPEELKL
A0A4P5WQK6      -STKVSSRPTVPIRPVSPRLPIAVLLSL---LIGTGTGLAVIWVLDIMDDRFRTPEELKL
A0A3C1X4W5      -STKVSSRPTVPIRPVSPRLPIAVLLSL---LIGTGTGLAVIWVLDIMDDRFRTPEELKL
A0A3D3W3A7      -STKVSSRPTVPIRPVSPRLPIAVLLSL---LIGTGTGLAVIWVLDIMDDRFRTPEELKL
A0A518DRX3      -RVAVVGEPLANENPVSPNLKMTVLLSL---LIGLGGGAALVYGIDLLDDRFRSPEEMVE
A0A518DZF9      -RVAVVGEPLANENPVSPNLKMTVLMSL---LIGLGGGAALVYGIDLLDDRFRSPEEMVE
F0SI78          -TATVVNHPSDGS-EVRLKVFNYAGMGG---MGGLAIGMLVGLLLEYSDKRFRSPEEMMQ
A0A518IQ30      -RVSVVGEPVASPNAVAPQLKVIGLLSL---FAGCGIGIAIAYITDLLEDHFQSPDELEE
A0A517LWP4      -RVSVVGEPVASPGAVAPRLRIIGVLSI---FAGCAIGIAIAYVTDLLEDRFQSPDELQE
A0A518JNW8      -RVSVVGEPVASPGAVAPRLKVIGLLSI---FAGCGIGIAIAYITDLLEDRFQSPDELQE
A0A2E7ENQ5      -RMAVVSEATASDSPVHPRLLTVLATVI---VSGLSLGIGLAYVLDVLDDRFRSVDELKD
A0A1G3AQE9      -CATLLDEPRVNRTPVSPNLARTVLAVL---TLGLGLGLGAVYILDILDDRFRSREEMQS
A0A3L7UQT9      -KVDLNKLPKAGKLPSSPRLVLVVAVCF---ILGIGGGLGLIYILDLLDDRFRSPDELRM
A0A4P5YBU2      -KVDLNKLPKAGKLPSSPRLVLVVAVCF---ILGLGGGLGLIYILDLLDDRFRSPDELRM
A0A518AKT8      -QAVVVEDPLPELKPVSPRIKTVFLMSV---LSGLIVGVSLAYIQDALDDRFNSPEELTA
A0A5C5ZR72      -RVEVMDEVMSSNVPEEAIPWKQLFVAC---AMSMVVPYGVVVLREMALRRVTDSDQIYQ
A0A517TY85      -RVFLMQVAEPPSMALEPIPYKYLLVAC---LASMLAPLGLAVAYEALLRRISSTDQLTK
A0A5B9QEI7      -RVTLMQSASPPHIAIEPIPYKYLLLAS---LVSLVTPLGLAIAYEFLAKRISTPEQLTN
A0A5S9IJB5      -NIYIASPPRIPKTPIWPKTLYILVGAF---LFSCFSGLGLCFALEFLDNSVKGKDQLEK
A0A1G2XVR0      -NVSILDPAMEPRTPIGASRNSQIMKGV---MIGLALGIGLAFFLDYLDNTVKSTEDVEN
A0A1G3B0P0      -NVSILDPAMEPRTPIGASRNSQIMKGV---MIGLALGIGLAFFLDYLDNTVKSTEDVEN
A0A1E3X4X0      -NIRILDAAVVPRHPIKPRVKLNIILAI---IVGLTLGVGLAFFLDYLDRTLSTPEDVER
A0A286U4B3      -NVQIVDRAALPTRPVKPKKRLNVFLSM---VVGLVMGTGIAFFLEYLDNTIKSADDVEK
A0A5C6DDS2      -NIQVVDKAVLPTTPIKPKKKLNVLLSM---IVGLTLGTGIAFFLEYLDNTIKSADDVEK
A0A0S8J591      -KARVISQADIPKGKFSPNPALNLPLGL---VVGLMVGIIAAFFFEYLNTTIRMPRDIED
A0A2E3GW02      -TATVVNHPSDGSEVRLKVFNYAGMGG----MGGLAIGMLVGLLLEYSDKRFRSPEEMMQ
A0A1U9NL64      -NISILEVARAPKDPSKPQKARVAAMAL---VLGLMAGGGLALLRDFMDKRIRGAEEITA
A0A5B9QNZ7      -VTEILRAP-EFGELAWPILPLVLAAGL---CFGSLLGGGLALLVDLGDRSFRSTADIET
A0A1U7CZ81      -DVGLIDAAIAVSEPTNNKRIKYVVIVP---SVILCLVLGLFALLEVKAERVADPDALST
A0A142YNY8      -RVSLYDRAAVPRVPSSSKRIKLMAAAP---MGIMALVLGIFSLLEVKAERVGDPDQLST
A0A1U7GLS6      -RVEQHDPAVPPKRPSDDKRLKLMAAVP---VGVLAVLIGLFSLLEIKAERVGNPDALST
A0A1Z8N7H5      -QATIIKDATASGQIVSPKISRIIVCWI---LGTLGIGFVLVYVQDTIDDRFRTPEELSK
A0A1G2YPI3      -NISILEYARPADKPSKPEKAKYMAMAL---VMGLMLGGGLGLLRDFMDQTLHSAEDISA
A0A532UIN2      -NISILEVARAADKPSEPEKAACLAKAL---IMGFMLGIGLALLRDWMDHRLHSAEEISA
A0A532UD06      -NISVLEVARPARNPSEPQKRKIMATAL---ALGLVFGTCLAFLRDWIDYRLRSCEEISS
A0A660URN1      -NISILEVAYPAIHPSRPQKAKIMMAAL---VLGLMLGFALALVRDWMDYRLRSADEISA
A0A0S8KNX5      -----ISVAYYADIARVLDKRVKYSAALV--FTALVCGMGLAHLRDKADQSLRTPDDVAK
A0A3D3UVZ8      -----ISVHYNADIASINDKRVKYSVALV--FGSLVCGMGLAYLRDKADQSLRTPDDVAK
E8R3W3          -RITLINPADAVRIVGDPTKRLKLSGMIG--AGVFFASLVGIALLEFYSNRVDNLNVLGA
A0A517NFU9      -STDLLESPEVSQSAAWPKLPIIAAIGL---FLGMTLGLLLAVGSELMDSTFSDVADLER
A0A5C5YWH4      -STDLLASPEVSRGAAWPKLPIICALGL---FLGAMLGLALAITTELLDSTFSDVHDLER
A0A3D2TNK4      -RATVVREPIANNNPVTPQIRLIAAVCL---LGGTCVGVVMAYAQDVLADRFNSPEELTL
A0A0J1B4A0      -STDLIVMPLPASVPVWPSRTKIAALGI---LAGGMLGLALALLAEMTDRTFHDPAEVER
A0A142WSB9      -KVSQLSQV-RIERSLKQVLKVFGACGL----LGLISVFALAYVREWYDTSVRSVDEVRQ
M5SZR3          -KANVISPP-GFSWKVKPEALIVFPMAI---FVGTFFGFGLACLAELANRTFRTSDEISK
M5TW92          -KANVISPP-GFAWKVKPEALIVFPMAI---FVGTFFGFGLACLAELANRTFRTSDEISK
A0A2S8FKY2      -PRITLLSEAKTGTVTDKKKPIMITAAAA--LAGFVLPGGLLLLRDFRKKHLSDLPTTRD
A0A517N8P6      -HVKVLRPA-GLGMLVGPLLSRALVMGG---FLGLVAGGALAFLWDWSERTFRSPDEIST
A0A432MJP4      -VTQTIEPPHALRKAVRPRVLLTLCMAL---MSGLVLGTMAALAADGLDSRVRSLDEVRS
M5UQ35          -STDLLVTPSPAMLPVWPAKSKIAAIGI---LLGAMLGAALAMIAELLDRTFKNPEEVER
A0A5C5WTY6      -TQEILEDP-RVGELVWPKPLLCLALGL---LGGVLVGSGVGVSREFMDQRFASVEQFET
A0A5C5Y033      -LYEFLEVP-RLGKRVWPNVPLCSLGGL---VLGLLCGMVLAVGNELRDSRFRTAQEVDE
A0A5C6G1Y2      -LYEFLEVP-RLGKRVWPNVPLCSLGGL---VLGLLCGMVLAVGNELRDSRFRTAQEVDE
A0A354PDV6      -VYELLETP-RPGIRSWPKLSICALGGL---MLGLFGGLFLSIANDLRDSRFHSAVEFEQ
A0A5C6FZ02      -LYELLETP-RIGAKSWPSLPLCGLGGL---MLGVFAGLTLAVANDVRDGRFRSAAEVEE
M5TIT3          -LYEFLEVP-RLGVKSRPKKSLCALGGL---MLGLFMGLSLAVANEIQDGRFRSSAELDE
A0A5M6CY44      -LYEFLEVP-RVGEPVWPKLPLCAVGGL---ALGLCGGLALAFGTDVRDRRFRSAAELDE
F2AXG2          -LYEILSIP-RTGEKSWPKLPLCGLGGL---MLGLFSGLFLAVANDVRDGRFRSAAELDE
M2BB46          -LYEILTIP-RTGEKSWPKLPLCGLGGL---MLGLFSGLFLAVANDVRDGRFRSAAELDE
L7CLQ6          -LYEFLAVP-RTGEKSWPKLPLCGLGGL---MLGLFSGLFLAVANDVRDGRFRSAAELDE
A0A0J1B719      -LYEFLAVP-RTGEKSWPKLPLCGLGGL---MLGLFSGLFLAVANDVRDGRFRSAAELDD
Q7UF18          -LYEFLAVP-RTGEKSWPKLPLCGLGGL---MLGLFSGLFLAVANDVRDGRFRSAAELDE
A0A2G1W1E0      -LYEFLAVP-RIGQKSWPKLPLCGLGGL---MLGLFSGLFLAVANDVRDGRFRSAAELDD
K5E235          -LYEFLAVP-RIGQKSWPKLPLCGLGGL---MLGLFSGLFLAVANDVRDGRFRSAAELDD
A0A5C6FFI9      -STDLLSNPEPAKSPAWPRLPIVLVLGS---FLGFFLGIATGISAELLDTTFRDVEDLET
A0A3A0DET7      -NVSILEVAGPATIPSYPSRARFLAVGL---MLGGVVGFGLAWLRELLDHRLKSVDEISE
A0A5C5WDJ1      -STDLLASAEVPMNPVWPRLSIVLAIGL---VNGAILGLILVVAAETLDSTFSSVEELEG
A0A5C5X547      -RIEVMAYA-TRAQKDDPKKQIALTIGVG--LAGLFAPLILLMWRDITKQHVDDLKTMRL
A0A2A2W9R6      -STDLLVMPAPANFPVWPSKSKIAIMGV---MGGIMLGLGLAMLAELADRTFRNPGEVES
A0A518HKC1      -STDLLVMPVPASLPVWPAKSKIAMMGI---MGGIMLGLGLAMLAELADRTFRNPEEVES
A0A518L3P0      -STDLLVMPVPASLPVWPAKSKIAMMGI---MGGIMLGLGLAMLAELADRTFRNPEEVES
A0A255R1S0      -ATDLLVQPVPARFPIWPSKSKIAMAGL---MAGGMLGLALAVLAELIDRTFKNPGEVEK
A0A5B9MKP1      -STDLLVMPVPASVPIWPSKSKIAMMGI---MGGLMLGLGLAMLAELADRTFKDPGEVES
A0A0S8FY64      -NVSFVERASPPQAPVRPNKQVNLILGA---LLGVLLGVGLAYGLEYLDDTVKTPDDVER
A0A1N6KFT7      -SCQVIEPPSALPYPVQPRVKMTLLMGL---MTGLFLGIGLAYLADRLDPRIRTLDEVRK
L0DFG4          -SCQVVDPPSALPSPVQPRVRMTLALGL---MGGLLLGMGLALLVDRLDPRIRTLDEVRK
A0A5C5XXG1      -LYELLETPRIGAKSW-PSLPLCGLGGL---MLGVFAGLTLAVANDVRDGRFRSAAEVEE
A0A518BJJ1      -AADFIDAAAAPDLRYSPRIGFTLMLSS---VLGLGLGLGLAWLRESLRRSLQGPSELEA
A0A518D182      -SADFVDRAAAPDRRYAPRIGFTLGLGL---VAGVLAGLALLLVREHLAESLESEGELER
A0A353FIP5      -AISIVDWAVPPLLRASPRLTLSSLAGI---LLGLFLGSFFALWRESSQKKIRSTAQMEA
A0A5B1CIK7      -LYEFLEVP-RLGEKSWPKLPICGLGGL---MLGTFGGLFFAVANEFRDRRFRSAAELDE
A0A5C5WHS2      -LYEFLEVP-RLGKKSWPKLPICGLGGL---MLGLFSGLVLAVANEVRDRRFRSASELDE
A0A5C6B6G8      -LYEFLELP-RIGRKVWPSLPICGLGGL---MLGLATGVFLAFANEIRDGRFRTAAELDE
A0A5C5ZZN3      -LYEFLEVP-RMGVKSWPKLPLCALGGL---MLGLFGGLFVAVANDVRDGRFRSSAELDE
A0A5C5XS91      -LYEFLEVP-RRGEKSWPKLSLCGLGGL---MLGLFSGLFLAVANDLRDGRFRSAAELDE
A0A5C6C4E6      -LYEFLEVP-RRGEKSWPKMSLCGLGGL---MLGMFSGLFLAVANDLRDGRFRSAAELDE
A0A2E1VVJ1      -QVEIIDRALPPRLRALPNVRANLVVGI---LLGLAIGSILALARESFTRRIRSAAQLEA
A0A3M2AEL0      -TVDVIDWAIPPDSRSRPILAMNTALGL---LLGLVAAFALGLYREGRVRKILSIAQLET
A0A532UT69      -NISVLELARPANAPSEPQKTRYMATAL---LAGLMLGGGLALARDWMDQTLRSGDEISA
A0A2D5AWU0      -NILVIDYGRPSNTPASPDRVSMMAYAL---AGGVGLAFAIVMLRSFSDKKMRIIGELPH
M5RT57          -RIVLLQPAEPTLHPVASFPLRNMAIAA---FLSGCLPFGLALLWELSTKPISDVDQLTS
A0A356KTN1      ANARIIDRAKGAWRVRP-SHSRNVILGL---LFGFGLGAVIALIFERLSDRLRTLKDAVN
A0A518HFS8      -RIRLLEPAKPQGPADPMERYKFCAMAA---VASMGAFVGLVSLWEFRAQRIDATAEVAG
                                                                            

A0A5S9IPR9      LTPARIMGFIPFISPKIFM-----------------------------------------
A0A533Q9U4      YLKTSLLGIVGHIPLDKKDT----------------------------------------
A0A1U9NNE1      SLSTRIIGTT--------------------------------------------------
A0A2G2JCA2      QSNTPVLAEISQLPKRRT------------------------------------------
A0A533Q6B7      YFGTVLLGIVGHIPQKKKDA----------------------------------------
A0A351FYP6      ALDAAVLGVIPQN-----------------------------------------------
A0A2E7ESJ6      LMRLPVIGHVPLIDPEKIP-----KLPGCN------------------------------
A0A1G2YQB7      RIGVRIIGT-------------------TT------------------------------
A0A353P687      RIGVRIIGT-------------------TT------------------------------
A0A356EME5      ETNLAVIGEIARLPERS-------T---KA------------------------------
A0A355AI52      ELNLPTLATIGILEEED-------FED-GI------------------------------
A0A3L7SI46      QLGLPMLAMIREMEALD-----------GS------------------------------
A0A3L7P4E4      TLRLPIVGISPQIQLGR-------RDRTNP------------------------------
A0A3L7PEB5      TLRLPIVGISPQIQLGR-------RDRTNP------------------------------
A0A2N1UCJ3      VLATPVLGIVPSMSDKG-------KK--DN------------------------------
A0A517ZCB5      ELGLPILAMIRKLPPLA-----------DS------------------------------
A0A432MFP3      RLAAEVFAVPPLPTTRD-------A---ER------------------------------
D5SZ21          QLGAPVLSFIPSLPTYD-----------GN------------------------------
A0A518CHE5      HLNLPVLAMVRKMEETT-----------GY------------------------------
A0A257WS34      QLGLPVLAMIRQMPQPE-----------GE------------------------------
A0A2E8FLY0      QTNLSVLAMVGELPA---------AD--GP------------------------------
A0A3D2U1E1      QAGLPVLAIVGELPPGN-------AE--TK------------------------------
A0A1P8WP26      QLDTQILTMVPALEQFS-----------GE------------------------------
A0A3L7V1F3      QLDTQVLSMIPRMEELQ-----------GE------------------------------
A0A5B9QF68      QLGVPVLAMVRNLTPLP-----------GE------------------------------
A0A5B9QGF0      QLGVPVLAMVRNLTPLP-----------GE------------------------------
A0A5C6CK24      QLGVPVLAMVRNLSPLP-----------GE------------------------------
A0A2E8B0L9      QLGVPVLAMVRRLTVAG-----------NE------------------------------
A0A5Q4GFE7      QLGAPVLAMIRELATPA-----------TA------------------------------
A0A2E3GWX1      QLGAPVLAMVRELPMLD-------V---ET------------------------------
F0SG60          QLGAPVLAMVRELPMLD-------V---ET------------------------------
A0A2E9VST2      ELGAPVMAMVRSLPALP-------H---TH------------------------------
A0A356A6X2      ELGAPVMAMVRSLPTLP-------H---TH------------------------------
A0A5C5XLM3      ELGAPVMAMVRSLPSLP-------H---TH------------------------------
A0A3M1VCL4      QLGAPVLAIVRKLQQLE-----------GT------------------------------
A0A5C5V7Z9      QLELPVLSVVRTLNPLP-----------GV------------------------------
A0A5C5YT05      QLELPVLSVVRTLNPLP-----------GT------------------------------
A0A518D7F9      ELGLPILSIVRQLNPTG-----------GE------------------------------
A0A5C5ZIP0      QLGCQVLALVRQLQPIA-----------GS------------------------------
A0A518KBK3      QLGCRVLAVIRELPLRT-----------GV------------------------------
A0A5C6AKF9      QLGCPVLAVVRDLPARS-----------GV------------------------------
A0A2E0X4J3      ALQLPLVGAIPLAPGVK-------N----R------------------------------
A0A5C5YU10      LLQLQVFGAVRRQLGKI-------G----R------------------------------
A0A517MPZ6      TLQLPVLGALPLSAGKD-------D----R------------------------------
A0A5C6CNV7      VLQLPVLGALPLSSERA-------NDRKGR------------------------------
A0A518K5H4      VMQLPVIGAVPLMAGSR-------GREGDR------------------------------
A0A5C6AA28      VMQLPIVGAVPLVTGAR-------SREGER------------------------------
A0A2E9VK20      IVDTPILGTLPSIANPAKNLQ---AARETG------------------------------
A0A3D4PJK1      IVDTPILGTLPSIANPAKNLQ---AARETG------------------------------
A0A0S8GZ23      CIGVPMIGTTSDLTHVEKKLL---------------------------------------
L0DC26          CLGMNLFGTLPILPRRSRILG---------------------------------------
A0A354PCQ3      CGELSVIGEIARLPSGTRS-----------------------------------------
A0A1I3DDV4      ALGVPVIAQVGKITRSRDKR----------------------------------------
A0A2E2N5A9      KLNIPVLGIVPLVQQAQGAQ----------------------------------------
A0A2E3GWC6      LFEAPILGTLPSVTNPQKNLE---MARQTG------------------------------
F0SLB0          LFEAPILGTLPSVTNPQKNLE---MARQTG------------------------------
A0A2E0SMM6      HLNLPVLAMVRRM-----------EETGGY------------------------------
A0A1N6DAJ8      SLGMNLFGTLPSLPQRSRG-----------------------------------------
A0A5B9PJZ8      ILGSRVIGHVGLFQRVRPRKDSPFSNVA--------------------------------
A0A2S8G191      NLRINVLGAIPFVP----------------------------------------------
A0A2E7EGG1      DNNLPVVGEIACLPEKSIT-----------------------------------------
A0A225EH48      ELGLRVIGTIPAF-----------------------------------------------
A0A3L7NDH9      FAGLSLLTMMGSLEDEAD------RDEEGS------------------------------
A0A518INW8      SLNASVIAHVPRFVVTRKEKK---AAKQSA------------------------------
A0A518JPH9      SLNANVIAHVPRFQVTRKEKK---AAKQSS------------------------------
A0A2E2CCW9      QLHLPILGEVPCFADSDAA-----VD-ESE------------------------------
A0A3C0AGX3      QLHLPILGEVPCFADSDAA-----VD-ESE------------------------------
A0A518AAQ5      QLHLPMLGEVPQFTETPAH-----VD-DSQ------------------------------
A0A517QBG9      QLHLPMLGEVPQFTETPAH-----VD-ESQ------------------------------
A0A518FTU3      QLHLPMLGEVPQFTEKPAH-----VD-ESQ------------------------------
A0A2E7K7A9      QLHLPMLGEVPQFTEEPAH-----MD-DSQ------------------------------
A0A517PTS5      QLHLPMLGEVPQFTEEPAH-----MD-DSQ------------------------------
A0A517WHH5      QLHLPMLGEVPQFTEEPAH-----MD-DSQ------------------------------
A0A5A8BGT3      QLHLPMLGEVPQFTEEPAH-----MD-DSQ------------------------------
A0A517VTK3      QLHLPVLGEVPTFDESVSI-----DDSECE------------------------------
A0A517WQT4      QLHLPVLGEVPTFDESVSI-----DDSECE------------------------------
A0A517VID8      QLHLPVLGEVPSFAESEAV-----VD-DSE------------------------------
A0A517RK10      QFHLPILGEVPAFAESEAA-----MD-DSD------------------------------
A0A518IH18      QLHLPILGEVPTFAESEAA-----MD-DSE------------------------------
A0A5C5VEK8      VLQLQVFGAMKRQ-----------MGRLGR------------------------------
A0A532UTJ0      RIGIRIIGTTTSL-----------------------------------------------
A0A517NSK8      TLGAPVLAHVNRFAPIRRKRNEPAFEID--------------------------------
A0A5C5Z0D6      TLGAPVLAHVPRFEPFKRKRKDPPLKID--------------------------------
M5UE94          TLGAPVLAHVPRFDPIKRKRKDPPFEID--------------------------------
A0A1P8WN28      ELGLNVLGIIRKLPQHEVDQ----------------------------------------
A0A3B9CTT0      ELGLPVLGIIRRLPEEQLSQ----------------------------------------
A0A5C5XLF4      IVDTPILGTLPSIANPAKNLQAARETGLA-------------------------------
A0A2D5NDU9      RLPVPILASMPQ------------TQAAPK------------------------------
A0A286RGB6      AVGVDVWGTIPLVPTRALQMLPEENGRSRR------------------------------
A0A1V5N3W2      TVGVAVVGTTSQLNY---------RDKIGL------------------------------
A0A3E0MY27      GLGMTVMGDVPLLSERPWRL----PGMSGI------------------------------
A0A2E0X9P6      ETALNLLGEVTRFPM---------RPVASR------------------------------
A0A286RLF2      QLRAPVLSIIREMPP---------REGEGV------------------------------
A0A5C5ZM48      HANAPVLCEIARLPSR--------PNSSGR------------------------------
A0A5B9WF77      RVQSEVYALPPIPRQ---------------------------------------------
A0A518BBX8      RLGLPIVGLIPFIAAPKTKGSGEDAQIDAA------------------------------
A0A518ALT3      ETQLPLLGEVACLP----------VRKVGT------------------------------
A0A517MDV3      AVGAPMLGAVGTMKFRRHRGMDKTLS----------------------------------
A0A3M1QRP3      QAG-PLLGPLPLVR----------------------------------------------
A0A517TMV0      QLGCRVLSVVRELQP---------LASHGL------------------------------
A0A2E3RCU8      RVGYPIISLVRALPE---------LGGKGI------------------------------
A0A3E0MY88      RLGAPTLAMVAQLDM---------THQTGV------------------------------
A0A1C3E6N1      QLGAPVLSFIPTLPT---------YDGNGL------------------------------
A0A518GJT2      QLGAPVLSFIPTLPT---------YDGNGL------------------------------
A0A286RD13      GLGLPVLGDLPLIE----------------------------------------------
A0A517MLW3      QTRTEILAVVEKLET---------YGEYGA------------------------------
A0A5B9QVD0      QTQTEILAVVEKLEP---------HGETGP------------------------------
A0A3B8PNV4      QLDVPVLALVGEMPV---------TDELGL------------------------------
A0A3D1DR40      QLDVPVLALVGEMPV---------TDELGL------------------------------
A0A2E7RYU8      QLDVPVLALVGEMPV---------TDEPGL------------------------------
A0A3B8LXG8      QLDVPVLALVGEMPV---------TDEPGL------------------------------
A0A350CI62      HLETQVLSMIPRMTE---------LPGEGF------------------------------
A0A4P5WQK6      HLETQVLSMIPRMTE---------LPGEGF------------------------------
A0A3C1X4W5      HLDTQVLSMIPRMSE---------LPGEGF------------------------------
A0A3D3W3A7      HLDTQVLSMIPRMSE---------LPGEGF------------------------------
A0A518DRX3      QLGAKLLAAIRPLSL---------TETHGA------------------------------
A0A518DZF9      QLGAKLLAAIRPLSL---------TETHGA------------------------------
F0SI78          MLGVPILGHIPEMPASQKRRKRNKSGDTVP------------------------------
A0A518IQ30      QVGVSVIAMIQSLNG---------SGEAGG------------------------------
A0A517LWP4      QVGVSVIAMIQSLNG---------SGEAGG------------------------------
A0A518JNW8      QVGVSVIAMIQSLNG---------SGEAGG------------------------------
A0A2E7ENQ5      QLNVAVLAIVRQLSP---------TSATGV------------------------------
A0A1G3AQE9      VLGVPALAIVQELKM---------NQNSGI------------------------------
A0A3L7UQT9      QLGVPVLAMVRAMEP---------TGGTGA------------------------------
A0A4P5YBU2      QLGVPVLAMVRAMEP---------TGGTGA------------------------------
A0A518AKT8      QLGVPVLTLVQRLEP---------LVGDGL------------------------------
A0A5C5ZR72      DTNLRILGEISSFPKRKVAANPQMLPRRLR------------------------------
A0A517TY85      ESLLPVIGEVARFPRRRVGAAPV-IAGPPS------------------------------
A0A5B9QEI7      ESSLPLLGEVAQFPRQRVATTQAQIAAPQQ------------------------------
A0A5S9IJB5      MMQRPVLGLIAEGKKNKK------------------------------------------
A0A1G2XVR0      YLGVTLLGLVERAKQSK------------------ENKD---------------------
A0A1G3B0P0      YLGVTLLGLVERAKQSK------------------ENKD---------------------
A0A1E3X4X0      YLQVPLLGAVGRIEMDKQKRRSEQPTPASGLGGIADDNV---------------------
A0A286U4B3      HLNATVLGVLEKVEVER-------------------DEV---------------------
A0A5C6DDS2      HLKSTVLGVLEKVAVDK-------------------DEV---------------------
A0A0S8J591      GLGLPVLGFVPAMSPKFKDF----------------------------------------
A0A2E3GW02      MLGVPILGHIPEMPAS--------------------------------------------
A0A1U9NL64      LLGLPVLGVIPLMSKRKSM-----------------------------------------
A0A5B9QNZ7      ATGAPMLGAIGAMKFRR-------------------------------------------
A0A1U7CZ81      RVQSEVFSLPPLPMVRAS------------------------------------------
A0A142YNY8      RVQSEVYSLPPIPMSRSP------------------------------------------
A0A1U7GLS6      RVQSEVYSLPPIPMARSP------------------------------------------
A0A1Z8N7H5      RVGQPLIGLVRALPELS-------------------------------------------
A0A1G2YPI3      VLSMPVLGVVPSMSR---------------------------------------------
A0A532UIN2      VLNLPILGVVPSMPRRLSI-----------------------------------------
A0A532UD06      VLHIPVLGVIPEISEGQRSTITRGREIWLKLKSIFADISRTAYSRTVPGEPKGKAKPGAQ
A0A660URN1      VLGLPVLGVVPTILPEQNIAIHSGKALL-------------------------KFKSGAS
A0A0S8KNX5      RIGIRIIGTTTSLHTVK-------------------------------------------
A0A3D3UVZ8      RIGIRIIGTTTSLNTVK-------------------------------------------
E8R3W3          SMGMNVIGAIPTLPRQTN------------------------------------------
A0A517NFU9      TVGAPAIAHVPRFNLRKL------------------------------------------
A0A5C5YWH4      TLGAPAIAHVPRFNTRDL------------------------------------------
A0A3D2TNK4      QLGVPVLAMVKKLDALNG------------------------------------------
A0A0J1B4A0      IVGASILAHVPRLKESAL------------------------------------------
A0A142WSB9      LTGAHVLGIVPHFQKRNQ------------------------------------------
M5SZR3          HLMLPVIGRIALARVSAK------------------------------------------
M5TW92          HLMLPVIGRIALARLSAK------------------------------------------
A0A2S8FKY2      ELGLELLGTIPRLPRGIV------------------------------------------
A0A517N8P6      LLGLPILAHLPVILTPSK------------------------------------------
A0A432MJP4      MLGSRILGVIPRLSKAE-------------------------------------------
M5UQ35          VVGAPILAHLPLLKTSKL------------------------------------------
A0A5C5WTY6      ALGLQAFGVIDDLSGIEL------------------------------------------
A0A5C5Y033      AIGLLNLGHVGQMSAI--------------------------------------------
A0A5C6G1Y2      AIGLLNLGHVGQMSAI--------------------------------------------
A0A354PDV6      FIGLRTLGRIGKVNSM--------------------------------------------
A0A5C6FZ02      TVSLPSLGRVGKLNSM--------------------------------------------
M5TIT3          AIGLPRLGSVGKLNSI--------------------------------------------
A0A5M6CY44      MIGLPNLGRVGKMMSI--------------------------------------------
F2AXG2          AIGLPSLGRVGKLNSI--------------------------------------------
M2BB46          AIGLPSLGRVGKLNSI--------------------------------------------
L7CLQ6          AIGLPSLGRVGKLNSI--------------------------------------------
A0A0J1B719      AIGLPSLGRVGKLNSI--------------------------------------------
Q7UF18          AIGLPSLGRVGKLNSI--------------------------------------------
A0A2G1W1E0      AIGLPSLGRVGKLNSI--------------------------------------------
K5E235          AIGLPSLGRVGKLNSI--------------------------------------------
A0A5C6FFI9      TLQASAIAHVPLFNLRKL------------------------------------------
A0A3A0DET7      VVQLPVFGVVPQSSASAD------------------------------------------
A0A5C5WDJ1      TTGAAVIAHVPRMALRDL------------------------------------------
A0A5C5X547      AIGLEHMGGIPRLPMKQL------------------------------------------
A0A2A2W9R6      VVGAPILAHMPMLRESRL------------------------------------------
A0A518HKC1      VVGAPILAHMPMLRESKL------------------------------------------
A0A518L3P0      VVGAPILAHMPMLPESKL------------------------------------------
A0A255R1S0      AAGASIIAHLPQMVESKL------------------------------------------
A0A5B9MKP1      VVGAPILAHMPMLRESKL------------------------------------------
A0A0S8FY64      RLNMPWLGYVPQMHSDGS------------------------------------------
A0A1N6KFT7      VLEFRLIGTIPKLLVD--------------------------------------------
L0DFG4          VLNFALIGTIPKLRSD--------------------------------------------
A0A5C5XXG1      TVSLPSLGRVGKLN----------------------------------------------
A0A518BJJ1      VTGLPVLTTVPDFKHGKH------------------------------------------
A0A518D182      ITGLPVLASVPDFKDGG-------------------------------------------
A0A353FIP5      VTGLTQWASIPDFRHGAN------------------------------------------
A0A5B1CIK7      AIGLPNLGMVGKL-----------------------------------------------
A0A5C5WHS2      AIGLPNLGMVAKL-----------------------------------------------
A0A5C6B6G8      AIGLPSLGRVGKL-----------------------------------------------
A0A5C5ZZN3      AIGLLSLGRVGKL-----------------------------------------------
A0A5C5XS91      AIGLTSLGRVGKL-----------------------------------------------
A0A5C6C4E6      AIGLTSLGRVGKL-----------------------------------------------
A0A2E1VVJ1      TTQLPVLGTIPDFRRGLA------------------------------------------
A0A3M2AEL0      ATGLPQVGVIPDFRRGGT------------------------------------------
A0A532UT69      LLRMPVLGAVPAMLGERSG-----------------------------------------
A0A2D5AWU0      VLNVNVVGVMPRLKGPRSR-----------------------------------------
M5RT57          NTTQTTVSEVAKLP---VR-----------------------------------------
A0A356KTN1      ALGIPVLGVVP-HQ---RE-----------------------------------------
A0A518HFS8      RLGIGVVGALPTSP---RG-----------------------------------------
                                                                            

A0A5S9IPR9      -------------------------------------------------GKTTHVVEEKE
A0A533Q9U4      -------------------------------------------------DFTELIAHSSP
A0A1U9NNE1      -------------------------------------------------VCPTEVKRSEL
A0A2G2JCA2      -------------------------------------------------MSPGNSTVSTS
A0A533Q6B7      -------------------------------------------------RTMQLITYNLP
A0A351FYP6      ---------------------------------------------------VGSLMDEGD
A0A2E7ESJ6      -------------------------------------------------IEPIMCTVHKP
A0A1G2YQB7      -------------------------------------------------SKEKIKESMWP
A0A353P687      -------------------------------------------------SRDKIKKAMWP
A0A356EME5      -------------------------------------------------GKTTSRRMAQK
A0A355AI52      -------------------------------------------------GLETVHMWNIS
A0A3L7SI46      -------------------------------------------------GLDAIVTYAKP
A0A3L7P4E4      -------------------------------------------------IDPAIVTIHRP
A0A3L7PEB5      -------------------------------------------------IDPAIVTIHRP
A0A2N1UCJ3      -------------------------------------------------GNKGQKVHLEP
A0A517ZCB5      -------------------------------------------------GLSSLYPFSKP
A0A432MFP3      -------------------------------------------------ARLEGPGYDPK
D5SZ21          -------------------------------------------------GLDSVHAFVAP
A0A518CHE5      -------------------------------------------------AIDAVQTHVNP
A0A257WS34      -------------------------------------------------GIQQVLTFVKP
A0A2E8FLY0      -------------------------------------------------GLASVPTFSEP
A0A3D2U1E1      -------------------------------------------------GLDAVQTFAEP
A0A1P8WP26      -------------------------------------------------GFNSVLCHVKP
A0A3L7V1F3      -------------------------------------------------GFAAVMCHSKP
A0A5B9QF68      -------------------------------------------------GMETVHTHTLP
A0A5B9QGF0      -------------------------------------------------GMDTVHTYKLP
A0A5C6CK24      -------------------------------------------------GMETVHTHKLP
A0A2E8B0L9      -------------------------------------------------GAESLQVHVAA
A0A5Q4GFE7      -------------------------------------------------GLQAIQVHVSP
A0A2E3GWX1      -------------------------------------------------GLESIYTHTKP
F0SG60          -------------------------------------------------GLESIYTHTKP
A0A2E9VST2      -------------------------------------------------GLESIFTYTKP
A0A356A6X2      -------------------------------------------------GLESIFTYTKP
A0A5C5XLM3      -------------------------------------------------GLESIFTYTKP
A0A3M1VCL4      -------------------------------------------------GVASVLTFAKP
A0A5C5V7Z9      -------------------------------------------------GLDAVHMHVDG
A0A5C5YT05      -------------------------------------------------GLDAVHMHVDA
A0A518D7F9      -------------------------------------------------RLEAVHMFRDG
A0A5C5ZIP0      -------------------------------------------------GIQSVQMFAKP
A0A518KBK3      -------------------------------------------------GLEKVQMFSQP
A0A5C6AKF9      -------------------------------------------------GLEKVQMFAQP
A0A2E0X4J3      -------------------------------------------------AEAGMMLVNAP
A0A5C5YU10      -------------------------------------------------EELGKLVHLQP
A0A517MPZ6      -------------------------------------------------HETGRVVLTHP
A0A5C6CNV7      -------------------------------------------------SAIGTVLLTHP
A0A518K5H4      -------------------------------------------------SVGGRLVALQP
A0A5C6AA28      -------------------------------------------------NIGGRIVALQP
A0A2E9VK20      -------------------------------------------------LAPMLYYYHDP
A0A3D4PJK1      -------------------------------------------------LAPMLYYYHDP
A0A0S8GZ23      ------------------------------------------------------------
L0DC26          ---------------------------------------------------SGDAEHRRW
A0A354PCQ3      ---------------------------------------------------------YKG
A0A1I3DDV4      ---------------------------------------------------KKGRMIVDA
A0A2E2N5A9      ---------------------------------------------------LARMYSEGN
A0A2E3GWC6      -------------------------------------------------TSPMLYYYHDP
F0SLB0          -------------------------------------------------TSPMLYYYHDP
A0A2E0SMM6      -------------------------------------------------AIDAVQTHVNP
A0A1N6DAJ8      ---------------------------------------------------------FRS
A0A5B9PJZ8      ---------------------------------------------------PELIALHQP
A0A2S8G191      ---------------------------------------------------RSVLVNSSR
A0A2E7EGG1      ---------------------------------------------------HELDDDIDQ
A0A225EH48      ---------------------------------------------------PSKSSLRSG
A0A3L7NDH9      -------------------------------------------------GLESTHMHKSN
A0A518INW8      -------------------------------------------------ISPLCRTVFAP
A0A518JPH9      -------------------------------------------------LSPLCRTVFAP
A0A2E2CCW9      -------------------------------------------------FAPALWYYYRP
A0A3C0AGX3      -------------------------------------------------FAPALWYYYRP
A0A518AAQ5      -------------------------------------------------FDSALWYYYRP
A0A517QBG9      -------------------------------------------------FDSALWYYYRP
A0A518FTU3      -------------------------------------------------FDSALWYYYRP
A0A2E7K7A9      -------------------------------------------------FDSALWYYYRP
A0A517PTS5      -------------------------------------------------FDSALWYYYRP
A0A517WHH5      -------------------------------------------------FDSALWYYYRP
A0A5A8BGT3      -------------------------------------------------FDSALWYYYRP
A0A517VTK3      -------------------------------------------------FDRALWYYYRP
A0A517WQT4      -------------------------------------------------FDRALWYYYRP
A0A517VID8      -------------------------------------------------FAPALWYYYRP
A0A517RK10      -------------------------------------------------FDPALWYYYRP
A0A518IH18      -------------------------------------------------FDPALWYYYRP
A0A5C5VEK8      -------------------------------------------------EELGKLVHLQP
A0A532UTJ0      ---------------------------------------------------HTVKPALLP
A0A517NSK8      ---------------------------------------------------SSVYAFHRP
A0A5C5Z0D6      ---------------------------------------------------SSIRVYHQP
M5UE94          ---------------------------------------------------SSIRVHHQP
A0A1P8WN28      ---------------------------------------------------ARIYVNDFP
A0A3B9CTT0      ---------------------------------------------------CKIYLEKFA
A0A5C5XLF4      ---------------------------------------------------PMLYYYHDP
A0A2D5NDU9      -------------------------------------------------ETDAPTTTWDN
A0A286RGB6      --------------------------------------------------------YQRW
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      ---------------------------------------------------DPISL----
A0A2E0X9P6      -------------------------------------------------LRSLPAWHHRE
A0A286RLF2      ---------------------------------------------------EVLEVVADP
A0A5C5ZM48      ---------------------------------------------------RSEYRLEQA
A0A5B9WF77      ---------------------------------------------------RAIGASGPD
A0A518BBX8      -------------------------------------------------IDMTLCAHLRP
A0A518ALT3      -------------------------------------------------RHQLMAPNQHD
A0A517MDV3      ---------------------------------------------------PELVVYHRP
A0A3M1QRP3      ---------------------------------------------------DPRSATAEE
A0A517TMV0      ---------------------------------------------------QAVQMFAKP
A0A2E3RCU8      ---------------------------------------------------EKVSAYNDP
A0A3E0MY88      ---------------------------------------------------EAVHTHVDP
A0A1C3E6N1      ---------------------------------------------------DSVHAFVAP
A0A518GJT2      ---------------------------------------------------DSVHAFVAP
A0A286RD13      ---------------------------------------------------RPIMRWMSR
A0A517MLW3      ---------------------------------------------------EAIQMHVAP
A0A5B9QVD0      ---------------------------------------------------QAIQMHVDP
A0A3B8PNV4      ---------------------------------------------------SSVRMLSEP
A0A3D1DR40      ---------------------------------------------------SSVRMLSEP
A0A2E7RYU8      ---------------------------------------------------SSVRMLSEP
A0A3B8LXG8      ---------------------------------------------------SSVRMLSEP
A0A350CI62      ---------------------------------------------------EAVMCHVRP
A0A4P5WQK6      ---------------------------------------------------EAVMCHVRP
A0A3C1X4W5      ---------------------------------------------------DAVMCHVRP
A0A3D3W3A7      ---------------------------------------------------DAVMCHVRP
A0A518DRX3      ---------------------------------------------------QAVQVHVNP
A0A518DZF9      ---------------------------------------------------QAVQVHVNP
F0SI78          -------------------------------------------------IDPTLVNYHRP
A0A518IQ30      ---------------------------------------------------QNLHMFTNP
A0A517LWP4      ---------------------------------------------------QNLHMFTNP
A0A518JNW8      ---------------------------------------------------QNLHMFTNP
A0A2E7ENQ5      ---------------------------------------------------DSLQVHVAP
A0A1G3AQE9      ---------------------------------------------------DQLPTYASP
A0A3L7UQT9      ---------------------------------------------------DAVLCHAKP
A0A4P5YBU2      ---------------------------------------------------DAVLCHAKP
A0A518AKT8      ---------------------------------------------------QSLHTHMCP
A0A5C5ZR72      ---------------------------------------------------REMYVF---
A0A517TY85      ---------------------------------------------------KEMFVF---
A0A5B9QEI7      ---------------------------------------------------RQMFVY---
A0A5S9IJB5      -------------------------------------------------SQYPEVLALST
A0A1G2XVR0      -------------------------------------------------ANLELLTSEAP
A0A1G3B0P0      -------------------------------------------------ANLELLTSEAP
A0A1E3X4X0      -------------------------------------------------FVPELFVHRKS
A0A286U4B3      -------------------------------------------------ENFDTILHELP
A0A5C6DDS2      -------------------------------------------------QNFDLISHELP
A0A0S8J591      -------------------------------------------------ATRSLISHLDS
A0A2E3GW02      -----------------------------------QKRRKRNKSGDTVPIDPTLVNYHRP
A0A1U9NL64      -------------------------------------------------AERGRRVALNP
A0A5B9QNZ7      ------------------------------------------NKQLSRLISPELVVYHRP
A0A1U7CZ81      -------------------------------------------------NKLNGPAEDDQ
A0A142YNY8      -------------------------------------------------RRLGAPGDDDQ
A0A1U7GLS6      -------------------------------------------------RRLGAPGEDDQ
A0A1Z8N7H5      ------------------------------------------GEGL-----KKVSAFSDP
A0A1G2YPI3      ------------------------------------------RESV---TDRGRKTYLDS
A0A532UIN2      -------------------------------------------------ADRGQKVHKDS
A0A532UD06      PIMAQVRAYRALRATGTKAQPFAVGASSPNKDETTTEEQALEEQAL---VEFGQVVHFKP
A0A660URN1      RIWRTIQAGISSDAAGVETKTVSAVPRSED-----TAQGALDTKAI---AERGQRVHLAP
A0A0S8KNX5      --------------------------------------------------------PALL
A0A3D3UVZ8      --------------------------------------------------------PALL
E8R3W3          -----------------------------------SSRSISKPNDR----------QVVW
A0A517NFU9      -----------------------------------RKLLN--KDSG---VQPSLVCSYAP
A0A5C5YWH4      -----------------------------------KSKTR--SGSL---IQPSLVTFHAP
A0A3D2TNK4      -----------------------------------ENLETIHTHAC-------------P
A0A0J1B4A0      -----------------------------------KKKVKEGSG-----ISAMIPTFHLP
A0A142WSB9      -----------------------------------NSAMAHTG------ISPQVVYLHHP
M5SZR3          -----------------------------------PQLDPEEMDDS---LDRSLCTYFRP
M5TW92          -----------------------------------PQLDPEEMDDS---LDRSLCTYFRP
A0A2S8FKY2      -----------------------------------RKPKA----------------LSHN
A0A517N8P6      -----------------------------------RQLKKSSGNDLFPHTDQIVTVLHHP
A0A432MJP4      ------------------------------------------LAET---TEPGLVVHQRP
M5UQ35          -----------------------------------KRHVR--PGSV---VSPMIVAFHAP
A0A5C5WTY6      -----------------------------------STSPK----------------ATGN
A0A5C5Y033      ------------------------------------------DQGI---AGL----VATD
A0A5C6G1Y2      ------------------------------------------DQGI---AGL----VATD
A0A354PDV6      ------------------------------------------RQGV---KGL----IATE
A0A5C6FZ02      ------------------------------------------RRGV---RGL----IAGE
M5TIT3          ------------------------------------------NQGV---AGL----IATE
A0A5M6CY44      ------------------------------------------NQGV---NGL----ISAE
F2AXG2          ------------------------------------------NQGI---KGL----IATE
M2BB46          ------------------------------------------NQGI---KGL----IATE
L7CLQ6          ------------------------------------------NQGI---KGL----IATE
A0A0J1B719      ------------------------------------------NQGI---KGL----IATE
Q7UF18          ------------------------------------------NQGI---KGL----IATE
A0A2G1W1E0      ------------------------------------------NQGI---KGL----IATE
K5E235          ------------------------------------------NQGI---KGL----IATE
A0A5C6FFI9      -----------------------------------PIPSP--DQTP---LAPSLVTAHCP
A0A3A0DET7      -----------------------------------RALAGQLV-------------LQAP
A0A5C5WDJ1      -----------------------------------RKAAN--VKSM---LDPSLMTFHSP
A0A5C5X547      -----------------------------------SGKNGKDDKKD---SKL--------
A0A2A2W9R6      -----------------------------------QKQAI--KDSE---ISPMVAAFHVP
A0A518HKC1      -----------------------------------QKQAI--KDSA---ISPMIAAFHVP
A0A518L3P0      -----------------------------------QKQAI--KDSD---ISPMVAAFHIP
A0A255R1S0      -----------------------------------AKQAK--VGSK---ISPMITTFHQP
A0A5B9MKP1      -----------------------------------QKRVI--KGSA---ISPMVASFHLP
A0A0S8FY64      ------------------------------------------REGL---VSLAQHAIQHA
A0A1N6KFT7      -----------------------------------QLTLM--GEVG---LVS----HAMP
L0DFG4          -----------------------------------QISLM--GEIG---LVS----HAMP
A0A5C5XXG1      --------------------------------------------------SM----RRGV
A0A518BJJ1      -----------------------------------RVAKA--TTDF---IAL----RDDP
A0A518D182      -----------------------------------RVATR--TKDF---VAM----RDDP
A0A353FIP5      -----------------------------------KIEAAKGKEHF---LAL----LDAP
A0A5B1CIK7      --------------------------------------NSI-RDGI---SGL----IAVE
A0A5C5WHS2      --------------------------------------NSI-REGI---SGL----IAAE
A0A5C6B6G8      --------------------------------------NSI-DMGI---RGL----VSAE
A0A5C5ZZN3      --------------------------------------NSV-KQGV---TGL----IATE
A0A5C5XS91      --------------------------------------ESI-KKGV---SGL----IATG
A0A5C6C4E6      --------------------------------------NSM-KKGV---AGL----IATG
A0A2E1VVJ1      -----------------------------------RSQRAR-GKVF---LAL----LHDP
A0A3M2AEL0      -----------------------------------RSKHSR-ARDY---LPL----RDEP
A0A532UT69      -------------------------------------------------RARGQKVHLDP
A0A2D5AWU0      -------------------------------------------------ARTGRIVEEQP
M5RT57          -------------------------------------------------TISIGSRQTKA
A0A356KTN1      -------------------------------------------------DEVELLALRES
A0A518HFS8      -------------------------------------------------DRGGATAVR--
                                                                            

A0A5S9IPR9      NTNVAEAFRA--------ISTSI--FFAEE-----------QTKNKTFVITSALAQDGKT
A0A533Q9U4      KHSITEALKG--------IRTSI--IFSHP-----------DKPKKVILVTSSAPSEGKS
A0A1U9NNE1      SERLADDYRT--------IRANI--SMLEE-----------ENQHI-LAVTSSQPKDGKT
A0A2G2JCA2      LRMYEESIDS--------LRTNI--MLPNN---S-------DDIKV-IVVSSACSREGKT
A0A533Q6B7      KYPITESIKR--------IRTSI--MFSHP-----------DNPKKTLLISSAIPSEGKT
A0A351FYP6      ESPHAEAYRV--------LRTNI--LFAGR---K-------SEDQTTFTVVSGGAGEGKT
A0A2E7ESJ6      KSPQAESYRA--------VRTAL--YFNSR---G-------ERHQV-IQVTSPMPGDGKS
A0A1G2YQB7      RQL-ADDYHA--------ICINL--GLMNN---C-------TIPNK-LAITSAGPQEGKS
A0A353P687      RQL-ADDYHS--------ICINL--GLMNN---C-------TIPNK-LVISSASPREGKS
A0A356EME5      LRLYEESIDS--------MRTFL--VLAEE---I-------KGARV-LAVTSAASNEGKT
A0A355AI52      DDAAAESFRT--------IRTVL--VMGT------------EDSER-IAVTSAEPGDGKT
A0A3L7SI46      DSLEAESFRT--------LRSSI--TFST------------SNTQR-LVMTSTEPGDGKT
A0A3L7P4E4      RSQSAEAFRG--------VRTYL--MAATR---G-------EGHRI-VLLTSPEPGDGKS
A0A3L7PEB5      RSQSAEAFRG--------VRTYL--LAATR---G-------AGHSI-VLLTSPEPGDGKS
A0A2N1UCJ3      KSSIAEAYRS--------IRTSV--FFGVP---K-------GQART-ILITSPAPSDGKT
A0A517ZCB5      NAVESEAFRS--------LRTTL--EFSN------------EDTKC-MTISSTEPGDGKT
A0A432MFP3      FEQFVQQLDH--------LRVAL--CGEGG---Q-------DGRGRCVLITSAVGGEGKT
D5SZ21          HESSTEAFRT--------LRTAI--QFAG------------DDIRR-LVITSTEPGDGKT
A0A518CHE5      NSVESEAFRT--------LRTAI--SFSS------------HESRR-LLVTSTEKSDGKT
A0A257WS34      SAAEAECFRT--------LRSAI--SFCA------------GDTHR-LCVTSTEPGDGKT
A0A2E8FLY0      NGVETEAFRT--------LRTAL--AFSS------------NPTTR-LAVTSTEPGDGKT
A0A3D2U1E1      NGSENEAFRT--------LRTTL--AFSS------------EPTAR-LVVTSTEPGDGKT
A0A1P8WP26      NSTEAESFRG--------LRTNL--EFAG------------GDTGR-IVCTSTEPGDGKT
A0A3L7V1F3      HSKEVEAFRA--------LRTSI--EFSP------------QETNR-LVCTSTEPGDGKT
A0A5B9QF68      HAVETEAFRT--------LRTAI--SLSG------------VACGR-LLISSSEPGDGKT
A0A5B9QGF0      HAVETEAFRT--------LRTAI--SLSG------------TSCER-LLISSSEPGDGKT
A0A5C6CK24      HSVETEAFRT--------LRTAI--SLSG------------SSCDR-LLISSSEPGDGKT
A0A2E8B0L9      GAVESEAFRT--------LRTTL--AFSG------------QDLQR-IAITSSEPSDGKT
A0A5Q4GFE7      ESVESEAFRT--------LRTTL--AFSG------------SDLER-IAITSTEPSDGKT
A0A2E3GWX1      NSVETEAFRT--------LRTAI--EFAS------------ETHQR-ISISSTEPSDGKT
F0SG60          NSVETEAFRT--------LRTAI--EFAS------------ETHQR-ISISSTEPSDGKT
A0A2E9VST2      NSVETEAFRT--------LRTSI--EFAC------------ENHQR-ISITSTQPSDGKT
A0A356A6X2      NSVETEAFRT--------LRTSI--EFAC------------ENHQR-ISITSTQPSDGKT
A0A5C5XLM3      NSVETEAFRT--------LRTSI--EFAC------------ENHQR-ISITSTQPSDGKT
A0A3M1VCL4      NGVETEAFRT--------LRLKL--MFSE------------TPAQR-LVVSSTEPGDGKT
A0A5C5V7Z9      NSVEAEAFRT--------LRTSL--TLRG------------DETER-LVISSAEPSDGKT
A0A5C5YT05      NSVEAEAFRT--------LRTSL--TLRG------------EETER-LVISSAEPSDGKT
A0A518D7F9      NSPDAEAFRT--------LRTAL--TLTG------------DVADR-IVVSSAEPSDGKT
A0A5C5ZIP0      QAVDSEAFRT--------LRTAI--ALGA------------DAPDR-LVISSAEPSDGKT
A0A518KBK3      QATESESFRT--------LRTAI--TLGA------------EVSER-LVITSSEPGDGKT
A0A5C6AKF9      QGAESEAFRT--------LRTAI--TLGA------------AVSDR-LVISSSEPGDGKT
A0A2E0X4J3      RAAFSEAVRT--------LRTSF--HFGLG---G-------PDVRA-VCVTSPTAGDGKS
A0A5C5YU10      RSTSAEAFRT--------LRTAV--HFGLA---G-------DDCKV-LVVTSPSPGDGKS
A0A517MPZ6      RSMAAESFRT--------LRTAI--HFGLT---R-------DDAKV-IAITSPSPGDGKS
A0A5C6CNV7      RSTAAEAFRT--------LRTAI--HFGLA---R-------DDAKI-ICVTSPSPGDGKS
A0A518K5H4      RSTAAEAIRT--------LRTAL--YFGIG-----------GESKT-FVVTSPAPGDGKS
A0A5C6AA28      RSVAAEAIRA--------LRTSL--HFGLA-----------GDART-YVVTSPAPGDGKS
A0A2E9VK20      GSPEAEACRS--------VRATF--FVRAA---D-------VDAHI-IQFTSSEPGDGKT
A0A3D4PJK1      GSPEAEACRS--------VRATF--FVRAA---D-------VDAHI-IQFTSSEPGDGKT
A0A0S8GZ23      LEQVAEDYQT--------IRANL--GLLSN---G-------KIPHK-MVVTSSGVREGKS
L0DC26          GSMLIESVDA--------ARTAL--LHVSR---T-------ESVRV-VMVASALGGEGKT
A0A354PCQ3      RRIFEESIDS--------LRANL--FLSTR---W-------KDTRS-IAVVSSISGEGKS
A0A1I3DDV4      QAPEAESFRL--------LRTYL--LREVK---A-------GNLRT-AMITSSQAKDGKS
A0A2E2N5A9      NPLFTETIRT--------IRTKL--EMANT---D-------HYSQV-IVTTSALPGEGKS
A0A2E3GWC6      ASPEAESCRS--------VRATF--FVRAS---D-------AGARI-IQFSSPEPGDGKT
F0SLB0          ASPEAESCRS--------VRATF--FVRAS---D-------AGARV-IQFSSPEPGDGKT
A0A2E0SMM6      NSVESEAFRT--------LRTAI--SFNTH------------ESRR-LLVTSTEKSDGKT
A0A1N6DAJ8      GEAENVRWKSMLVESVDAARTTL--LHVSR---T-------ESVRV-VMVASALSGEGKT
A0A5B9PJZ8      SNQNCEAYRS--------IRTSI--FFRAQ---E-------TGAKI-IQMTSPTPGDGKS
A0A2S8G191      NSKKQEYWKNLIAESVGGIVARL--FRPSA---T-------RQYRV-VMISSALAGEGKT
A0A2E7EGG1      LGLFEESIDS--------LRTGL--VLSQK---N-------ESIQV-VVVSSSVAGEGKS
A0A225EH48      DAGQAQNWRFVLNESVNSARTML--LHTAK---T-------QNMQV-LMVTSAMQGEGKT
A0A3L7NDH9      DDAASEGFRT--------LRTVL--AMNGS------------QSQR-IAISSSEPGDGKT
A0A518INW8      HSVESEVLTM--------ARTSL--FVHAG---Q-------TNDNV-IQVTSPMPGDGKS
A0A518JPH9      HSVESEVLTM--------ARTSL--FVHTG---Q-------TDENV-IQVTSPMPGDGKS
A0A2E2CCW9      ASREAEAFRS--------LRTSL--LLKTD---R-------SGAKV-LQMTSAEPGDGKT
A0A3C0AGX3      ASREAEAFRS--------LRTSL--LLKTD---R-------SGAKV-LQMTSAEPGDGKT
A0A518AAQ5      ASREAEAYRS--------LRTSL--LLKTD---R-------SGAKV-LQVTSAEPGDGKT
A0A517QBG9      ASREAEAYRS--------LRTSL--LLKTD---R-------SGAKV-LQVTSAEPGDGKT
A0A518FTU3      ASREAEAYRS--------LRTSL--LLKTD---R-------SGAKV-LQVTSAEPGDGKT
A0A2E7K7A9      ASREAEAYRS--------LRTSL--LLKTE---R-------NGAKV-LQVTSAEPGDGKT
A0A517PTS5      ASREAEAYRS--------LRTSL--LLKTE---R-------NGAKV-LQVTSAEPGDGKT
A0A517WHH5      ASREAEAYRS--------LRTSL--LLKTD---R-------TGARV-LQVTSAEPGDGKT
A0A5A8BGT3      ASREAEAYRS--------LRTSL--LLKTD---R-------TGARV-LQITSAEPGDGKT
A0A517VTK3      SSKEAESFRS--------LRTSL--LLKTD---Q-------SGAKV-LQMTSAQPGDGKT
A0A517WQT4      SSKEAESFRS--------LRTSL--LLKTD---Q-------SGAKV-LQMTSAQPGDGKT
A0A517VID8      ASREAEAFRS--------LRTSL--LLKTD---R-------SGAKV-LQMTSAEPGDGKT
A0A517RK10      ASREAEAFRS--------LRTSL--LLKTD---R-------SGAKV-LQMTSAEPGDGKT
A0A518IH18      ASREAEAFRS--------LRTSL--LLKTD---R-------SGAKV-LQMTSAEPGDGKT
A0A5C5VEK8      RSTSAEAFRT--------LRTAV--HFGLA---G-------DDCKV-LVVTSPSPGDGKS
A0A532UTJ0      EQIVGD-YQT--------IRANL--GLVGD---K-------GIPRK-LVITSPGMKEGKT
A0A517NSK8      RSPEAEIYRV--------IRTSM--LMSAK---A-------KDQRI-IQVTGPLPGDGKS
A0A5C5Z0D6      RSPSAEVFRV--------MRTGL--LVEAK---A-------KGLHV-FQVTSPLPGDGKS
M5UE94          RTPAAEVFRV--------LRTGL--LVAAR---K-------NGHQV-IQVTSPLPGDGKS
A0A1P8WN28      QTTHAECFRT--------LKTSI--TLSPM------------DTKC-IAITSTEASEGKT
A0A3B9CTT0      QTVQAEAFRT--------LKTAV--TLTAQ------------QSKC-LAVTSTDAGEGKT
A0A5C5XLF4      GSPEAEACRS--------VRATF--FVRAA---D-------VDAHI-IQFTSSEPGDGKT
A0A2D5NDU9      EHEFAEAART--------LRTAI--YFGLA---Q-------IEGTS-IQITSAEPGPGKS
A0A286RGB6      RALFSESVRK--------VAARI--IRESE---H-------ERLQV-IMVTSAVPGEGKT
A0A1V5N3W2      RQQLVSDYQT--------IRSNL--RLLSD---G-------EIPKI-LVVTSPASGDGKT
A0A3E0MY27      QGMMDESVDS--------IRSLL--LHSAS---C-------ESVQV-VMVTSANSGEGKT
A0A2E0X9P6      MIVFAESIDS--------LRTQL--MLTQGLGVG--------GVRV-LAVASAGSGEGKT
A0A286RLF2      NSPASESFRT--------LRTAL--ALSDR------------PTGA-VVVTSTQPGDGKS
A0A5C5ZM48      LRVFEESTNV--------LATTI--RWADG---F-------KGIRV-VSVMSAMKNEGKT
A0A5B9WF77      DQIDRFIQRL--------DHLRF--AVCGEPHDA-------EMGRC-VLVTSAIGGEGKT
A0A518BBX8      RSVHAEAYRG--------LRTAL--YFSMN---A-------HNQNV-VQVTSPNAGDGKS
A0A518ALT3      LLVYTESIDS--------LRTTL--ALTEGVGVR-------DCHKT-VAVCSGVSGEGKT
A0A517MDV3      DSSDAEAYRH--------LRTSL--LFRPG---G-------KELRV-IQMTSPNPGDGKT
A0A3M1QRP3      FTVQSECVRM--------VRTAL--LQRLP---H-------DRCNV-IQITSASPGAGKT
A0A517TMV0      QATESEAFRT--------LRTAI--TLGAE------------VSDR-LVISSSEPSDGKT
A0A2E3RCU8      ASVFVESFRT--------LRTSL--ALSAA------------ESTR-LALTSSEPGDGKT
A0A3E0MY88      NSPECEAFRT--------LRTAL--SFNPE------------ETQR-LVVSSAEPGDGKT
A0A1C3E6N1      HESSTEAFRT--------LRTAI--QFAGD------------DIRR-LVITSTEPGDGKT
A0A518GJT2      HESSTEAFRT--------LRTAI--QFAGD------------DIRR-LVITSTEPGDGKT
A0A286RD13      NGHMPETMRSVLIESVDQLRTIL--LHRAE---R-------QGLKV-VLVTSALAREGKT
A0A517MLW3      STRSSEAFRT--------LRAGL--MLNPA------------KPRL-IAVSSSEPGDGKT
A0A5B9QVD0      SARVSEAFRT--------LRAGL--MLNPD------------QPRL-IAVSSSEPSDGKT
A0A3B8PNV4      NSTDTEAFRT--------LRTAL--SFAGR------------PTQQ-LVITSTEPGDGKT
A0A3D1DR40      NSTDTEAFRT--------LRTAL--SFAGR------------PTQQ-LVITSTEPGDGKT
A0A2E7RYU8      NSTDTEAFRT--------LRTAL--SFAGR------------PTQQ-LVVTSTEPGDGKT
A0A3B8LXG8      NSTDTEAFRT--------LRTAL--SFAGR------------PTQQ-LVVTSTEPGDGKT
A0A350CI62      HSREVEPFRA--------LRTSI--EFSPQ------------DTNR-LVVTSTEPGDGKT
A0A4P5WQK6      HSREVEPFRA--------LRTSI--EFSPQ------------DTNR-LVITSTEPGDGKT
A0A3C1X4W5      HSREVEAFRA--------LRTSI--EFSTQ------------DTNR-LVITSTEPGDGKT
A0A3D3W3A7      HSREVEAFRA--------LRTSI--EFSTQ------------DTNR-LVITSTEPGDGKT
A0A518DRX3      TAVESEAFRT--------LRTVL--SFGDL------------EGNR-LIVTSTEPSDGKT
A0A518DZF9      TAVESEAFRT--------LRTVL--SFGDL------------EGNR-LIVTSTEPSDGKT
F0SI78          NSRIAEAYRL--------IRGTL--LLTMG---G-------ERARV-IQFTSPDPGDGKS
A0A518IQ30      KSAESEAFRT--------LRTSL--SLQGS------------DFSK-LAITSSEPGDGKT
A0A517LWP4      KSAESEAFRT--------LRTSL--SLQGS------------DFSK-LAVTSSEPGDGKT
A0A518JNW8      KSAESEAFRT--------LRTSL--SLQGS------------DFSK-LAVTSSEPGDGKT
A0A2E7ENQ5      NDVASESFRT--------LRSTL--AFSEQ------------GSEC-VAISSSEPGDGKT
A0A1G3AQE9      NAAEVEAFRT--------LRTAL--SLANQ------------ETHQ-LVVSSAEPGDGKT
A0A3L7UQT9      NGVETEAFRT--------LRTAI--SFSDR------------QAQR-IVVTSTEPGDGKT
A0A4P5YBU2      NGVETEAFRT--------LRTAI--SFSDR------------QAQR-IVVTSTEPGDGKT
A0A518AKT8      NASDSEAFRT--------LRTSL--SLMTD------------ASER-ILVSSAEPSDGKT
A0A5C5ZR72      ----AESINA--------LRTSL--VFAAE---P-------DQPLV-IALTSAVSGEGKT
A0A517TY85      ----AESIDS--------LRTQL--LLTEHLGVP-------GERKV-VAICSAASGEGKS
A0A5B9QEI7      ----TESIDS--------LRTQL--MLTEQVGQP-------GVDKI-IAICSAASGEGKS
A0A5S9IJB5      RSPVAESFRS--------LRTTL--SFSI------------EKNST-FFVTSPVPGDGKS
A0A1G2XVR0      KSVFSETIRN--------IRTGI--MLSTT---D-------TPHKS-LLITSTKQGEGKS
A0A1G3B0P0      KSVFSETIRN--------IRTGI--MLSTT---D-------TPHKS-LLITSTKQGEGKS
A0A1E3X4X0      KSNIAEAIRN--------IRTNI--IFTAT---D-------TPRKL-IMIASANPDEGKT
A0A286U4B3      KSTFAEAVRN--------VRTGI--MLSSA---D-------NPKRI-MLVTSTTPSEGKT
A0A5C6DDS2      MSTFAEAVRN--------VRTGI--MLSST---D-------NPKKI-ILVTSTTPGEGKT
A0A0S8J591      RSGPAEAFRG--------IRTEV--MLRSD---L-------RQVKT-GMVTSTSPQEGKT
A0A2E3GW02      NSRIAEAYRL--------IRGTL--LLTMG---G-------ERARV-IQFTSPDPGDGKS
A0A1U9NL64      SSPVSEAYRT--------VRTAV--FFGVP---K-------ESCKT-ILVTSPQPAEGKS
A0A5B9QNZ7      ESPQAEAYRH--------LRTAL--MFSPG---G-------KDLRL-LQMTSPNPGDGKT
A0A1U7CZ81      IDRFIQRLDH--------LRFAV--CGDHP---EV------GLGRC-VLITSAIGGEGKT
A0A142YNY8      IERFIQRLDH--------LRFAV--CGDHP---EV------GLGRC-VLISSAVGGEGKT
A0A1U7GLS6      IDRFIQRLDH--------LRFAV--CGDHP---DV------GLGRC-VLISSAVGGEGKT
A0A1Z8N7H5      VSVFVESFRT--------LRTSL--TLSG------------VDSTR-IAFTSSEPGDGKT
A0A1G2YPI3      KSNWAEAYRT--------IRTAV--FFGAP---K-------DEAKT-ILVTSPMPADGKT
A0A532UIN2      DSPVAEAYRT--------IRTAV--FFGAP---K-------NQAKT-ILVTSPAPADGKT
A0A532UD06      RSIAAEAYRT--------LRTSI--FFGVP---K-------GGAKT-ILVTSPAPGDGKT
A0A660URN1      KSHVAEAYRT--------IRTAV--FFGVP---K-------GQAKT-IVITSPAPGDGKS
A0A0S8KNX5      PERIIGDYQT--------IRANL--GLLGG---E-------GIPKK-LVITSPGMKEGKT
A0A3D3UVZ8      PEQIVGDYQT--------IRANL--KLLGG---R-------GIPKK-LVVTSPGMKEGKT
E8R3W3          EGMLRESINE--------IRSHV--LHANM---P-------TPPRV-LLVTSSMPREGKT
A0A517NFU9      RSTESEVYRV--------ARTAL--MVTNR---K-------DDVRT-IMMTSPQPGDGKS
A0A5C5YWH4      RSAESEVYRV--------ARTSL--MVANR---K-------TNVRT-MMMTSPQPGDGKS
A0A3D2TNK4      NAPETEAFRT--------LRTVL--SLSE------------QNCER-ILISSSEPGDGKT
A0A0J1B4A0      RGTEAETFRV--------LRTSL--LFLTK---S-------QSKKV-FLLTSPSPSDGKS
A0A142WSB9      GSRESEAYRS--------LRTTL--FFSTR---E-------TGEKV-IQVCSAEPGDGKS
M5SZR3          ISVESESYRA--------LRTTL--FFHNR---S-------REQSV-IQVTSACPGDGKS
M5TW92          ISVESESYRA--------LRTTL--FFHNR---S-------REQSV-IQVTSACPGDGKS
A0A2S8FKY2      LGPYEDQVRD--------SSDSV--AATVL---RRSLS---EQCQV-LLISSAMPREGKS
A0A517N8P6      HAPCSEAVRS--------VRTSL--FPVAG---AP------PEYQV-LQITSALPGDGKS
A0A432MJP4      GSLTAEAYRA--------LRTGL--EFVRR---E-------RDVRV-IVVCSPSPGDGKS
M5UQ35          RSSEAETFRV--------LRTGI--IFRCK---S-------EGKRA-FMITSPSPADGKS
A0A5C5WTY6      AKGSRETFRL--------TRTIL--AQSIQ---S-------RGIHS-MGITSPTPGDGKS
A0A5C5Y033      GSSESEAFRL--------GRTIL--LPDIK---S-------KKVRS-IGFTSSMQGDGKS
A0A5C6G1Y2      GSSESEAFRL--------GRTIL--LPDIK---S-------KKVRS-IGFTSSMQGDGKS
A0A354PDV6      LTPDAEAIRM--------MRTLL--LMDVK---S-------KKLQT-IAMTSPMQGDGKS
A0A5C6FZ02      LSPNAEALRL--------GRTML--LPKIK---S-------RDMKS-IGVTSSMQGDGKS
M5TIT3          LSPNAEAFRL--------GRTVL--LPEIR---S-------GKLRT-IGFTSSMQGDGKS
A0A5M6CY44      LSPDAEAFRL--------GRTMM--LMDIK---A-------GKLKT-IGFTSPLQGDGKS
F2AXG2          LSPDAEAFRL--------GRTVL--LPDIR---S-------GKVRA-IGFTSPMQGDGKS
M2BB46          LSPDAEAFRL--------GRTVL--LPDVR---N-------GNVRA-IGFTSPMQGDGKS
L7CLQ6          LSPDAEAFRL--------GRTVL--LPDIR---K-------ENVRA-IGFTSPMQGDGKS
A0A0J1B719      LSPDAEAFRL--------GRTVL--LPDIR---S-------GSVRT-IGFTSPMQGDGKS
Q7UF18          LSPDAEAFRL--------GRTVL--LPDVR---N-------GNVRA-IGFTSPMQGDGKS
A0A2G1W1E0      LSPDAEAFRL--------GRTML--LPDIR---N-------GNVRA-IGFTSPMQGDGKS
K5E235          LSPDAEAFRL--------GRTML--LPDIR---N-------GNVRA-IGFTSPMQGDGKS
A0A5C6FFI9      RSAEAEVYRV--------ARTSL--MIRAD---G-------SDTKV-LMMSSPHPGDGKS
A0A3A0DET7      RSSVAEAIRT--------LRTAL--HFGMA---G-------EDVKV-LAITSPMPGDGKT
A0A5C5WDJ1      RSPEAEIFRV--------GRTSM--MIANR---K-------GSVQT-IMVTSPQPGDGKS
A0A5C5X547      QRALSESVRG--------IVAQL--IRRKA---S-------ENQNC-IMVSSATAGEGKT
A0A2A2W9R6      RATDAETFRF--------VRTSL--LFLAK---K-------QSKQV-FLVTSPSPSDGKS
A0A518HKC1      RATDSETFRV--------VRTSV--LFLAK---K-------QSKQV-FLLTSPSPSDGKS
A0A518L3P0      RATDAETFRV--------IRTSI--LFLAK---K-------QSKQV-FLITSPSPSDGKS
A0A255R1S0      RGIDAETFRV--------LRTTL--LFMAK---R-------QSKKI-FMITSPSPADGKS
A0A5B9MKP1      RAVDSETFRV--------VRTSV--LFLAK---K-------QSKQV-FLLTSPSPADGKS
A0A0S8FY64      TDSSTEAFRS--------IRTNI--YFSGQ---R-------GEMKT-LMVTSAAPQDGKT
A0A1N6KFT7      RSVWAEAYRS--------VRTSL--EFLRR---S-------RQVQL-ILVTSAHSGDGKT
L0DFG4          RSVWAEAYRS--------VRTSL--EFLRR---S-------RQVQV-ILVTSSHSGDGKT
A0A5C5XXG1      RGLIAGELSP--------NAEAL--RLGRT---MLLPKIKSRDMRS-IGVTSSMQGDGKS
A0A518BJJ1      HGVVAEAYRS--------LRANL--RFAVG---DV------NALRT-MAATSCAPGEGKS
A0A518D182      SGPVAEAYRS--------LRASL--RFAVG---DL------GQMRT-LAVTSSAPGEGKS
A0A353FIP5      DSRVAEAYRG--------LRANL--TFAAK---R-------NEIKS-LAITSASQGEGKS
A0A5B1CIK7      NSPNAEAFRL--------GRTVL--LPEVR---S-------GKLRT-IGFTSPMQGDGKS
A0A5C5WHS2      NSPNAEAFRL--------GRTVL--LPEIR---S-------GELRV-LGFTSPMQGDGKS
A0A5C6B6G8      LSPDAEAFRL--------GRTVL--LPEIR---S-------GKLQT-IGFTSPMQGDGKS
A0A5C5ZZN3      LSPDAEAFRL--------GRTVL--LPDIR---S-------GKIRT-IGFTSPMQGDGKS
A0A5C5XS91      ESPDAEAFRL--------GRTML--LPEIR---S-------GALRT-IGFTSPMQGDGKS
A0A5C6C4E6      ESPDAEAFRL--------GRTML--LPEIR---S-------GALRT-IGFTSPMQGDGKS
A0A2E1VVJ1      ESAAAEAYRS--------LRASL--RFATG---G-------REIRT-MAITSAGQGEGKS
A0A3M2AEL0      DSPTAEAYRA--------LRANL--RFLAK---G-------QAIKT-LAITSSVQGEGKS
A0A532UT69      DSPAAEAYKT--------IRTAI--FLGVP---N-------GKAKT-ILVTSPESAEGKT
A0A2D5AWU0      GSSAAEAIRN--------LRTAT--TFALP---K-------DSHGV-VLVTSSVSGEGKS
M5RT57          MSIFEESIDS--------LRVGL--LLGEK---H-------NDIQT-LVVTSAVHGEGKS
A0A356KTN1      RSVYAEAFRR--------ARVQLNAVGAFP---S-------EGCGV-LLCVSGIPREGKT
A0A518HFS8      RRALIESVDA--------VRTAL--LRASQ---V-------EPLQV-IMVTSATKGEGKS
                                                                   .     **:

A0A5S9IPR9      TIFCNLALMMAKA-GHK-VLLIDGDLRRPRLRRLFELPQ-------GE-GFTELLR----
A0A533Q9U4      LISANLAIVMAQT-GKK-VLLIDADLRKPTMHKLFKIDK-------SL-GLSNVLV----
A0A1U9NNE1      TFSINFAASLAQN-DRK-VLLIDGDLRKPDIARILNLPE-------GTTGLSDVLE----
A0A2G2JCA2      SVACQLAISLARSSGRK-TLLIDGDMRSPDIHNVFEVPK-------SP-GLAEVLN----
A0A533Q6B7      LLTSNLGVVMAQT-GKK-VLLVDADLRNPSLHKTFELDE-------SS-GLSNSLI----
A0A351FYP6      TTMFNLAVVFAQM-GDR-ILVVDSDLRRPSMHRYFKVSN-------TI-GLTNLLL----
A0A2E7ESJ6      TLASNLAVTIAQS-GKS-VLLLDADFRRPTQHEVFAMEA-------PEIGLASVVA----
A0A1G2YQB7      TLAVNLAMNLAKI-GKK-VLLIDGDLRKPDIAKYLNLDN-----K-GK-GMHQLLA----
A0A353P687      TLAVNLATNLAKI-GKK-VLLIDGDLRKPDIAKYLKLDN-----K-GK-GMHQLLA----
A0A356EME5      SVAAQLALSLARASGKP-TLLIDGDMRAPDIQEVFEVRK-------SP-GLAEVLG----
A0A355AI52      TISSNLAIAYQQA-GKR-VLIIDADMRKPGLTKLIDRRG-------QV-GLSDILR----
A0A3L7SI46      TTLANLSVAFAQA-KKK-TLLIDADLRRPGMTQLLELKG-------PR-GLSQILR----
A0A3L7P4E4      TMSSNLAVTLAQT-GKS-VLLIDADMRRPTVKRLFSLKN-------KM-GLSNLLG----
A0A3L7PEB5      TMSSNLAVALAQT-GKS-VLLIDADMRRPTVKRLFGLKN-------NT-GLSELLD----
A0A2N1UCJ3      TMVSNLAIAMAQA-GQK-TLIVDADFRKPMQHNIFGFAN-----EVEK-GLSSILS----
A0A517ZCB5      TVMASLGVAFAQS-GRR-TILIDGDMRRPGLTRLFNLTG-------HP-GLSTVLM----
A0A432MFP3      TLAAQLAVRCAEA-GAS-TVLIDADLRRATLGRLFEVPD-------CP-GLSDVLR----
D5SZ21          TVSTNLAVAYAQS-GRR-TIIIDCDMRRPGLSKTMKLRG-------SY-GLSTILR----
A0A518CHE5      TVMANLAVAFAQS-NKK-TLIVDTDMRRPGMTNLLELRK-------EE-GLSKLLR----
A0A257WS34      TTLANLAVAFAQA-GKK-TLLIDADLRRPGMTQLLGLKG-------QQ-GLSHVLR----
A0A2E8FLY0      TILANLAVAFAQS-GKK-TLLIDADMRRPGMTALMDLRG-------PR-GLSTVLR----
A0A3D2U1E1      TVLANLAVAFAQS-GKR-TLLIDADMRRPGLTAMMDLRG-------QQ-GLSSILR----
A0A1P8WP26      TISSNMAVAFAQS-GRR-TLIIDADMRRPGLSTLLDLRD-------DK-GLSVILR----
A0A3L7V1F3      TVSSNLAVAFAQS-GKR-TLIIDADMRRPGLSTLLGLRD-------DT-GLSKILR----
A0A5B9QF68      TISVNLSVAMAQA-GKR-TLVIDADLRKPGFTSLLQLRG-------RP-GLADVLT----
A0A5B9QGF0      TISVNLSVAMAQA-GKR-TLVIDADLRKPGFTSLLKLKG-------RP-GVADVLT----
A0A5C6CK24      TISVNLSVAMAQA-GKR-TLVIDADLRKPGFTTLLKLKG-------RP-GVSDVLT----
A0A2E8B0L9      TVLTNLAVSYAQA-GKR-TLLIDCDLRRPGLTKLFQLRG-------VA-GLSDILR----
A0A5Q4GFE7      TVLANLAVSYAHS-GKR-TLVIDADLRRPGMTKLFEMRS-------NG-GLSEILR----
A0A2E3GWX1      TVISNTAVAFAQA-GRR-TLLIDGDMRRPGLTRLFDLRG-------QQ-GLSSILR----
F0SG60          TVISNTAVAFAQA-GRR-TLLIDGDMRRPGLTRLFDLRG-------QQ-GLSSILR----
A0A2E9VST2      TVISNTAVAFAQA-GKK-TLVIDGDMRRPGLTAVFALKG-------QA-GLSTILR----
A0A356A6X2      TVISNTAVAFAQA-GKK-TLIIDGDMRRPGLTAVFALKG-------QA-GLSTILR----
A0A5C5XLM3      TVISNTAVAFAQA-GKK-TLIIDGDMRRPGLTAVFALKG-------QA-GLSTILR----
A0A3M1VCL4      TVLSNLAVAFAQA-GKR-TLLIDADLRRPGMTTLFGLRA-------AP-GLSTVLR----
A0A5C5V7Z9      TVTSNLGVAFAQI-GKR-TLIIDADLRKPGMTSLMDLKG-------QA-GVTDILL----
A0A5C5YT05      TVSSNLGVAFAQV-GKR-TLIIDADLRKPGMTSLMGLKG-------HA-GVTDILI----
A0A518D7F9      TVSSNLAVAFAQI-GKR-TLVIDADLRKPGLTALLGLKG-------QP-GVTDLLT----
A0A5C5ZIP0      TISSNLAVSYAQV-GKR-TLLIDADLRKPGMTALMDLKG-------KS-GVTDILT----
A0A518KBK3      TVSANLAVSYAQT-GRR-TLVIDCDMRKPGLTSLLELKG-------YE-GVTDILS----
A0A5C6AKF9      TISANLAVSYAQT-GKR-TLVIDCDLRKPGLTALLELKG-------QA-GVTDILT----
A0A2E0X4J3      TVASNLAIAMARA-GQR-TLLIDADMRKPRQHVTFGLST-------EI-GLSTLLA----
A0A5C5YU10      VVTSNLAIATDQA-DRR-TLLIDADMRKPTQHTIFGVDN-------TQ-GLSTALS----
A0A517MPZ6      VVASNLALTMAQA-DQR-VLLIDADMRKPKQHEVFEIQV-------EH-GLSSVLA----
A0A5C6CNV7      TVASNMAIAMAQA-DQR-VLLIDADMRKPTQHTIFEVTC-------EQ-GLSTVLT----
A0A518K5H4      TVASNLAIAMAQA-NQR-VLLIDADMRKPTQHETFGMTP-------TT-GFSDVLT----
A0A5C6AA28      TVASNLAIAMAQA-NQR-VLLIDADMRKPTQHEIFGVEV-------ES-GFAAVLS----
A0A2E9VK20      TTISNLAISIAQA-GKR-VLLIDADLRKPMVHQLFGMRE-------DI-GLSECLS----
A0A3D4PJK1      TTISNLAISIAQA-GKR-VLLIDADLRKPMVHQLFGMRE-------DI-GLSECLS----
A0A0S8GZ23      TFAVNLATSLAQA-GKR-VLLIDGDLRKPDIERLLNLPH-------DSWGLMDVLY----
L0DC26          SLSSHLATSLARA-GRR-TLLVDGDLRRPSAHELFDQPC-------VP-GFCEVLR----
A0A354PCQ3      SVASQLSLSIAKA-TGQTVLLVDADLRCPDQHRLFGLEM-------GP-GFSAVLA----
A0A1I3DDV4      TILANLGASFAEL-GLK-VLIIDGDMRAPTIHRFLNMPI-------DR-GLSETLQ----
A0A2E2N5A9      TLSANLAHALAQL-GK--VILIDADLRKPTLAKNFGRPK-------GSMGLTDIIE----
A0A2E3GWC6      TTISNLAISMAQA-GKK-VLLIDADLRRPMVHRLFGLRE-------EI-GFSEVLQ----
F0SLB0          TTISNLAISMAQA-GKK-VLLIDADLRRPMVHRLFGLRE-------EI-GLSEVLQ----
A0A2E0SMM6      TVMANLAVAFAQA-NKK-TLIVDTDMRRPGMTNLLEMRK-------EE-GLSKLLR----
A0A1N6DAJ8      SLSSHLATSLARA-GRR-TLLIDGDMRRPSAHELFDQPC-------VP-GLSEVLR----
A0A5B9PJZ8      TTIANLAASMAQS-GRK-VLLIDADLRKPRQHKYFGVDN-------DY-GLTSVVY----
A0A2S8G191      TLAGQIAYALAES-GAR-TILVDFDLRRPALDTAFDVNL-------VP-GVTEWLS----
A0A2E7EGG1      SVASQLAVSLARS-SGMPTLLIDGDMRSPDIHRIFKVEN-------KP-GLVGVLS----
A0A225EH48      SLASQLATSMATA-GLR-TLVLDCDLRNPSLHKLFDSPL-------TP-GCAEVLL----
A0A3L7NDH9      TASTNLAVAYSQA-GKR-VLLIDADMRKPGLTKLVGFRS-------MP-GLSDILR----
A0A518INW8      TMTVNLAAAIAKA-GKR-VLLIDADLRRPTLYKLLGTQN-------AN-GLAEYLM----
A0A518JPH9      TMTVNVAAAIAKA-GKR-VLLIDADLRRPTLYKLLGIQH-------PK-GLAEYLM----
A0A2E2CCW9      TSISNLALAIAQT-GRK-VLIVDADLRRPTIHKLFGLAN-------SV-GLGDVLT----
A0A3C0AGX3      TSISNLALAIAQT-GRK-VLIVDADLRRPTIHKLFGLAN-------SV-GLGDVLT----
A0A518AAQ5      TSVSNLAMAIAQT-GRK-VLIIDADLRRPTVHKLFGINN-------AV-GLGDVLA----
A0A517QBG9      TSVSNLAMAIAQT-GRK-VLIIDADLRRPTVHKLFGINN-------AV-GLGDVLA----
A0A518FTU3      TSVSNLAMAIAQT-GRK-VLIIDADLRRPTVHKLFGINN-------AV-GLGDVLA----
A0A2E7K7A9      TSVSNLALAIAQT-GRK-VLIIDADLRRPTVHKLFGINN-------AV-GLGDVLA----
A0A517PTS5      TSVSNLALAIAQT-GRK-VLIIDADLRRPTVHKLFGINN-------AV-GLGDVLA----
A0A517WHH5      TSVSNLALAIAQT-GRK-VLIIDADLRRPTVHKLFGINN-------AV-GLGDVLA----
A0A5A8BGT3      TSVSNLALAIAQT-GRK-VLIIDADLRRPTVHKLFGINN-------AV-GLGDVLA----
A0A517VTK3      TSISNLALAIAQT-GRK-VLIVDADLRRPTIHSLFGIVN-------GI-GLGDVLS----
A0A517WQT4      TSISNLALAIAQT-GRK-VLIVDADLRRPTIHSLFGIVN-------GI-GLGDVLS----
A0A517VID8      TSISNLALAIAQT-GRK-VLIVDADLRRPTIHKLFGLAN-------SV-GLGDVLS----
A0A517RK10      TSISNLALAIAQT-GRK-VLIVDADLRRPTVHKLFGLAN-------AI-GLGDVMA----
A0A518IH18      TSISNLALAISQT-GRK-VLIVDADLRRPTVHKLFGLSN-------AI-GLGDVMA----
A0A5C5VEK8      VIASNLAIATDQA-DRR-VLLIDADMRKPTQHSIFGVDS-------KQ-GLSTMLR----
A0A532UTJ0      TFAVNLATSMAES-GKK-VLLIDGDLRKPDVARLLNLPK-------GSRGLQDVLC----
A0A517NSK8      TTSANLAVAFAQA-GKR-VLLIDADLRKPRVAKLFRLEN-------TL-GLSEAIG----
A0A5C5Z0D6      TTSVNLATAFAQT-GKR-TLIIDADLRKPRVGRLLHLEG-------SL-GLSDALR----
M5UE94          TTSVNLAMAFAQT-GKR-TLIVDADLRKPRVARLLHLSG-------ES-GFSEALQ----
A0A1P8WN28      TTTVNLAASYAQT-GQR-TLLIDADMRRPGLSRLLEIRG-------NG-GLSEVLR----
A0A3B9CTT0      VTTVNLAASFAQT-GQK-TLLIDADMRRPGLSRLLEVRG-------NG-GLSEILQ----
A0A5C5XLF4      TTISNLAISIAQA-GKR-VLLIDADLRKPMVHQLFGMRE-------EI-GLSECLS----
A0A2D5NDU9      TIASILAIAMAKA-GHR-TLLIDGDLRKPVQSKRWQVSG-------PG-GITSAVA----
A0A286RGB6      TLASQLAASLAQM-GQK-TVILDFDLRRPSLHEVFNLPI-------SP-GVSEVLR----
A0A1V5N3W2      TLAINLSLSLAQT-GQK-VLLIDGDLRKPDIAHFLKLPE-------NYWGLQDVLL----
A0A3E0MY27      TISSSLAASLGRS-GRR-TLLIDGDMRRPAVHRMLDLPL-------DT-GLSEVLR----
A0A2E0X9P6      SVATSLAVSFAKA-TQHATLIIDADLRAPSAARMLGLPN-------QP-GLADVLR----
A0A286RLF2      TVSANLALTYAHV-GKR-TLLVDGDLRRPGLTQLLGLRG-------EP-GISEVLR----
A0A5C5ZM48      SLSSQLSICLAEA-GGK-TLLIDGDLRSPDIHSAFDIDP-------SP-GLGDVLD----
A0A5B9WF77      TLAAQLAARCGNA-GIS-TLLIDADLRRASLCPLLEVPE-------GP-GLSDALQ----
A0A518BBX8      TTASNLAITFAQL-GRK-TLLIDADLRKPRVHRLFNLSG-------KK-GLVSVIR----
A0A518ALT3      NISTALAMSIAHA-SKMPTLIIDADLRSPDVSEYLDVPS-------GP-GLSEVIS----
A0A517MDV3      LTTTNLAVSIAQT-GKQ-VLLIDCDLRRPRLGTLFGLED-------EA-GLSNVLT----
A0A3M1QRP3      TFAIMLAKSLAHI-GKR-VLLVDADLRNPSIAGRLGVSG-------A--GQEFLAS----
A0A517TMV0      TISSNLAVSYAQT-GKR-TLLIDCDLRKPGLTALMDLKR-------MP-GVTDILT----
A0A2E3RCU8      TVIANLAVVYAQS-GKR-TLLIDGDLRRPGLTRLLDLKS-------HR-GLSDVLA----
A0A3E0MY88      TVLSNLGTSIAQS-GKK-VLMIDADLRRPGLTALFALKR-------EH-GLSDVLN----
A0A1C3E6N1      TVSTNLAVAYAQS-GRR-TIIIDCDMRRPGLSKTMKLRG-------SY-GLSTILR----
A0A518GJT2      TVSTNLAVAYAQS-GRR-TIIIDCDMRRPGLSKTMKLRG-------SY-GLSTILR----
A0A286RD13      TLVAQLATSLARA-GRR-VVVVDGDLRRPRLHRLFRCPL-------SP-GLSELAK----
A0A517MLW3      TISSNLAVGLAQA-GKR-TLVIDADLRKPGMTNLFNVRH-------AK-GLSQLLV----
A0A5B9QVD0      TVSSNLATSLAQA-GKR-TLLIDADLRKPGMTNLFDLRQ-------CR-GFSQLLV----
A0A3B8PNV4      TVLANLGVAFAQS-GKR-TLVIDADMRRPGLTRKLNLKG-------SR-GLSTILQ----
A0A3D1DR40      TVLANLGVAFAQS-GKR-TLVIDADMRRPGLTRKLNLKG-------SR-GLSTILQ----
A0A2E7RYU8      TVLTNLGVAFAQS-GKR-TLVIDADMRRPGLTRKLNLKG-------PR-GLSTILQ----
A0A3B8LXG8      TVLTNLGVAFAQS-GKR-TLVIDADMRRPGLTRKLNLKG-------PR-GLSTILQ----
A0A350CI62      TVSMNLSVAYAQS-GRR-TLVIDADMRRPGLSTLLGLRD-------DV-GLSRLLR----
A0A4P5WQK6      TVSMNLSVAYAQS-GRR-TLVIDADMRRPGLSTLLGLRD-------DV-GLSRLLR----
A0A3C1X4W5      TVSMNLSVAYAQS-GKR-TLVIDADMRRPGLSTLLGLRD-------DV-GLSRLLR----
A0A3D3W3A7      TVSMNLSVAYAQS-GKR-TLVIDADMRRPGLSTLLGLRD-------DV-GLSRLLR----
A0A518DRX3      TVISNLGASFAQS-GKR-TLLIDCDLRKPGLSTLFQVRG-------LP-GLSDLLR----
A0A518DZF9      TVISNLGASFAQS-GKR-TLLIDCDLRKPGLSTLFQVRG-------LP-GLSDLLR----
F0SI78          TTCSNIALATANS-GKR-TLVIDLDLRRPTVHKLFGLDR-------DV-GVSTFLT----
A0A518IQ30      TVIANLAVTYATA-GKR-TLLIDCDLRKPGLTRLFDLRG-------LG-GVSQLLT----
A0A517LWP4      TVIANLAVTYATA-GKR-TLLIDCDLRKPGLTRLFDMRG-------LG-GVSQLLT----
A0A518JNW8      TVIANLAVTYATA-GKR-TLLIDCDLRKPGLTRLFDMRG-------LG-GVSQLLT----
A0A2E7ENQ5      TVLSNLGASSAQA-GKR-TLLVDADMRRPGLTRLFGFRG-------KG-GLSDVLT----
A0A1G3AQE9      TVLANLAVAIAQS-GKK-TLLIDADLRRPGLTALMAMRG-------IE-GLSSVIR----
A0A3L7UQT9      TVMSNLAVAFAQS-GKR-TLLIDADMRRPGMTALLGLKG-------QQ-GLSQVLR----
A0A4P5YBU2      TVMSNLAVAFAQS-GKR-TLLIDADMRRPGMTALLGLKG-------QQ-GLSQVLR----
A0A518AKT8      TVSANLAVAFAQA-GKR-TLVIDADLRRPGMTTLLGLKG-------QA-GVADILT----
A0A5C5ZR72      SISVALAMSFANA-SGKPTLLIDGDTRKPGVPDLIDLRH-------GQ-GLTEVLA----
A0A517TY85      SLATALAMSIAES-SKQPTLLIDADLRSPDIARLLGTPA-------GP-GLAELLS----
A0A5B9QEI7      SLAAALTLSIAKA-SKKPTLLIDADLRSPDVSSFLEVPS-------QP-GIVELLG----
A0A5S9IJB5      FCAANLSVAFTQN-DAK-VLLIDADMRKSRQHQIWNTPR-----YP---GLSNLIA----
A0A1G2XVR0      FIAANLAIAFAQT-GKK-TLLVDTDFRKPRQHKIFGIDL-----KP---GLSNHFI----
A0A1G3B0P0      FIAANLAIAFAQT-GKK-TLLVDTDFRKPRQHKIFGIDL-----KP---GLSNHFI----
A0A1E3X4X0      FFVSNLATVIAHT-GKK-VLMVDTDMRKPRLNKIFSVER-----NP---GVSNVLA----
A0A286U4B3      FVASNLAIVIAKT-GKK-TLIVDCDFRKPRVHKAFNIQM-----MP---GLTNHIL----
A0A5C6DDS2      FVAGNLAIVIAKT-GKK-TLIVDCDFRKPRVHKAFNIET-----MP---GLSNHFV----
A0A0S8J591      TVAVNWAITLAQA-GNK-VLLIDGDLRKPMIHRAFNMKP-----DR---GLSTLLS----
A0A2E3GW02      TTCSNIALATANS-GKR-TLVIDLDLRRPTVHKLFGLDR-----DV---GVSTFLT----
A0A1U9NL64      TLISNLGITMAQA-GQK-TLIVDADFRRPKQHEVFEFDR-----EP---GISNILA----
A0A5B9QNZ7      LTTVNLAASLGQT-GKR-VLLIDCDLRRPRVGKLFSLDP-----DNTA-GLADVLT----
A0A1U7CZ81      TLAAQLAARCGHA-GHS-TLLIDADLRRGSLCSLLDIPE-----GL---GLSDVL-K---
A0A142YNY8      TLAAQLAARCGHS-GHS-TLLIDADLRRGALSPLLDVAD-----SK---GLSDLLMN---
A0A1U7GLS6      TLAAQLAARCGHS-GHA-TLLIDADVRRGALSPLLDVPE-----GA---GLSDALMN---
A0A1Z8N7H5      TVIANLAVVCAQS-GKK-TLLIDGDLRRPGLTRLLDLKS-----KP---GLSDLLNADDE
A0A1G2YPI3      TLASNMAIAMAQA-GQR-VLILDADFRKPMQHRIFKLNH-----ENR--GLSSVLA----
A0A532UIN2      TLVSNLAIAMAQA-GQK-TLIIDGDFRKPMQQKIFNVNH-----GDV--GLSSTLA----
A0A532UD06      TLVSNLAIATAQA-GQG-TLVIDADLRKPRQHRIFEIDH-----EL---GLTNVLA----
A0A660URN1      TLASNLALTMAQA-GQR-TLVLDADFRKPVQHKIFEIDH-----GK---GLSNVFA----
A0A0S8KNX5      TFAINLATSIAES-GKR-VLLVDGDLRKPDVARLLNLPK-----GAR--GLQDVLS----
A0A3D3UVZ8      TFSVNLATSLSES-GKK-VLLIDGDLRKPDVARLLNLPK-----GSR--GLQDVLC----
E8R3W3          TLSSYLAVSMASC-GHR-TLLVDCDFRRPMSHQLFGTQK-----SP---GLAEIFR----
A0A517NFU9      TTISNLAISFARA-GKS-VLLIDADMRRPVIAGLFNVAE-----SP---GLSDVLR----
A0A5C5YWH4      TTISNLAVSFARA-GKK-VLLIDADMRRPVIAGLFGVQR-----EP---GLSDVLS----
A0A3D2TNK4      TISANLSVALAQA-GHR-TLVIDADLRRPGFTTLMQLKG-----QP---GVADLLTSPET
A0A0J1B4A0      TTIANLAVSVAQT-GKR-VLLIDADMRRPTVAANFGVER-----SP---GLSDLLSHDGP
A0A142WSB9      TTTANLAVALAQS-GKS-VVLIDADLRRPTVHDLFALPR-----QL---GLAEVLT----
M5SZR3          TVAGNLGVSIAQS-GKR-VLLIDADLRKPRQHLFFGSEI-----GI---GLSNMIV----
M5TW92          TVAGNLGVSIAQS-GKR-VLLIDADLRKPRQHLFFGSEI-----GI---GLSNMIV----
A0A2S8FKY2      SLTCHLAISLAQA-GRK-VVVVDFDLRRPSMHSIFGLPV-----GP---GVGDILV----
A0A517N8P6      TVAANLAASVARA-GKR-VLLIDADLRRPTQAKIFGVQS-----EL---GLTSLIN----
A0A432MJP4      TVTSNLAIGLAQA-GRR-VLLIDCDLRKPSQDRIHGIDR-----AP---GLSEVLR----
M5UQ35          TMIVNLAASMAQT-GKR-VLLVDADMRRPTVAASLGVSA-----EY---GLVDYLK----
A0A5C5WTY6      TMVSHLSTSFIRS-GMR-VLLIDADLRRPTIHKLFGLPN-----EL---GLSQFIS----
A0A5C5Y033      TIVANFAQAFAQV-GLN-VVVVDCDLRRPSQHRYLSLQD-----QQ---GMSEVLQ----
A0A5C6G1Y2      TIVANFAQAFAQV-GLN-VVVVDCDLRRPSQHRYLSLQD-----QQ---GMSEVLQ----
A0A354PDV6      TVISNLAVSFSQL-GMS-VLVMDCDLRRPSIHNFFSVKR-----EN---GLVDVLA----
A0A5C6FZ02      TITANLAASFSQV-GLS-VLVVDGDLRRPTVHRYFSVAP-----EG---GLTDLLT----
M5TIT3          TVAANFAVSFSQI-GLR-VLVIDADMRRPGVHRFFSVDK-----AN---GLSEVLE----
A0A5M6CY44      TIMSNFAVSFAQV-NLK-VLVIDADLRRPTVHRYFSVEN-----EL---GLSDLLE----
F2AXG2          TVVSNFAVSFSQV-GLK-VLVIDADLRRPSAHRYFSIGK-----ED---GLCDVLE----
M2BB46          TVVSNFAVSFSQV-GLK-VLVIDADLRRPSAHRYFSIGK-----ED---GLCDVLE----
L7CLQ6          TVVSNFAVSFSQI-GLK-VLVIDADLRRPSAHRYFSLGK-----ED---GLCDVLE----
A0A0J1B719      TVVSNFAVSFSQV-GLK-VLVIDADLRRPSAHRYFSLGK-----ED---GLCDVLE----
Q7UF18          TVVSNFAVSFSQV-GLK-VLVIDADLRRPSAHRYFSLGK-----ED---GLCDVLE----
A0A2G1W1E0      TVVSNFAVSFSQV-GLK-VLVIDADLRRPSAHRYFSLGK-----ED---GLCDVLE----
K5E235          TVVSNFAVSFSQV-GLK-VLVIDADLRRPSAHRYFSLGK-----ED---GLCDVLE----
A0A5C6FFI9      TTISNLAISFAQA-GKR-VLLIDSDLRRPVIAGLFGVDG-----GR---GLGDILM----
A0A3A0DET7      TIASNLALAMAQA-DQR-VLLIDADLRKPSQHTIFDLST-----EK---GLATVLS----
A0A5C5WDJ1      TTISNMAISFAQT-GKK-VLLIDADMRRPVIAKLFGIDQ-----EP---GLSDYLE----
A0A5C5X547      TASVEISRMLARS-GQK-TVLIDFDLRRPRIHEIFEVDG-----AT---GIYDILT----
A0A2A2W9R6      TTIANLAVSMAQA-GKR-VLLVDADLRRPMVAKTFGIER-----SP---GLSDYLN----
A0A518HKC1      TTIANLAVSMAQA-GKR-VLLVDADLRRPTVAKNFGIER-----SP---GLSDYLN----
A0A518L3P0      TTIANLAVSMAQA-GKR-VLLVDADLRRPMVSKTFGIER-----SP---GLSDYLN----
A0A255R1S0      TTIANLAVSMAQT-GKR-VLLVDADMRRPTIASRFGVER-----GP---GLSDYLH----
A0A5B9MKP1      TMVSNLAVSMAQA-GKR-VLLVDADMRRPTIDKVFGVER-----SP---GLSDYLN----
A0A0S8FY64      VFAANLATTMAQD-GKR-VLLVDADLRRPALHRAFELER-----SP---GLTNLLV----
A0A1N6KFT7      TTASNLAISFAMA-GRK-VLLVDGDLRKPAQHKIFRLKG-----DQ---GLSHILR----
L0DFG4          TTASNLAISFAMA-GRR-VLLVDADLRKPSQHKIFGLKA-----DQ---GLSHVLR----
A0A5C5XXG1      TITANLAASFSQV-GLS-VLVVDGDLRRPTVHRYFSVAP-----EG---GLTDLLT----
A0A518BJJ1      TTNIDIAWAFASG-GRR-VLLVDADMRRPSVHRYLKLDR-----GP---GLAEVLA----
A0A518D182      TTNIDLAWCLASP-SRR-VLLVDADLRRPSVHRYLGLGD-----QV---GLAECLT----
A0A353FIP5      TTIADLAISLANS-GAT-VLLVDADLRRPSIHKLFSIQS-----NP---GLVDAIS----
A0A5B1CIK7      TVCSNFAVSFSQI-GLR-VLVIDADLRRPSAHRYFSVAK-----GA---GLCDVLE----
A0A5C5WHS2      TVTSNFAVSFSQI-GLK-VLVIDADLRRPSVHRYFSVAK-----GA---GLCDVLE----
A0A5C6B6G8      TVTSNFAVSFAQL-GLK-TVVVDADLRRPSIHRYFSVSK-----TG---GLCDVLE----
A0A5C5ZZN3      TVASNFAVSFSQI-GLR-VLLIDADLRRPSAHRFFSVGR-----EE---GLCDILN----
A0A5C5XS91      TVVSNFAVSFSQI-GLK-ILIIDADLRRPSAHRFFNLSK-----EN---GLCDLLE----
A0A5C6C4E6      TVVSNFALSFSQI-GLK-VLVIDADLRRPSAHRFFNLNK-----ER---GLCDLLD----
A0A2E1VVJ1      TTLADLAIALAQG-GKK-VLLVDADLRRPVVHKYFDAEV-----SP---GLSEVLL----
A0A3M2AEL0      VTTCDLAVALAQT-GAR-VLLVDADLRRPVVHRLFGFPI-----SP---GLSDVLK----
A0A532UT69      TMVSNLAISMAQA-GEK-TLILDADFRNPVQHLVFDVDVFEVNGSK---GLASLLS----
A0A2D5AWU0      VTASNLAFALATG-GRR-TLLIDGDLRMPSLHEIYGVEN-----LA---GLGQVMT----
M5RT57          SISSQLAVSIGRATGEP-VLLIDGDLRAPDIHNIFQVSN-----NL---GMTSVLE----
A0A356KTN1      LSALNLAIASAQA-GRR-TLLIDADMRSPRVHRILGQPL-----EP---GLADAIE----
A0A518HFS8      SLSCHLATSLARA-GRR-TLLLDCDLRSPAIHLLMDEPL-----AP---GLCEVLR----
                                   :::* * *                      *          

A0A5S9IPR9      -RDVS-SEEVVHK-------INENLSCI-TSGKIPA---DP-YE-TIHNSH-IKELIREL
A0A533Q9U4      -KSGD-LRTVAKET------TIPNVRAI-ACGPIPP---NP-SE-LLSSSA-MVEMLQLA
A0A1U9NNE1      -GKPF-ANALWYA-------PSAGFDVL-GNYDRCL---KA-CD-RLSRPE-VQSNIRNL
A0A2G2JCA2      -RDIP-LKDAINRE------WSDSVHLL-TAGTLMT---SP-HK-LLGTNV-FDKLMKGV
A0A533Q6B7      -NPVN-LHRVARVT------KVPNLYVI-TSGPPSP---NP-SE-LLSSSA-MVEFLKVA
A0A351FYP6      -GQNT-LDEVIQTS------ESPNLHFI-PSGKLPS---SS-MG-VLNSAK-MKEFVAEM
A0A2E7ESJ6      -GDAE-PADAWQEIP-----FVPNLRIM-ACGPRPE---NP-SE-LLSSES-FANVLQLL
A0A1G2YQB7      -DFK------LRDLLMHA--DTPGLAVL-TAEPCDI---AI-INKLIHHKN-LVEFINEV
A0A353P687      -DFK------LRDLLLYS--DVPGLSVL-TAEPCDI---SI-INRLIHHKN-MVEFINEI
A0A356EME5      -GECD-LHEA----IVPT--WTPSVDVL-PGGEAKQ---NV-HK-LVGNGE-LSAILRQV
A0A355AI52      -GTEE-VAEQASGLAIQT--GSVPVDII-PAGRRPP---NP-GE-LLLGDR-FAELLAWA
A0A3L7SI46      -ETTP-VAECCLENIFNL--GIENLDVM-PSGSRPA---NP-SE-LLASDR-FNDILAWA
A0A3L7P4E4      -DVSL-DVNECIESVTFE--G-STLDIL-SSGECPI---DP-GE-RLMSDR-MESLLNML
A0A3L7PEB5      -EVPP-DINECIQTVSFE--G-SNLDIL-ASGECPI---DP-GE-RLMSNR-MENLLSML
A0A2N1UCJ3      -GQIS-LDDA----IRSC--PTDGLFLL-TSGPEIL---NP-SE-LLNSEA-FSNLLKEL
A0A517ZCB5      -SDRS-VEEAIDTLPHHT--ELPNLDVL-PAGPRPA---NP-VE-LLSGDR-LSMLVAWA
A0A432MFP3      -GDAQ-LEDAL---VPIS--QVGGCQLL-PAGSPEA---YP-NR-ILRGKA-FAPMLERL
D5SZ21          -NDDS-IENSLRNNVVVS--DLAGLDII-PAGPRPA---NP-LE-LLSSTR-FSELLAYV
A0A518CHE5      -SEEP-VDQCAVELIQPS--GSPNLDIL-PSGSRPV---NP-SE-LLSSNR-LSDFLSWA
A0A257WS34      -DSRP-VQESCLDNIFHL--GQENLDVM-PSGARPI---NP-SE-LLSTER-FSDVIAWA
A0A2E8FLY0      -GDEP-IANTATANLFAT--ELGTLDVM-PAGPRPL---NP-AE-LLHGDR-FSELLAWA
A0A3D2U1E1      -SNLP-PDTATQGNVFST--HLEHLDVI-PSGARPA---NP-AE-LLHGTR-FSELLAWA
A0A1P8WP26      -STDE-FDEAVQGNLRAT--AVDGLDVI-SCGPRPV---NP-AE-LLSSER-FANLLAWA
A0A3L7V1F3      -DSDE-LEVSIERNLRKS--DVKGLDVI-SCGPRPV---NP-AE-LLSSER-FSNMLAWA
A0A5B9QF68      -SGLS-PAESAPSMVVAT--EVPGLDVL-PVGLRRP---NP-AE-LLSSHE-FVELLAWA
A0A5B9QGF0      -SGLS-PSESAPSMVVET--EVPGLDVL-PVGLRRP---NP-AE-LLSSNE-FVELLAWA
A0A5C6CK24      -SERS-PAESAPDLVVHT--EVPGLDVL-PVGLRRP---NP-AE-LLSSNE-FVELLAWA
A0A2E8B0L9      -GNDE-VPAMCEERIQAA--GVDGLDVL-VCGPKPP---NP-VE-LLTDSR-FVDVIAWA
A0A5Q4GFE7      -GDSP-IDAMCRPRVLPS--GIAHLDVM-PCGPKPS---NP-AE-LLSGPR-LADVLAWA
A0A2E3GWX1      -DDQT-IEESAKANMVHT--GLMNLDII-AAGPRPS---NP-VE-LLTSDR-FAELIAWA
F0SG60          -DDQT-IEESAKANMVHT--GLMNLDII-AAGPRPS---NP-VE-LLTSDR-FAELIAWA
A0A2E9VST2      -DTAS-IEESALKHITKT--RLENLDVI-SAGPRPS---NP-VE-LLTSER-FEELIGWA
A0A356A6X2      -DTAT-IEESASKYITKT--RLENLDVI-SAGPRPS---NP-VE-LLTSER-FEELIGWA
A0A5C5XLM3      -DTAT-IEESASKYITKT--RLENLDVI-SAGPRPS---NP-VE-LLTSER-FEELIGWA
A0A3M1VCL4      -SEEP-LQVALQGCLFQS--GCAGLDFI-PSGPRPS---NP-AE-LLGSPR-FVDLLAWA
A0A5C5V7Z9      -CEGG-VAELAERCLVKT--PLEKLDVI-PAGPRRP---DA-AE-LLSGPN-FTELLAWA
A0A5C5YT05      -CEGA-IGALAERCLVKT--GLDKLDVI-PAGPRRP---DA-AE-LLSGPN-FGELLAWA
A0A518D7F9      -ARGE-MSKLAPGVVRKT--DQPGLDVI-PAGPRRP---DP-AE-LLVGPA-LTELLAWA
A0A5C5ZIP0      -TSGD-VAAEARRCLLKT--EQPNLDVI-PAGPRRP---DP-AE-LLLGPN-FSELLAWA
A0A518KBK3      -AEGN-VGLIAQRCVVRT--ALESLDVI-PAGPRRP---DP-AE-LLLSPN-FAELLAWA
A0A5C6AKF9      -TRDD-VAAVAERCVLRT--ALDTLDVI-PAGPRRP---DP-AE-LLLGTN-FADLLAWA
A0A2E0X4J3      -DRRP-AADA----MQAT--DVDNLTVI-TSGPVPS---HP-VE-LLNNGY-FADLVTSL
A0A5C5YU10      -ERRP-IEEL----IVSS--EIGTLDFL-PAGPTPS---NP-LE-LLNNDY-FAEMLERL
A0A517MPZ6      -ERRP-ADEV----IQRT--EVDTLDLL-PCGSRPT---NP-VE-LLNNGY-FSELLHEL
A0A5C6CNV7      -ERRP-VREL----IVST--EVVNLDLL-PCGVCPA---NP-VE-LLNNGF-FSELLDKL
A0A518K5H4      -GAVL-AIEA----VVSG--VAPNLDLL-PCGPIPP---NP-VE-LLNNGM-FSEVLEQL
A0A5C6AA28      -GVTP-AIEA----VVAT--SVPSLDLL-ACGRIPA---SP-VE-LLNNGN-FSEALEQL
A0A2E9VK20      -GEIE-MANAVQDS------GIENLHIL-SAGAIPA---KP-AE-LLSSSK-LHYLLGQA
A0A3D4PJK1      -GEIE-MANAVQDS------GIENLHIL-SAGAIPA---KP-AE-LLSSSK-LHYLLGQA
A0A0S8GZ23      -GLKK-FEETVRSV------PLSGLDVLTADGRNPA---EA-VE-LLEKPQ-TAECINNI
L0DC26          -GEID-IVGAVQPT------VISGLSLL-TAGFSDS---DS-IQ-ALASLD-LRAMFDQL
A0A354PCQ3      -GKAS-LLDAVNS-------RLGNLIHLLPAGQLTA---SP-HR-LMSPER-LQEFMREA
A0A1I3DDV4      -GKTK-LDEVIRPT------GIEGLSVM-TAGSAVR---NP-AE-LLQSEV-FDQVLEDC
A0A2E2N5A9      -NRAS-LESCIT--------QVSGVDMI-CAGTAVR---DP-LS-LLSSSR-FSALIEAL
A0A2E3GWC6      -GELE-LLNAIQPT------KIENLSVL-SAGAIPA---KP-AE-LLSSAK-LHYLFGEA
F0SLB0          -GELE-LLNAIQPT------KIENLSVL-TAGAIPG---KP-AE-LLSSAK-LHYVFGEA
A0A2E0SMM6      -SDEP-IHQCAVELIQPS--GAPNLDIL-PSGGRPV---NP-SE-LLSSNR-LSDFLAWA
A0A1N6DAJ8      -DEVD-VADAIQPT------AAGGLWLL-PAGLCDS---DS-IQ-ALACRD-LRAMFDQL
A0A5B9PJZ8      -GQME-PEEAVRVI------QPEYLSVV-TCGPIPP---NP-SE-LLTSAR-FEAIIGVY
A0A2S8G191      -GEVE-IQDAIQET------GMRNLDII-AAGDWGH---NS-FR-ELTSNR-MDAFFKKL
A0A2E7EGG1      -GECD-FEDAVNRE------WSEHVHVL-PAGYLDR---SP-HK-LMANEG-FKQLIAKA
A0A225EH48      -QEVD-VSDAVQPT------TVPNLWLI-PAGQCSN---RVIAA-LAQGHP-LETLFNRL
A0A3L7NDH9      -GNQP-VSDHASACIRRS--GSVPIDII-PAGQRPS---NP-AE-LLLSER-FSELLSWA
A0A518INW8      -GDAG-LDEVAVPS------EIERLDFI-SHGHHAS---EP-AE-LLESFA-LERLIAEA
A0A518JPH9      -GDAS-LEEVTVSS------EIPGLDFI-CHGHHAS---EP-AE-LLESFA-LETLIAEA
A0A2E2CCW9      -GEID-AQTAIRET------RVSHLSIL-TAGMLPE---NP-SE-MLMSRA-FSELVNQL
A0A3C0AGX3      -GEID-AQTAIRET------RVSHLSIL-TAGMLPE---NP-SE-MLMSRA-FSELVNQL
A0A518AAQ5      -QEID-AQTSIRET------RISNLSIL-TAGMLPE---NP-SE-MLMSRR-FAETVNQL
A0A517QBG9      -QEID-AQTSIRET------RISNLSIL-TAGMLPE---NP-SE-MLVSRR-FAETVNQL
A0A518FTU3      -QEID-AQTSIRET------RISNLSIL-TAGMLPE---NP-SE-MLVSRR-FTETVNQL
A0A2E7K7A9      -QEID-AQTSIRET------RISNLSIL-TAGMLPE---NP-SE-MLMSRR-FAEMVNQL
A0A517PTS5      -QEID-AQTSIRET------RISNLSIL-TAGMLPE---NP-SE-MLMSRR-FAEMVNQL
A0A517WHH5      -QEID-AQTSIRET------RISNLSIM-TAGMLPE---NP-SE-MLMSRR-FAEMISQL
A0A5A8BGT3      -QEID-AQTSIRET------RISNLSIM-TAGMLPE---NP-SE-MLMSRR-FAEMISQL
A0A517VTK3      -EEID-AQTAIRET------RIKDLSLM-TAGTLPE---NP-SE-MLMSKR-FTHLLKQV
A0A517WQT4      -EEID-AQTAIRET------RIKDLSLM-TAGTLPE---NP-SE-MLMSKR-FTHLLKQV
A0A517VID8      -GDID-AQTAIRET------RVSHLSIL-TAGMLPE---NP-SE-MLMSRG-FSELVNQL
A0A517RK10      -EEID-AQTAIRET------RISNLSIM-TAGTLPE---NP-SE-MLMSRR-FIDLIKQL
A0A518IH18      -NEID-AQTAIRET------RISNLSIM-TAGTLPE---NP-SE-MLMSRR-FTDLIKQL
A0A5C5VEK8      -ERRP-VEDFIIPN------ALGSLDFL-PAGPSPS---NP-LE-LLNNDY-LIEVLERL
A0A532UTJ0      -GVKF-EQAVYSM-------ASTGLDVLAADFDNAA---DA-YE-MLAMPA-TKKRINTI
A0A517NSK8      -GLAD-AADVISDT------VVDNLWAV-GSGAVPA---NP-AE-LLQSED-FASLLKHW
A0A5C5Z0D6      -QSLD-PSKVVQTT------VQDNLFAV-SAGSIPE---NP-SE-LLQSDK-FAQLLNAW
M5UE94          -DLCD-PTDVVQST------VSDNLFAV-SAGAIPA---NP-SE-LLQSDR-FSQLINVW
A0A1P8WN28      -ADSD-IPQMCKERVVQT--EVPLLEVL-PCGPRIL---NA-GM-LLSMPA-LADILDWA
A0A3B9CTT0      -ADGG-IAELASERVTPT--DVDGLYVL-PCGPRIL---NA-GT-LLSMPA-LSELLDWA
A0A5C5XLF4      -GEIE-MANAVQDS------RIENLDIL-SAGSIPA---KP-AE-LLSSSK-LHYLLGQA
A0A2D5NDU9      -EDLR-LIAAVHET------EVDGLDLL-AAGTPPS---NP-TE-ILNSEK-FGDLIAQA
A0A286RGB6      -AEIS-LKDVVRPT------ELENLFVV-TAGYWSP---HR-MA-VLANGV-IGGLFRQL
A0A1V5N3W2      -GLRR-WEEAVYTL------PEAGVQVLTADHRNNG---QA-ID-QLARPE-TAEIIRTI
A0A3E0MY27      -GEAA-VEEAIRPS------RAPGLWVM-PAGRCDH---ES-IQ-SLTKEI-LGATLEQL
A0A2E0X9P6      -GDLP-AVETIAQV------GSSTAFLL-PAGRSQD---NP-HH-LLLGGR-IKELFDRL
A0A286RLF2      -DTAP-IAEAIQARLKKN--IVPDLDVL-PCGRRPA---NP-AE-LLAGPR-TAELLNWA
A0A5C5ZM48      -GHAS-LQQTVVAA------EQPGLWVL-PAGKAVS---TP-HR-KLSWLQ--ERVLAAA
A0A5B9WF77      -GDVK-VDELIIPV------QGGTFHLL-AAGTPVP---DA-SR-IVQGRS-FPMLIAQL
A0A518BBX8      -DGAD-LDDVIHDT------GIDGLSVI-PCGPLPE---NP-AE-LLTSPH-FEELVEGV
A0A518ALT3      -GSVP-LNEAIYR-------VGDSLTFVLPAGSERI---NP-HQ-VVEGSA-IPDLLRKL
A0A517MDV3      -GDTE-LVDSIHET------PIENLSVM-PSGFRPS---NP-SE-LLMGKT-FFEMLETL
A0A3M1QRP3      -LLDA-QAGQTPRRDRAT--NVPGLRVLVSSRPARL---EE-SE-ILAGVA-PQRCLDAW
A0A517TMV0      -AGGD-IAAIAERCVRRT--DLETLDVI-PAGPRRP---DP-AE-LLLGPN-LAELLAWA
A0A2E3RCU8      -ADDP-IQEIIPGHVVPT--AAANLDVL-PAGPRRQ---NP-SE-LLASDR-LAQILAWA
A0A3E0MY88      -APEP-VEEVATRYVRGT--GIPDLDVL-PSGPRRP---NP-AE-LLTSRR-LADLLAWA
A0A1C3E6N1      -NDDS-IENSLRNNVVVS--DLAGLDII-PAGPRPA---NP-LE-LLSSTR-FSELLAYV
A0A518GJT2      -NDDS-IENSLRNNVVVS--DLAGLDII-PAGPRPA---NP-LE-LLSSTR-FSELLAYV
A0A286RD13      -NLAR-PEEIVRNA------EIENLYVV-TAGHCDG---EV-LE-AVSQGK-LDRFLQSL
A0A517MLW3      -EMSP-VD-VVDKYVMST--GIDNLELI-PCGARPL---DP-AE-LLASNA-LSDIVQWA
A0A5B9QVD0      -EANV-AA-TVKSYIQPS--GIEDLDLL-PSGARPL---DP-AE-LLSGPR-FSEVLEWA
A0A3B8PNV4      -SEDP-IAVSAAGNLFAT--ELGSLDVI-PAGPRPT---SP-AE-LLHGGR-FAELIAWA
A0A3D1DR40      -SEDP-IAVSAAGNLFTT--ELGSLDVI-PAGPRPT---SP-AE-LLHGGR-FAELIAWA
A0A2E7RYU8      -SEEP-IGISAASNLLAT--ELNSLDVI-PAGPRPG---SP-AE-LLHGGR-FAELIAWA
A0A3B8LXG8      -SEEP-IGISAASNLLAT--ELNSLDVI-PAGPRPG---SP-AE-LLHGGR-FAELIAWA
A0A350CI62      -SPDD-LDTAIAANLRTT--VVQGLDVI-SCGPRPV---NP-AE-LLSSER-FAALLSWA
A0A4P5WQK6      -SPDD-LDTAIAANLRTT--VVQGLDVI-SCGPRPV---NP-AE-LLSSER-FAALLSWA
A0A3C1X4W5      -SADD-LETAIAANLRTT--VVQGLDVI-SCGPRPV---NP-AE-LLQSER-FAALLSWA
A0A3D3W3A7      -SADD-LETAIAANLRTT--VVQGLDVI-SCGPRPV---NP-AE-LLQSER-FAALLSWA
A0A518DRX3      -SSEP-VGAMCEQRILST--GIPDLDLL-PCGPKAF---DA-AE-LLSGSR-IEELIAWA
A0A518DZF9      -SSEP-VGAMCEQRILST--GIPDLDLL-PCGPKAF---DA-AE-LLSGSR-IEELIAWA
F0SI78          -SDVE-WADCIQQT------SVPNLDVI-TAGKKNE---QY-GE-LLHNPK-LASVLDAL
A0A518IQ30      -QADT-VEPVWGNEVKAT--GIGNLSII-PAGPRPQ---DP-TE-LFSSSH-FGELLAWA
A0A517LWP4      -QADV-VAPIWNHEVKGT--GIPNLSII-PAGPRPQ---DP-TE-LFSSSH-FGELLAWA
A0A518JNW8      -QADV-VAPIWANEVKGT--GIPNLSII-PAGPRPQ---DP-TE-LFSSSH-FGELLAWA
A0A2E7ENQ5      -KPND-LNELCEERIQKT--ALAGLDVL-PAGPLPT---DP-SG-LLTNRR-FAEFVAWA
A0A1G3AQE9      -SEED-IVRAAVAHIRPS--GLAGLDVL-ASGPRPS---NP-AE-LLSSQR-FSELLAWA
A0A3L7UQT9      -DERP-IAASVAENLFTQ--ITPGLDVI-PSGSRPS---NP-AE-LLASER-FSELLAWA
A0A4P5YBU2      -DERP-IAASVAENLFTQ--ITPGLDVI-PSGSRPS---NP-AE-LLASER-FSELLAWA
A0A518AKT8      -SEEP-TASIAPRHVVHT--DEPRLDVI-PAGLRRP---NP-AE-LLSSQE-FIELLAWA
A0A5C5ZR72      -GQ------CTLDEALQPARGVANLQVL-PAGKSRS---DH-QL-LLQPQR-LSQLIESA
A0A517TY85      -GR------ATLREVIHRV-GETEAFVL-PAGKLRG---SP-HH-IFEGVK-IEGVLKGL
A0A5B9QEI7      -GE------VALEKAIHRV-GKTQAYVL-PAGVLKG---NP-HH-LIDQAK-IEKLLDKL
A0A5S9IJB5      -DSEVNLDDVVQN-VD-----VENLSFL-PAGVSPP---NP-IE-LVEKER-FKEIIAEC
A0A1G2XVR0      -GEID-YESIIKH-VN-----IPHLNII-TCGLIPP---NP-SE-LLGSHS-MEKFCDNV
A0A1G3B0P0      -GEID-YESIIKH-VN-----IPHLNII-TCGLIPP---NP-SE-LLGSHS-MEKFCDNV
A0A1E3X4X0      -GEAS-IESCIKD-TE-----ISNLNLI-TSGSVPP---NP-SE-MLGSAS-MEKFCDDI
A0A286U4B3      -GDND-LDSIIKH-TA-----IPNISVI-TCGLIPP---NP-SE-MLGSHS-MEKFCKEI
A0A5C6DDS2      -GEGD-LDLIIKP-TA-----IPNLSVI-TCGLIPP---NP-SE-MLGSHS-MEQFCMEV
A0A0S8J591      -EKDS-ATVYIKK-TD-----IENLHVL-PGGPIPS---NP-AE-LLGSRK-MRTLVAEA
A0A2E3GW02      -SDVE-WADCIQQ-TS-----VPNLDVI-TAGKKNE---QY-GE-LLHNPK-LASVLDAL
A0A1U9NL64      -GESQ-IDSVIKN-TS-----IDGLDVL-ACGPSIP---NA-SE-LLNSDE-FGELLSSL
A0A5B9QNZ7      -GKTE-LLDAIYE-TE-----VPEVSVM-PSGFRPH---NP-SE-LLQTNE-FFNLLAAV
A0A1U7CZ81      -EEAN-VEDVAIP-VQ-----GGTFHLL-CAGTPVA---DT-SR-LFQGRN-FGMMIARL
A0A142YNY8      -EDLN-PEDLAIP-VQ-----GGTFHLL-SAGTPTS---DT-SR-VFQGRA-FGMLIARL
A0A1U7GLS6      -DGLN-VEELAIP-VQ-----GGTFHLL-SAGTPTS---DT-SR-LFQGRA-FGMLIARL
A0A1Z8N7H5      -VSGM-ISDYLAP-TD-----APNLDVL-PAGPRRQ---NP-SE-LLASDR-LAQIFAWA
A0A1G2YPI3      -GAAR-LEDAIHQ-TE-----VKGLDLL-ACGPEVP---NP-AE-ILNSDT-FAKLLERL
A0A532UIN2      -GITT-SGEAIRP-TE-----IEGLELL-PCGASVP---NP-SE-LLNSDG-FAQLLEIL
A0A532UD06      -GTVR-LDEAIQP-GP-----VTGLDLL-SCGSQVP---NP-SE-MLNSDV-FAQMLKDL
A0A660URN1      -GAIT-LDEAIEA-GP-----VEGLDIL-PCGPEVP---NP-SE-ILNSDT-FANMLNEL
A0A0S8KNX5      --GVE-FEDVVYS-IA-----SSGLDVL-AADYHNAA--DA-YE-LLALPS-TAHRIDTI
A0A3D3UVZ8      --GVK-FEQAVFS-VA-----STGLDVL-AADFQDSA--DA-YE-MLALPS-TAKRINAI
E8R3W3          -NEID-LWSAIQT-TS-----FNLLSTL-AAGEGDP---QT-IE-LLNHNL-LAGLIEQA
A0A517NFU9      -GEIS-ADTAIKP-SE-----IPNLNLM-ANGSPTS---DP-AE-LLESAR-FSMMLSEM
A0A5C5YWH4      -GTIS-ARESIQN-TE-----VSNLDLI-PNGRPTA---DP-SE-LLESDR-FGAMVAEL
A0A3D2TNK4      -PAQS-APPLIHS-TI-----VKDLDVL-PAGLRRP---NP-AE-LLSSKA-FIELLAWA
A0A0J1B4A0      INPAT-LAECVQA-SE-----QDSLTLC-TSGSRTS---EP-SE-LLESDQ-WVAFLDLA
A0A142WSB9      -GAIP-LESGLKA-TP-----VANLSVL-TAGIPPE---NP-AE-LLSTSN-LEGLVQEL
M5SZR3          -DGAE-PTDAIRA-TP-----VHNLWLL-SAGQKTP---DP-AE-LLTSTR-FAELMAQF
M5TW92          -DGAE-PTDAIRA-TP-----VHNLWLL-SAGQKTP---DP-AE-LLTSTR-FAELMAQF
A0A2S8FKY2      -GEAK-LADSIRP-TD-----IPNVDLL-PAGIKEQ---SV-PR-SASTGR-LDQLFADL
A0A517N8P6      -GEGQ-LADIVVP-TD-----TEDLFVL-ASGPRPN---NP-AE-ALMMPE-FGQILDEA
A0A432MJP4      -GIST-WREVLQP-SA-----AEDLRIM-TTGGPVE---NP-AE-LLMSER-FRSLVAEL
M5UQ35          -GKAG-FEDVLHP-CE-----QAGLFVC-TDGSRTS---QP-AE-LLETDR-FAEFMAEA
A0A5C5WTY6      -GSAT-LDEVIQS-TK-----SDDFKVI-TSGEISL---DS-PE-WLQTAA-LEELLRQ-
A0A5C5Y033      -AKLP-LAEVIQP-TE-----IENLSAI-SAGKTPE---NP-AE-LLQGVN-LDKAIESL
A0A5C6G1Y2      -AKLP-LADVIQP-TE-----IENLSAI-SAGKTPE---NP-AE-LLQGVN-LDKAIESL
A0A354PDV6      -DELE-PMEAIRD-TD-----VENVHVL-PAGAPTS---TP-AE-LLQSPR-FDQLLEIL
A0A5C6FZ02      -GSME-LDDAIKP-TE-----ADGVSVI-TAGASTR---TP-AE-LLQSEK-LEELTHQL
M5TIT3          -GQLA-FEDAVKE-TR-----ADNVFVV-TGGATSP---RP-AE-LLQSDK-LGEVLEAA
A0A5M6CY44      -NETS-IEETIRS-TA-----IDNVSVM-TAGSSTK---TP-AE-LLQTSR-LDEILDEL
F2AXG2          -GRLE-IPESIKV-TE-----AENVSVM-TAGSSSQ---TP-AE-LLQSQR-LDEVLAVV
M2BB46          -GRLE-IPEAIKV-TE-----ADNVSVM-TAGSSSQ---TP-AE-LLQSQR-LDEVLAVV
L7CLQ6          -GRLE-IPEAIKV-TE-----AENVSVM-TAGSSSQ---TP-AE-LLQSQR-LDEVLAVV
A0A0J1B719      -DRLE-ISEAIKA-TE-----ADNVFVM-TSGSSSH---TP-AE-LLQSQR-LDEVLAVV
Q7UF18          -GRLE-IPEAIKV-TE-----AENVSVM-TAGSSSQ---TP-AE-LLQSQR-LDEVLAVV
A0A2G1W1E0      -GRLE-IPEAIKA-TE-----ADNVFVM-TSGSSSQ---TP-AE-LLQSQR-LDEVLAVV
K5E235          -GRLE-IPEAIKA-TE-----ADNVFVM-TSGSSSQ---TP-AE-LLQSQR-LDEVLAVV
A0A5C6FFI9      -GEAT-LEDSTVA-SS-----VENLDIL-PHGKATS---VP-AE-LLQSNR-MSVLVQEA
A0A3A0DET7      -ARMP-VGDAIVR-LR-----ESSLEVL-PCGPLPA---NP-VE-LLNNGY-FAELLESL
A0A5C5WDJ1      -RRIP-FEGAVTR-TE-----VANLDIV-PNGGPTA---EP-AE-LLESVQ-LTRLLQEA
A0A5C5X547      -GNET-LDGALKY-IE-----EDKLTVI-PAGNVES---EV-YL-ESYSGM-LAELFATL
A0A2A2W9R6      -HVVC-FSESLHE-CE-----QINLTLC-PAGSRTS---AP-SE-LLESES-IAEFIANA
A0A518HKC1      -HVVC-FSESLHE-CE-----QINLTLC-PAGSRTS---AP-SE-LLESES-FGEFIAEA
A0A518L3P0      -RVVC-FSECLHE-CE-----QINLTLC-PAGSRTS---AP-SE-LLESDS-FAEFIAEA
A0A255R1S0      -GDAT-LMECLHH-TE-----QENLVIC-PSGSRTS---SP-SE-LLESDR-FLEFIENV
A0A5B9MKP1      -GVVS-FSECQQD-CE-----QLNLAVC-PAGSRTS---SP-SE-LLESEQ-FAEFIAQA
A0A0S8FY64      -EGRA-LQEIVQQPSDGQLEGLQNLYVL-SAGAKTP---NP-AE-LLGSSA-MARLVRQS
A0A1N6KFT7      -RLLP-LSRVVQQ-TQ-----IENLDFI-ASGSDVD---NP-AE-LLASSA-LTDFVAEI
L0DFG4          -RLLP-LSRVVQQ-TQ-----TENLDFI-ASGPEVD---NP-AE-LLASAT-FTDFVSEI
A0A5C5XXG1      -GSMD-LDDAIKP-TE-----ADGVSVI-TAGASTR---TP-AE-LLQSEK-LEELTQQL
A0A518BJJ1      -GTSE-WRDVARS-TD-----NPLLSVI-PAGVLRA---SA-GD-ALGTTK-AQELIDEF
A0A518D182      -DEAD-WRERRQP-SG-----RDHLDVL-VAGRSRQ---VS-AD-LLGSDA-MSELVDEW
A0A353FIP5      -GESP-CEDLAQQVSS-----IPNLHIL-PSGKVDVGGINP-GD-LLAQEK-MSEIADSL
A0A5B1CIK7      -GRAE-FADVIKE-TD-----AENVSVI-TAGSSPK---MA-AE-LLQSEK-LDEILSQA
A0A5C5WHS2      -GREQ-FKDMIRE-TE-----AEGVHVV-TAGSSPK---MA-AE-LLQSDK-LDEVIAEA
A0A5C6B6G8      -GRLQ-LADVIKD-TD-----AEKVSVI-TAGSSSK---MP-AE-LLQMEK-LDELLEEL
A0A5C5ZZN3      -DRTP-FADAIKE-TR-----ADNVWVI-PAGSSSS---TP-AE-LLQSSK-FDEILRMA
A0A5C5XS91      -GRID-FNEAVKE-TK-----VDNVHVM-PAGSSST---SP-AE-FLQSEE-LDEVLATA
A0A5C6C4E6      -GRIS-FEEAVKE-TK-----ADNVYVM-PAGSSST---SP-AE-FLQSEE-LDEVLATA
A0A2E1VVJ1      -EKNP-WQDCVHK-AP-----VANLDVL-PAGAMVK---NP-GD-LLASEG-LVQLTESF
A0A3M2AEL0      -EDAS-PEKLMHP-TN-----IDGLSVL-TAGSRTA---RP-GD-LIASPA-MQGFLQDV
A0A532UT69      -RRAT-LEDIAEK-TD-----IKDLDLL-PCGEQLI---NA-SE-VLNSKS-FTTLLKDL
A0A2D5AWU0      -RSIT-TDKVIVQ-NV-----AAGLDLM-PAGDPFG---KP-AE-LFESGL-FPKLLDFL
M5RT57          -GRAT-LDEAVIR-DW-----SDQIHLL-PAGRLRV---NP-HQ-LMTRES-LNKIFNEL
A0A356KTN1      -GKVEDLGERLRR-TQ-----VENLWVM-GAGRCEA---NP-GE-LLARDDTFHQLVWRL
A0A518HFS8      -GEVA-LDDAVHA-TA-----ASPLEVL-PAGCCDA---AA-VD-ALAREE-FPRLIQDL
                                                                            

A0A5S9IPR9      EHEYDYILIDAPPIGITTDALLLG--KKLGGLLFAITVHRTPKRMVKQLIHRMQTLDIEL
A0A533Q9U4      KEEFEWIIIDSPPILTVTDARILA--RVADGAVFVIKSNKTTKDAARKAIDHFSDMRDKL
A0A1U9NNE1      CRYYDHVVIDTPPVLAFPDALLWA--RIADATILASFAGKTAADDLKEAYGRLHELNITV
A0A2G2JCA2      RGRYRYVVLDTPPVLAASEALVMA--KQADVSLVCAMRDVSRISQVQSVVERLESVGASP
A0A533Q6B7      REEYDWIIIDSPPLLTVTDGSILA--RMVDGIVFVLRNKKTSIAIAQKGAGCISAVHDKI
A0A351FYP6      KSRYDYVFFDAPPIMGVSDASVLA--SAVDLCVLVVQYRKYPQLMTQRAKDMVIKVGGDL
A0A2E7ESJ6      RDQFDFVIVDTPPVLAVSDPMAVA--ARVDGVILTFRIHKRARPLALRARDALVTTGANV
A0A1G2YQB7      SRIFDHVIIDTPPILAAVDALLWS--SMVDGVIMTSLAGRTETPDLKESIERLKQININL
A0A353P687      SRIFDHVIIDTPPVLAAVDALLWA--SMVDGVILTSLAGHTETPDLKDTIERLKQINVNL
A0A356EME5      SQKYAYVVLDTPPILAASESLVLA--KAADASLVCAMQDVSRASQVRTACERLVAAGCRP
A0A355AI52      DGEYDQVIVDAPPVLAGTDAAAVG--RLCDGLMLVVRPEKNRRRVLIKAVETLRMLGVTL
A0A3L7SI46      ESAYDQILIDAPPVLAVTDPAIIG--RLVDGAVVVIRPDKNRRKLVLRAVESFRMSGVEV
A0A3L7P4E4      RDRYEWIIIDSPPVLAVTDSATLS--RLVDGVILVVRMNGRTRMGAVRAAETLRTLGANI
A0A3L7PEB5      RDRYEWIIIDSPPVLAVTDSATLS--RLVDGVILVVRMNGRTRMGAVRAAETLRTLGANI
A0A2N1UCJ3      THRYDRVIIDSPPVTSVADSQILA--AICDITILVIRAEKSTRKLAQQAREALAGIGARV
A0A517ZCB5      ETHYDQVLIDAPPSLAAADGQIIG--RMVDGAIMTVRPDKNRRRMVMRAVEALSELGCNV
A0A432MFP3      RRSFDVVIIDTSPVLPVPDALILG--RLADGAVIATRHDQSRFPAVERANGLLTGAGIPV
D5SZ21          ESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVRPDKNQRRSVIRAAETLRMWGNNL
A0A518CHE5      ETVYDQIIIDAPPILAVSDAGIVG--RLVDTLVLVMRPDKNRRGLVYRSVETLQMFGIHI
A0A257WS34      ETIYDQILIDAPPILAVADPAIIG--RMVDAALVIIRPDKNRRRMVVRAVKSFIGAGVQV
A0A2E8FLY0      ETVYDQILIDAPPALAVSDAAIIS--RQVDGGLLVVRPDKNRRRMVIRAAESMAAVEATL
A0A3D2U1E1      ESIYDQILIDAPPALAVTDAAIIS--RQVDGGLLVVRPDKNRRRMVVRATESLAAVGSTM
A0A1P8WP26      ETRYDQIIVDAPPVLAVSDPLIIA--RLVDGVVLVVRPDKDRRRMVIRAAEALHNVGSNL
A0A3L7V1F3      ETKYDQIIVDAPPVLAVSDPAIVG--RLVDAVILVVRPDKDRRRMVIRATETLQTLGCTL
A0A5B9QF68      DSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVRPEKNHRRSVIRAFESFQSVGCNV
A0A5B9QGF0      DSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVRPEKNHRRSVIRAVESFQSVGCNV
A0A5C6CK24      DSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVRPEKNHRRSVIRAVESFQSVGCNV
A0A2E8B0L9      ETHYDQVLIDCPPVMAASDAAVVG--RLVDGIMLVVQPEKNHRRLVLRAAEQLLSMGVNL
A0A5Q4GFE7      EANYDQVLIDCPPILAAADAAIIG--RLTEGLIVVIQPEKNHRRLVLRAIAGMSSMGVGL
A0A2E3GWX1      EGEYDQILIDAPPSLAVTDPAIIG--RLVDGVILTVRPDRNRRRMILRAAESLQSLGANL
F0SG60          EGEYDQILIDAPPSLAVTDPAIIG--RLVDGVILTVRPDRNRRRMILRAAESLQSLGANL
A0A2E9VST2      EGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVRPDRNKRRMIIRAAESVTSLGGNL
A0A356A6X2      EGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVRPDRNKRRMILRAAESVTSLGGTL
A0A5C5XLM3      EGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVRPDRNKRRMILRAAESVTSLGGTL
A0A3M1VCL4      ETTYDQILVDAPPALAVADPTAVG--RFVDGALLVIRPDKNRRKMVIRAAEAFRAVDVPL
A0A5C5V7Z9      EARYDQVLVDCPPVLAVSDAQIIG--RLVDGVVVVVTPEKNHRRLVVRACDSFLHAGCHV
A0A5C5YT05      EGRYDQVLVDCPPVLAVSDAQIIG--RLVDGVVVVVTPEKNHRRLVVRACDSFLHAGCHV
A0A518D7F9      DSRYDQVLIDCPPVLAVSDAQIVG--RLVDGVVLVVSPEKNHRRLVSRACESFLSAGVHV
A0A5C5ZIP0      DANYDQVLIDCPPVLAVSDAQIVG--RMVDGVVLVVSPEKNHRRLVARAYNSFLTAGVNM
A0A518KBK3      DSKYDQVLIDCPPILAVSDAQIAA--RLVDGVVLVVSPEKNHRRLVNRACGHFTSGGAPL
A0A5C6AKF9      DSRYDQVLVDCPPILAVSDAQIAA--RLVDGVVLVVTPEKNHRRLVTRACSHFSTGGAPL
A0A2E0X4J3      SEQFDRVIIDSPPVMPVADARVIA--AMSDATLLVLRAERATRRLCQAARNELWQVRAKR
A0A5C5YU10      KLQYDRIIIDSPPVMPVADSRVIA--SMSDAVLLVLRAEKSTRRLSLAARDELWRVRAQR
A0A517MPZ6      QQKYDKIVIDSPPVMPVADARVIS--AQTDATILVLRADCSTRRMSVAARDELWRVRAQR
A0A5C6CNV7      RLDYDKIVIDSPPVMPVADARVIA--AQTDATILVLRADRSTRRMSVASRDELWKVHAQR
A0A518K5H4      LRQYDQIVIDSPPVMPVADSRMIS--AMVDCSLLVLRAERSTRRISVGARDELLRVRTQR
A0A5C6AA28      SRHYDQIIIDSPPVMPVADARLIS--AMVDCSLLVLRAERSTRRISVSARDELLKVRTQR
A0A2E9VK20      KRDYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVRLHKNRRPSVKRALEMFEAHEIPL
A0A3D4PJK1      KRDYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVRLHKNRRPSVKRALEMFEAHEIPL
A0A0S8GZ23      SQRYDHVIIDTPPVLAVPDARLWA--RMADAVVLSSLAGQTESSDLKETLDLLSQINVKI
L0DC26          KEHYDFLVIDSSPVLPVADALLIG--QHVDAVIFSVMRDVSRIPTVHAAYERLSRLGIRM
A0A354PCQ3      LSHYSYVVIDTAPVLSAGETLAVA--STMEATLLCVMRDVSRLDSIHQTTRRLEAAGASV
A0A1I3DDV4      KSRFDMVLVDSGPVLLVSDPAIVS--QKCDIAMLVVRPAIDTKRKVFESIRRLTSSKSNL
A0A2E2N5A9      KTRYDRIVVDSPPTQGVSDAMVLA--AHAEALLFIVRSEVTSSTEVERGVAQLRQNATPV
A0A2E3GWC6      TREYDFVLVDSPPILAVSDPSITA--RSVDAMMLVVRMQKNNRPSIKRTLELLGSHGVNL
F0SLB0          TREYDFVLVDSPPILAVSDPSITA--RSVDAMMLVVRMQKNNRPSIKRTLELLGSHGVNL
A0A2E0SMM6      ETVYDQIIIDAPPILAVSDAGIVG--RLADTLILIMRPDKNRRGMVFRSIETLQMFGIHI
A0A1N6DAJ8      KEQYDFIVVDSSPVLPVADAMLIG--QHVDAVLFSIMRDVSRIPKVQEAYERLAKLGIRM
A0A5B9PJZ8      REQYDYILIDTPPLLAVTDPAIVC--RFVDLVYMVMRITNGVRSNSVRAKEVIDSMGVEL
A0A2S8G191      RQEYDYVIVDGSPILPVVDARLIG--QYVDGVVMAVLRDISRGVKVEEARELLNVFNVPF
A0A2E7EGG1      RDSYRYIVVDTPPVLAASESLVMA--RDADATLVCAMRDVSRENHVRMTYHRLLSVGARP
A0A225EH48      RGQFDFIVVDSCPVLPVADALLVG--QHVDGVVISILQDISQLPKVLTASEKLTQLNIPL
A0A3L7NDH9      ETTYDQIIVDASPVLAGTDAAAIG--RVCDGLVMVIRPEKNRRRIIVRSVQTLRAFGVNI
A0A518INW8      RQEYDFVFIDSPPLLAVADPLIIA--SLVDSVLLVVRVQKNGRRPVERSRELLASNKVKV
A0A518JPH9      RQDYDFVFIDSPPLLAVADPLIIA--AQADTVLMVVRVQKNGRRPVERSRELLTSNKIKV
A0A2E2CCW9      RKEYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKV
A0A3C0AGX3      RKEYDYVLIDTPPLVVVSDPSVIA--SMVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKV
A0A518AAQ5      RNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGIIRKVQQVIQTNGIRI
A0A517QBG9      RNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGIIRKVQQIIQTNGIRI
A0A518FTU3      RNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGIIRKVQQIIQTNGIRI
A0A2E7K7A9      RNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKI
A0A517PTS5      RNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKI
A0A517WHH5      RNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKI
A0A5A8BGT3      RNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKI
A0A517VTK3      RNDFDYVLVDTPPLAVVSDPSIVA--SSVDGVLLVVRVDKNRRGVIRKVQQIIQTNGINV
A0A517WQT4      RNDFDYVLVDTPPLAVVSDPSIVA--SSVDGVLLVVRVDKNRRGVIRKVQQIIQTNRINV
A0A517VID8      RNDYDYILIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKV
A0A517RK10      RNEYDYVLIDTPPLVVVSDPSVIA--STVDGVLLVVRLDKNRHGVIRKVQQIIQTNGIKV
A0A518IH18      RDAYDYVLIDTPPLVVVSDPSVIA--STVDGVLLVVRLDKNRRGVMRKVQQVIQTNGIKV
A0A5C5VEK8      KARYDRIIIDSPPVMPVADSRVIA--AMSDAVLLVLRAEKSTRSLSLAARNELWRVRTQR
A0A532UTJ0      SRKYDHVIIDTPPTLGFPDALMWA--KIGGAAILVSFAGHTTMPDLKEAKDRLAEINVKV
A0A517NSK8      AEEFDYVIVDSPPVLAVSDAAIIS--QKCDVTLLALRIVKNGRRIAHRAITLLRQHDANV
A0A5C5Z0D6      RSEFDFIIVDTPPVLAVSDATIVS--EETDAVLLTVRIVKNGRRSAKRARDILRQTGASI
M5UE94          RDKFDFIVVDTPPVLAVSDAAVVS--EEMDNVLLAVRIIKNGRKSAIRACDILQRSGSEV
A0A1P8WN28      VSEYDQVIVDCPPTLPVSDAAIVG--RYVDSMLFLMNPDKTHRRSVARAVDQLRSMGLKI
A0A3B9CTT0      VANYDQVMVDCPPSMPVSDAAIVG--RYVDGLLYLMNPATTHRSMISRTVDTLRSLDLTP
A0A5C5XLF4      KREYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVRLHKNRRPSVKRALEIFEAHEIPL
A0A2D5NDU9      CATYDRVIVDSSPMLPVADARILA--TKCDATVLAVSGGSTSTKNVSAAYDALTQVNATV
A0A286RGB6      REDFDFVIVDGSPVLPVADTRFIS--THTDGVVLSVVRDISRAPQLRAARQVLESFHVRV
A0A1V5N3W2      SQNYDHVIIDTPPVLAIPDALLWS--KMADAVVLSSLAGHSNLTDFQETFHRLSQLHVRI
A0A3E0MY27      RAEFDIIVIDTGPVLSVVDPLLIG--QHCDGAIVSVVRRVSQISNVYETCQRLQGTGIRL
A0A2E0X9P6      QRDYALIVVDTPPVLAASESLVLA--RAADAVVLCLLSDVSQSQQVRRAARCLDATGSRI
A0A286RLF2      VEHYDQVIIDSPPAPLASDTAIWG--RLADGVILVLQPEKNKRRAVIRAAEYLALLKIPL
A0A5C5ZM48      REDYDYVVIDTPPLLVASEALMLA--RAADASILCAMRDKSRGEQVREAGQRLQAAGVRL
A0A5B9WF77      RQTYEMIIIDSPPVLPVPDALALG--RWTDGALLATRFEVSRSPQVERARRQLDNAGIPV
A0A518BBX8      REKFDFVVIDTPPVLAVSDPSVVA--VRVDGVLLVLRLSKSGRHPAERAKELLSRHGVNV
A0A518ALT3      GKRFSTVIIDTPPVLSASEALVYA--KASDLVVYCSLSDVSRARQVRLATEKLEATGARI
A0A517MDV3      RQKYEYILIDSTPLLAVSESTSLG--QKVDGVVVALRTSNSSRPETERAVQRLQGVGVQA
A0A3M1QRP3      RERYDMVLLDCSPILPVADARILA--RLADGTIMVVRDGHSDRRDVLDAIQTLRSAGGTI
A0A517TMV0      DSRYDQVLLDCPPILAVSDAQIAA--RLVDGVVLVVTPEKNHRRLVSRACDSFLTSGTPL
A0A2E3RCU8      EGEYDQILVDCPPTLVASDAVLVG--RITDGMVIVVRPEKNRRKVVFRAAQNLSEMKIPV
A0A3E0MY88      ETHYDQILVDSPPVLAASDVMVIG--RIVDGLVLVINPAKNRRRLVTRAYESLRTMGVTV
A0A1C3E6N1      ESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVRPDKNQRRSVIRAAETLRMWGNNL
A0A518GJT2      ESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVRPDKNQRRSVIRAAETLRMWGNNL
A0A286RD13      RDQCDLVLVDSSPILTTADALILA--HVADSVVLSVIQDKSRLPRVFEAVQRLRSVDLPL
A0A517MLW3      ASRYDHVVLDCPPVLIANDVALVT--RLTDGLVLVVRPEKNSRRHVLRAIERLERFQTNV
A0A5B9QVD0      TTQYDQIVLDCPPVLVANDVALAS--RLADGLVLVVRPEKNSRRHVLRAIERLARFNTNV
A0A3B8PNV4      ESSYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVRPGTNRRRMVLRAAESITAIDADL
A0A3D1DR40      ESSYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVRPGTNRRRMVLRAAESITAIDADL
A0A2E7RYU8      ESAYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVRPGTNRRRMVLRAAESITAIDADL
A0A3B8LXG8      ESAYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVRPGTNRRRMVLRAAESITAIDADL
A0A350CI62      ETRYDQIIVDAPPVLAVSDPAIAG--RLVDAVVLVVRPDKDRRRMVIRAAETLRTLGCTL
A0A4P5WQK6      ETRYDQIIVDAPPVLAVSDPAIAG--RLVDAVVLVVRPDKDRRRMVIRAAETLRTLGCTL
A0A3C1X4W5      ETRYDQIVVDAPPVLAVSDPAIAG--RLVDAVVLVVRPDKDRRRMVIRAAETLRTLGCTL
A0A3D3W3A7      ETRYDQIVVDAPPVLAVSDPAIAG--RLVDAVVLVVRPDKDRRRMVIRAAETLRTLGCTL
A0A518DRX3      EIHYDQLLIDTPPILAASDAALAA--RHTDGILMVVQPVKNNRRLVMRAVDEIRALDLNL
A0A518DZF9      EIHYDQLLIDTPPILAASDAALAA--RHTDGILMVVQPVKNNRRLVMRAVDEIRALDLNL
F0SI78          RDKYDVIFIDSPPVLAVADATAIA--PLADSLLLVIKNSKHSRPHAKQARESLDLVGAPL
A0A518IQ30      EANYDQVLVDCPPVVAASDAAIIG--RFVDGLLMVVQPAKNHRKLVIRSVEQLAQLGVQL
A0A517LWP4      EANYDQVLVDCPPVVAASDAAIIG--RFVDGLMMVVQPAKNHRKLVIRSVEQLGQLGVQL
A0A518JNW8      EANYDQVLVDCPPVVAASDAAIIG--RFVDGLMMVVQPAKNHRKLVIRSVEQLGQLGVQL
A0A2E7ENQ5      CDHYDQVLIDTPPILAASDASIVS--RLTGGLVLIIQPSKNHRRLVHRAVDEIRAANLEL
A0A1G3AQE9      ESVYDQILIDSPPVLAASDTAVIG--RLTSGVVLVVQPAKNRRRAVMRCVENLSVLKIPL
A0A3L7UQT9      ETCYDQILVDAPPVLAVADPIIIG--RMVDAAVLVVRPDKNRRRMVIRAAEAFSAVEVNL
A0A4P5YBU2      ETCYDQILVDAPPVLAVADPIIIG--RMVDAAVLVVRPDKNRRHMVIRAAEAFAAVEVNL
A0A518AKT8      DSQYDQVLVDCPPVLAVSDAQIVG--RLVDGAILVVRPDKNHRRLVARACESFRNTGSQV
A0A5C5ZR72      RDRFDTILIDTPPVLGASEALSLC--RSADMTTLCALRGVSRSRQVKMAAEKLDSAGANL
A0A517TY85      REKFNTIIIDTPPILAASESLVFA--KAADLTVVCSLADVSRAKQVRVAVERLHATGANV
A0A5B9QEI7      RGSFDTILIDTPPVLSASDSLIYA--KAADLVLFSSLADISRAKQVRCAVERLQTTGANL
A0A5S9IJB5      EQKYDYVIIDCPPIAIVADGVSVS--KVCQTGLLVVKNFKTPAKAVHIAKDVLSSNQVKL
A0A1G2XVR0      RNRFDIIIFDTPPTMTVTDAVVLS--RNVDGVVFVIKSGQTPKELTRRALLQYKNSKSDL
A0A1G3B0P0      RNRFDIIIFDTPPTMTVTDAVVLS--RNVDGVVFVIKSGQTPKELTRRALLQYKNSKSDL
A0A1E3X4X0      RKMFDYVLLDSPPIMSVTDATILA--RLTDASLLLVKTGETNRDAVKRSIAQFNDINAKV
A0A286U4B3      MDRFDTVILDTPPAMAVTDTIVLS--NMVDGIIYVIKSGKISKESARRSLHQFAGKKAEV
A0A5C6DDS2      RERFDTVIFDTPPSLAVTDTVILS--NIVDGIIYVIKSGVVAKEAAKRSLSQFAGKKGEV
A0A0S8J591      AERYDSVIIDASPVLGVADANILS--TMVDCVVLVVQASKNRRGLVMRAKNQLASVNARL
A0A2E3GW02      RDKYDVIFIDSPPVLAVADATAIA--PLADSLLLVIKNSKHSRPHAKQARESLDLVGAPL
A0A1U9NL64      KAKYDRILLDAPPVMPVADARILA--AMCDVTLLVLRADSSTRNVSVAACEALAGVGARP
A0A5B9QNZ7      REKFDYVLLDSTPLLAVSESASIG--QRVDGVVLALRTANTSRPEAERAVQRLQSVGVEP
A0A1U7CZ81      RQMYDLIIIDSPPVLPVPDGLIMG--RWTDGAVLASRYDISRAPQVERARRQLTNAGIPV
A0A142YNY8      RQLYDLIIIDSPPILPVPDALIMG--RWTDGVVLTSRYDVSRAPQVERARRQLDLAGIPV
A0A1U7GLS6      RQLYDLIIIDSPPILPVPDALIMG--RWTDGVVLASRFDVSRAPQVERARRQLDLAGIPV
A0A1Z8N7H5      ETKYDQILVDCPPTLVASDAVLVG--RIVDGMVLIVRPDKNRRKLVXRAXQNLTEMKIPL
A0A1G2YPI3      SNKYDRIVIDSPPVMPVTDAQILA--AICDITLLVLRAEKSTRRNCLQAKHGLLSVGAHV
A0A532UIN2      SDRYDRVIIDSPPVMPVTDAQILA--AICDVTLLVLRAKKSTRKTSQQAKDGLSSVGAHI
A0A532UD06      PKCYDRVIIDSPPVLPVADSQIIA--ASCDVTLLVLRADKSTRRLSRQACDSLVSVGGHL
A0A660URN1      VQKYDRVIIDSPPVTPVADSQILA--AICDVTIMVLRAEKSTRRLSRHARDNLLSVGGHL
A0A0S8KNX5      SKKYDHVIIDTPPALGFPDALLWA--KVGDAVILTSFAGHTTMPDLKEATDRLAQINVRV
A0A3D3UVZ8      SRKYDHVIIDTPPALVFPDALMWA--KIGNAVILVSYAGHTTMPDLKEAKERLLQINVKV
E8R3W3          RGVFDFIIIDSAPVLPVSDTLLVG--RAVDAALFVVMRNQSRRDRVYDAYERLHRFGIPV
A0A517NFU9      SLHFDLVLIDAPPLLAVADPAIIA--PIVDSVVMTIRVSKNGRRPVEQATKILQDIGMQP
A0A5C5YWH4      TQRYDLVLIDAPPLLAVADPAIIA--PLVDAVVLTVRVNKHARGPVEQASKILQDQGLAP
A0A3D2TNK4      ESKYDRVIVDCPPVLAVSDAQIVG--RLVDGAILVVRPEKNHRRSVMRAVESFHATGCHV
A0A0J1B4A0      RKTYDVILIDTPPLLAVADPSIVA--DEVDGVFLAVRIEKNNRTLVERATEVLTDKGIAI
A0A142WSB9      RGRYDFVLFDSPPVLAVSDPCIIA--PQADAMLLVVRLEKNNRTVLRRACEQLDAHGIRL
M5SZR3          REDYDYVIVDSGPLLAVSDPRIVM--AHTDGLLLSVRLDKTTRKQAETAREILLSLDAPI
M5TW92          REDYDYVIVDSGPLLAVSDPRIVM--AHTDGLLLSVRLDKTTRKQAETAREILLSLDAPI
A0A2S8FKY2      RKSYDFIIVDAGPVLGSPSTRFLAQPQHVDGVILSIFKDVSQVAQVDDAKRILNSFGAPI
A0A517N8P6      RLQFDLIIIDTPPLLAVTDASNVA--TYADGVMVVMRIGRNIKPMSKRAITMLRMLHVNI
A0A432MJP4      RGEFDRVLIDTSPLLYVADPSIVA--PSADGVLLVLRPSEIRRAAMHRVAEVVQMMGTPL
M5UQ35          RSAFDVILIDTPPLLAVADPVIVS--EHVDGCLLAVRVAKNNRTIVQRAAEILDEHGSRA
A0A5C5WTY6      TEDFDLVLFDLPPVLAVSDAAVVL--PRLDASLLVSRVATNKRHQVINAAKRIDAAGGQW
A0A5C5Y033      SNHFDLVLVDLPPVLAVSDPAVVL--PRLDGAVLVVRVARIRREQLANALQRLQSTGANL
A0A5C6G1Y2      SNHFDLVLVDLPPVLAVSDPAVVL--PRLDGAVLVVRVARIRREQLANAMQRLQSTGANL
A0A354PDV6      KEKYDVVLLDLPPVLAVSDPLVVA--PKVSGVVVVFRAVTARKSEVANTLRRLSSAGAVT
A0A5C6FZ02      EERFDLVIFDLPPVLAVSDPLVVA--PRIDGMVLVIRAASARRDEVMNSLKRVTDAGGNM
M5TIT3          KTQFDLVLVDLPPVLAVSDPIVVM--PRLDGGILVVKIANVRRDEVVNTLHRVESAGGNF
A0A5M6CY44      KQEFDVILLDLPPVLAVSDPVVVL--PRIDGSVLVIRVSRARRDEVLNTMRRIRESGGNF
F2AXG2          REDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGGEM
M2BB46          KEDFDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGGEM
L7CLQ6          KEDYDLVLVDLPPVLAVSDPVVVL--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGGKM
A0A0J1B719      KEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGGEM
Q7UF18          KEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGGEM
A0A2G1W1E0      KEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGGEM
K5E235          KEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVKVANVRRDEVVNTLRRIDSSGGEM
A0A5C6FFI9      RRTYDLVLIDAPPVLAVADPSIVA--PLADGVILTVRIAKNGRRPVEQAGRILNDNGIVP
A0A3A0DET7      KTRYDRIVIDSPPVLPVADARVIA--AVSDATLLVLRAERSTRRSAIGARNELWRVHANR
A0A5C5WDJ1      CAKYDLVLIDAPPVLAVADPAIIA--PMVDSVLLTVRVIKNGRSIVEDAVRVLHDIQVEP
A0A5C5X547      QEQYDFVIVDCCPVLPVVDARIVS--EYVDGVILALTRDVSVVPDAISARDILRSHGATV
A0A2A2W9R6      RQSFDMVFIDSPPLLAVTDPAIIA--LHVDGCLLTVRIEKNNRTLVERAAEILRDQRVPI
A0A518HKC1      RQSFDMIFIDSPPLLAVTDPAIIT--LHVDSCLLAVRIEKNNRTLVERATEILRDQCVPI
A0A518L3P0      RQSFDMVFIDSPPLLAVTDPAIIT--LHVDSCLLTVRIEKNNRTLVERAAEILRDQCVPI
A0A255R1S0      REGCDLVFFDAPPVLAVADPAIIA--LHVDCVLMGVRIEKNNRTLVERAADILREQSTPA
A0A5B9MKP1      RQSFDMVFIDSPPLLAVTDPAIIT--LHVDSCLLAVRIEKNSRTFVERAAEILRDHHVPI
A0A0S8FY64      REQYDVVIFDSCPAMFVADAAPIA--SGCDGVVIVLKASKSRCKAADRARRQLAAVNGRI
A0A1N6KFT7      RNLYDMVVFDSSPLLAVTDPSILS--AVVDGVVLVVRPEATKRHDAERTVELLKTMESPV
L0DFG4          RNIYDMVVFDSSPLLAVTDPSILS--AMVDGVVLVVRPEATKRHDAERTVELLKTMESPV
A0A5C5XXG1      EERFDLVIFDLPPVLAVSDPLVVA--PRIDGMVLVIRAASARRDEVMNSLKRVTDAGGNM
A0A518BJJ1      TKSYDLVVFDLPPALAVADVETFA--HRLDAVLLLYRSDGLPREAVSLATTRLRQAGAKL
A0A518D182      LAEYDLVVFDLPPALVVADVEVFA--HRLDAIVLLYRAGGLPSRVVENTAKRMRASGAKI
A0A353FIP5      RGAYDYVFFDVPPVLAVADASSFL--NRLDAILLLVRFNLSSESEVAGACHRLKLAGAKT
A0A5B1CIK7      KEQYDLVIVDLPPVLAVSDPIVVM--SRLDGGVLVVRVANVRRDEVINTMRRIAASGGNF
A0A5C5WHS2      REMYDLVLVDLPPVLAVSDPIVVM--PRLDGGVLVVRVSRVRRDEVINTMRRIESSGGNF
A0A5C6B6G8      KQQFDVVLVDLPPVLAVSDPVVVM--PRLDGGVLVIRVARVRRDEVINTMRRIRSSGGNF
A0A5C5ZZN3      STQFDLVLVDLPPVLAVSDPVVVM--PRLDSGILVVRVANVRRDEVINTIRRIESAGGQF
A0A5C5XS91      RSQFDFVLVDLPPVLAVSDPVVVL--PRLDGAILVVRVSKVRRDEVVNTLRRVETAGGNF
A0A5C6C4E6      RSHFDFVLVDLPPVLAVSDPVVVL--PRLDGAILVIRVSKVRRDEVVNTLRRVETAGGNF
A0A2E1VVJ1      LSEYDRVLFDVPPVLAVADASAFL--HNLEAIFLLCRSNLLPEAVIEQATHRLRVSGAPA
A0A3M2AEL0      RGSFDYILFDIPPVLAVADASGFV--SQLDALFMLCRAGVVPEVVAASATKRIRLTGAKL
A0A532UT69      AKKYDRIVIDSPPVVHVADAQILA--ATSDVTLLVLRADKSTREASRRACASLSSVGAHI
A0A2D5AWU0      RKKYDCIVVDSPPILESSESRVMA--SEVDLCIFVTRLCVSTSPNAIRALGILRGVDARV
M5RT57          RAQYRYIVIDTPPILSASEAILLA--RCADGSLLCTRRNVSREGQVKIAHDRLTKAGIKP
A0A356KTN1      RRRFDRIVIDSPPVVAVSDATLMA--QAADAVIQVVSARTSSRSAATQANTELSRLGAAP
A0A518HFS8      RGRYEFIIVDSAPALIVTDTLMLS--QHVDAALLSVLRLVSRAPDVGEAYERLATLGVRI
                      :..*  *     .                                         

A0A5S9IPR9      SGLILNDVKGS-----------------------------YSSQLSYYNYYGLYYSKSYY
A0A533Q9U4      LGVVINDVDFSRDKYYYQYY--------------------YQYYYH--------Y-----
A0A1U9NNE1      LGTVLNGVHTAHSY--------------------------NKYGYR--------Y-----
A0A2G2JCA2      MGTVLNGVSASYYS-----------------YHYGH----YGYNHA--------------
A0A533Q6B7      LGVVINDLDFSDE---------------------------YRYHY---------Y-----
A0A351FYP6      VGVVLNNINISQDS---------------YYYYYSG----YYYDYY--------Y-----
A0A2E7ESJ6      IGVVVNGVDHETSS--YYSE---------YKYGYAG----YRYGYN----SR--Y-----
A0A1G2YQB7      IGIVLSNVSYNKVY--------------------------YRYGHDY-------Y-----
A0A353P687      LGIVLSNVKYNQIY--------------------------YPYGYGY-------Y-----
A0A356EME5      VAAVLNGVSSRRYE--------------------------YSYGY---------Y-----
A0A355AI52      FGTIVNAVGLEEMG---------------YGYGY-G----YGYGYG----YGDEY-----
A0A3L7SI46      IGIVANHIGSKSNS------------------EY-G----YGYGYS----YG--Y-----
A0A3L7P4E4      LGLIANGIDPTKHG---------------------G----YGYQYGV---YG--A-----
A0A3L7PEB5      LGLIANGIDPTKHG---------------------G----YGYQYGV---YG--A-----
A0A2N1UCJ3      LGAVVNDVSPKHSR-----------------YGYYSHYSYYGYGYG--------Y-----
A0A517ZCB5      YGLIVNHVSPQSDS------------------EY-S----YGYGYG----YG--Y-----
A0A432MFP3      LGVVVNGARTSDRR---------------FGTGYAT----YTYRSDRISDPG--------
D5SZ21          LGLALNNMSSDRAG------------------GY-G----YGYGYG----YG--Y-----
A0A518CHE5      SGIVVNHLTPDQGS------------------DYYG----YGYGYGYSEDYG--HEESTG
A0A257WS34      VGIAANHLANSPSQ------------------DY-G----YGYGYGYG--YG--Y-----
A0A2E8FLY0      IGAVINHIADTAGS------------------EYYG----CGYEYD--------S-----
A0A3D2U1E1      LGAVINHVTAEAGG------------------DYYG----YGYGFE--------Y-----
A0A1P8WP26      LGVVVNHLSGSEAE------------------GY-G----YGYGYG----YG--Y-----
A0A3L7V1F3      LGVVINHLTTTDTD------------------GY-G----YGYGYG----YG--Y-----
A0A5B9QF68      LGVVANALSDESQS-----------------YGYGG----YGYGYGYGSDYGSDY-----
A0A5B9QGF0      LGVVANALSDESQT-----------------YGYGG----YGYGYGYG--YG--Y-----
A0A5C6CK24      LGVVANALSDESQT-----------------YGYGG----YGYGYGYG--YG--Y-----
A0A2E8B0L9      IGVVPNRVGDDSSG---------------YYGGY-G----YGYGYGYG--YD--D-----
A0A5Q4GFE7      IGIVANRIRHESGG---------------GYFGYGG----YGYGYGYG--YR--D-----
A0A2E3GWX1      LGVVVNRLSDSSGE-----------------YSY-G----YGYGY--G--YG--Y-----
F0SG60          LGVVVNRLSDSSGE-----------------YSY-G----YGYGY--G--YG--Y-----
A0A2E9VST2      LGVVVNGLSDSRGE-----------------YGY-G----YGYGYGEG--YG--E-----
A0A356A6X2      LGVVVNGLSDSRGE-----------------YGY-G----YGYGYGEG--YG--E-----
A0A5C5XLM3      LGVVVNGLSDSRGE-----------------YGY-G----YGYGYGEG--YG--E-----
A0A3M1VCL4      LGIVVNNVSAEDGD---------------GYYGY-G----YGYGYGYG--YG--Y-----
A0A5C5V7Z9      HGVVANRISNKSEG------------------GY-G----YGYGYGQQ--YG--Y-----
A0A5C5YT05      HGVVANRISNKSEG------------------GY-G----YGYGYG----YG--Y-----
A0A518D7F9      LGVVANRITQGGGH------------------GY-G----YGYGYG----YG--Y-----
A0A5C5ZIP0      VGVVANRISEQAGK------------------GY-G----YGYGYG----YG--Y-----
A0A518KBK3      VGVVVNRVSDQIGK------------------GY-G----YGYGYG----YG--Y-----
A0A5C6AKF9      LGVVANRISEQAGK------------------GY-G----YGYGYG----YG--Y-----
A0A2E0X4J3      LGVVVNGVPMRGAG------------------SY-G----YGGGY-GY--GG--Y-----
A0A5C5YU10      LGIVVNAVPQSKGG------------------SY-G----YGYGYG--------Y-----
A0A517MPZ6      IGIVVNAVPGRKQA------------------NY-S----QGYGY-GY--GN--Y-----
A0A5C6CNV7      IGVVVNAVPARQQS------------------SY-S----SGYGYGGY--GA--Y-----
A0A518K5H4      LGVVVNAAPIHRSN------------------------------FGGY--SG--Y-----
A0A5C6AA28      LGVIVNAAPLHRAS------------------------------YGGY--YA--Y-----
A0A2E9VK20      LGVIANGLQDASGD--------------------------YQYRGG----YG--G-----
A0A3D4PJK1      LGVIANGLQDASGD--------------------------YQYRGG----YG--G-----
A0A0S8GZ23      LGNVLCNVSPSSSH--------------------------YRYRYG----YG--Y-----
L0DC26          LGAIVTG--EQTDH--------------------------YGSSYP----SV--S-----
A0A354PCQ3      IGTVFSGV-TSRQY----------------VYRYGD----YQYALS----GG--D-----
A0A1I3DDV4      RGCILNTY-GSSKEFTRDSG---------YYSSYNY----YGYGYG----YG--Y-----
A0A2E2N5A9      DWVILNQV-DIKKAERHGYR---------YSSYYDY----YQYGSG----SP--S-----
A0A2E3GWC6      MGVIANGVEATGGE--------------------------YSYRGG----YG--G-----
F0SLB0          MGVIANGVEATGGE--------------------------YSYRGG----YG--G-----
A0A2E0SMM6      SGVVVNHLTPDQGG--------------------EY----YGYGYG----YG--Y-----
A0A1N6DAJ8      LGAIVTG--EKSDH--------------------------YGSKYE----YS--A-----
A0A5B9PJZ8      SGVIINGLRRRDQKTYDYKG---------GKYGYGG----YTYGGG----YG--S-----
A0A2S8G191      LGAVVVGI-TKEDV--------------------------YNYTSQ----RN--R-----
A0A2E7EGG1      VGTVLNGV-PTRQY----------------ARRYGT----YGYETA----SS--Y-----
A0A225EH48      LGAVVNGI-KPDIH---------------------A----YGYNYV----KQ--L-----
A0A3L7NDH9      FGAVINGV-GIEAD------------------GYG-----YGYGYG----YG--Y-----
A0A518INW8      AGVIVNGG-ERADK----------------HFGYGE----YVKPYE----YG--Y-----
A0A518JPH9      AGIIVNGA-ERGDK----------------NFGYGE----YVKPYE----YG--Y-----
A0A2E2CCW9      AGILANSV-KSGKP--------------------GD----YDYGSG----PG--Y-----
A0A3C0AGX3      AGILANSV-KSGKP--------------------GD----YDYGSG----PG--Y-----
A0A518AAQ5      TGLIANNV-ITNSL--------------------AG----YDYIDS----EG--Y-----
A0A517QBG9      TGLIANNV-ITNSL--------------------AG----YDYIDS----EG--Y-----
A0A518FTU3      TGLIANNV-ITNSL--------------------AG----YDYIDS----EG--Y-----
A0A2E7K7A9      TGLIANNV-ITNSL--------------------VG----YDYIDN----EG--Y-----
A0A517PTS5      TGLIANNV-ITNSL--------------------VG----YDYIDN----EG--Y-----
A0A517WHH5      TGLIANNV-ITNSL--------------------VG----YDYIDS----EG--Y-----
A0A5A8BGT3      TGLIANNV-IINSL--------------------VG----YDYIDS----QG--Y-----
A0A517VTK3      TGILANGI-YNGKS--------------------GK----YRYRGG----EG--Y-----
A0A517WQT4      TGILANGI-YNGKS--------------------GK----YRYRGS----EG--Y-----
A0A517VID8      TGILANGV-QSGKL--------------------GD----YDYGSG----PG--Y-----
A0A517RK10      TGVLANGI-FSGRY--------------------GE----YDYGAG----EG--Y-----
A0A518IH18      TGILANGI-FSGRY--------------------GE----YDYGAG----EG--Y-----
A0A5C5VEK8      LGVVVNAV-PQSRG--------------------SS----YGYGYA----YG--G-----
A0A532UTJ0      LGTVLSSV-DAG----------------------------HGYYRH----HG--Y-----
A0A517NSK8      VGLVINGY-QSSNKNYGYIE---------K-YDSDS----YGYGYG----PT--S-----
A0A5C5Z0D6      AAIVVNGY-QTKDRSYGYTG---------G-YDAEA----YGYGYG----ET--H-----
M5UE94          GAIIVNGY-QSKDKKYGYTG---------G-YDADA----YGYGYG----ES--H-----
A0A1P8WN28      VGIVANTS-LSEDTS---------------SYGYQ-----YGYGYG----ND--Y-----
A0A3B9CTT0      VGVVVNMG-LSSEKEGQGYG---------YGYGYG-----YGYGYE----SQ--Y-----
A0A5C5XLF4      LGVIANGL-QDGSG---------------DYQYRGG----YGGGYD----KK--S-----
A0A2D5NDU9      LGIVLNNM-PKMKG-------------------EVA----YSYGYG----YG--G-----
A0A286RGB6      LGAVMTGS-AEDVY--------------------------YAYPYH----SP--I-----
A0A1V5N3W2      LGNVLANV-AARHS-------------------YNR----YGYGYG----YG--Y-----
A0A3E0MY27      LGSVVNGV-SGSQV------------------SVGY----YGYGYG----YE--D-----
A0A2E0X9P6      AGAVLSGV-PMRRYTYAYDY---------RPRAAAD----YGSGEA----F---------
A0A286RLF2      LGIVINRL-SNEKE-----------------KDYSG----YSGDYY----GQ--P-----
A0A5C5ZM48      AGVVLNGV-PAKQ---------------------------YATRYG----QP--Y-----
A0A5B9WF77      LGTVINGL-RSSDS------------------YYGR----YTY-----------------
A0A518BBX8      IGVVVNNS-DRGTR-----------------YGYGG----YGYAYS----YG--N-----
A0A518ALT3      AGTVLSGV-STKSY----------------VYAYGR----YASLQG----QA--------
A0A517MDV3      VGFVVNDI-DRLAK----QG---------DEVDAG-----YGYEYG--------------
A0A3M1QRP3      LGSVFNGV-PSRGG----------------YYYHGS----YGYGSA----AR--N-----
A0A517TMV0      LGVVANRI-TEQAG-----------------KGYG-----YGYGYG----YG--H-----
A0A2E3RCU8      YGLVANCI-KAENG-----------------KGYN-----FGEGEG----YG--Y-----
A0A3E0MY88      LGIVANRI-DQDQS-----------------KGYG-----YGYGYT----YS--Y-----
A0A1C3E6N1      LGLALNNM-SSDRA-----------------GGYG-----YGYGYG----YG--Y-----
A0A518GJT2      LGLALNNM-SSDRA-----------------GGYG-----YGYGYG----YG--Y-----
A0A286RD13      LGIVLHGT-APSRY----RS---------YYRSYT-------------------------
A0A517MLW3      LGMVINAM-DASTA-----D---------GA--YG-----YGYGYG----YG--Y-----
A0A5B9QVD0      YGLVINGL-DSASS-----D---------RAYGYG-----YGYGYG----YG--Y-----
A0A3B8PNV4      LGVVINNV-DSDTG-----------------GDYDG----YGYEYG--------------
A0A3D1DR40      LGVVINNV-DSDTG-----------------GDYDG----YGYEYG--------------
A0A2E7RYU8      LGVVINNV-DSDTG-----------------SDYDG----YGYEYG--------------
A0A3B8LXG8      LGVVINNV-DSDTG-----------------SDYDG----YGYEYG--------------
A0A350CI62      LGVVVNHL-NVDDA----GG---------YGYGYG-----YGYGYG----YG--Y-----
A0A4P5WQK6      LGVVVNHL-NVDDA----GG---------YGYGYG-----YGYGYG----YG--Y-----
A0A3C1X4W5      LGVVVNHL-NLDDA----GG---------YGYGYG-----YGYGYG----YG--Y-----
A0A3D3W3A7      LGVVVNHL-NLDDA----GG---------YGYGYG-----YGYGYG----YG--Y-----
A0A518DRX3      IGVIANRI-DVAQA--------------------GY----YGYGYG----YG--Y-----
A0A518DZF9      IGVIANRI-DVAQA--------------------GY----YGYGYG----YG--Y-----
F0SI78          EGMVVNLV-CEETSYRYEGG---------H-YRRGM----YGSNYN----YG--T-----
A0A518IQ30      TGIILNRV-DDSTA----GS---------Q-FGYG-----YGYGYG----YG--Y-----
A0A517LWP4      TGIILNRV-DDSVS----GG---------Q-FGYG-----YGYGYG----YG--Y-----
A0A518JNW8      TGIILNRV-DDSVS----GG---------Q-FGYG-----YGYGYG----YG--Y-----
A0A2E7ENQ5      IGVVINRI-SDDGD----SA---------YGYSYG-----YGQGYG----HG--Y-----
A0A1G3AQE9      LGIVLNRI-GSEKE----GG---------Y-YGYG-----YG-GYG----YG--Y-----
A0A3L7UQT9      MGVVVNHL-SSDSS----GD---------Y-YGYG-----YGYGYG----YG--Y-----
A0A4P5YBU2      LGVVVNHL-SSDSS----GD---------Y-YGYG-----YGYGYG----YG--Y-----
A0A518AKT8      LGVVANDV-SDM-H----GS---------G-YGYG-----YG------------------
A0A5C5ZR72      AGAALSGV-APMGY----GS---------V-YAYG-----YG------------------
A0A517TY85      AGAVLSGV-SPSHY---------------V-YNYGA----YG------------------
A0A5B9QEI7      AGVVLSGV-SVNRY---------------V-YHYGS----YG------------------
A0A5S9IJB5      SGIILNNMEVPK-----------------GRYYNSG----Y-YNYG--------Y-----
A0A1G2XVR0      LGIILNLVDVSK-----------------GGYYSYY----YSHYYK--------Y-----
A0A1G3B0P0      LGIILNLVDVSK-----------------GGYYSYY----YSHYYK--------Y-----
A0A1E3X4X0      LGVVMNNVDLSK-----------------GSYYYHY----YQYYYR--------Y-----
A0A286U4B3      LGVVINSVDAAR-----------------GDF----------YGYG--------Y-----
A0A5C6DDS2      LGVVMNSVDVAK-----------------GGYYQYG----YQYGYQ--------Y-----
A0A0S8J591      AGAVLNNV---------------------RGTKGDY----YYYRQR--------Y-----
A0A2E3GW02      EGMVVNLVCEETSYRYEGGHYR-------RGMYGSN----YNYGTN--------Y-----
A0A1U9NL64      LGVVVTAPGKK------------------MSKYGYG----YGYGYG--------Y-----
A0A5B9QNZ7      LGFVVNDIDYLSRQGD-------------EGKYGYG----YHYGAG--------G-----
A0A1U7CZ81      LGTVINGMKS-------------------SDAYYGR----YSYSR---------------
A0A142YNY8      LGTVINGMRT-------------------SDSYYGR----YSYSRP--------G-----
A0A1U7GLS6      LGTVINGMRT-------------------SDSYYGR----YTYSR---------------
A0A1Z8N7H5      FGLVANGVGAENNKGYSFGE---------GEGYGYG----YGYGDD--------E-----
A0A1G2YPI3      LGVVVNDVPK-------------------KGHYG--------YYGS--------Y-----
A0A532UIN2      LGALVNDVQG-------------------NGRYG--------YYNG--------Y-----
A0A532UD06      LGAVVNDVKHKRGRYSY------------YNYSGYG----YDSGYD--------Y-----
A0A660URN1      IGVVVNDVSQRSGRYGY------------GRYGQYG----YYGYCS--------Y-----
A0A0S8KNX5      LGTVLSSVQAE------------------HSYYRHG----HSYYAQ--------S-----
A0A3D3UVZ8      LGTVLSSVQAE------------------HSYYRHG----HSYYAQ--------S-----
E8R3W3          LGTVVTAATS---PKRYGYDP--------YGYYSYG----YTYYYQ--------H-----
A0A517NFU9      SAVIVNGVDQDAKSYGY------------GNYQRDR----YGYVGH--------Y-----
A0A5C5YWH4      AAIVVNGVDQSSKSYGY------------GSYSAGK----YAYVGD--------Y-----
A0A3D2TNK4      FGVVANGLSSDSSGY--------------GYGYGYG----YSYDGG--------Y-----
A0A0J1B4A0      EGVIVNSRDSRSNHYAYSSY---------DYYGKKQ----YGYVAN--------Y-----
A0A142WSB9      LGVIANDAAA---STQTEGS--------------------YGNYEE--------Y-----
M5SZR3          VGIVANCVRT---SELDALG---------RARYG------YGAYEG--------Y-----
M5TW92          IGIVANCVRT---SELDALG---------RARYG------YGAYEG--------Y-----
A0A2S8FKY2      IGTVLSGYSS-------------------GMYYS--------YTNR--------S-----
A0A517N8P6      IGLVINAVGDSGYSATYSQAWSDSYGGQPGGEYGHS----Y-YRYG--------S-----
A0A432MJP4      LGSVVNADGSD--DAQFLHA---------GRYYG-----------R--------Y-----
M5UQ35          MGVVINTQSPRSGDYGYSSY---------NYYGKKE----NGYVAS--------Y-----
A0A5C5WTY6      IGALLNIVQA---PKEFHEQ---------G----------YGYQSD--------S-----
A0A5C5Y033      IGSMLNVVGA---DKEFDAG---------VSQYG------Y-YRND--------Y-----
A0A5C6G1Y2      IGSMLNVVGA---DKEFDAG---------VSQYG------Y-YRND--------Y-----
A0A354PDV6      VGSVLNTLGA---QKEFSSD---------GGYYG------Y-YRSG--------Y-----
A0A5C6FZ02      VGCVLNTFGA---GKSFDLG---------GGYYG------Y-YESG--------Y-----
M5TIT3          VGCMINAFGS---GKKFDSD---------GGYYG------Y-YKSD--------Y-----
A0A5M6CY44      VGWMLNSLGA---GTKFDSA---------GGYSG------Y-YESD--------Y-----
F2AXG2          LGCMLNAFGA---GKKFDSD---------GGYYG------Y-YKSD--------Y-----
M2BB46          LGCMLNAFGA---GKKFDSD---------GGYYG------Y-YKSD--------Y-----
L7CLQ6          LGCMLNAFGA---GKKFDSD---------GGYYG------Y-YKSD--------Y-----
A0A0J1B719      LGCMLNAFGA---GKKFDSD---------GGYYG------Y-YKSD--------Y-----
Q7UF18          LGCMLNAFGA---GKKFDSD---------GGYYG------Y-YKSD--------Y-----
A0A2G1W1E0      LGCMLNAFGA---GKKFDSD---------GGYYG------Y-YKSD--------Y-----
K5E235          LGCMLNAFGA---GKKFDSD---------GGYYG------Y-YKSD--------Y-----
A0A5C6FFI9      LALIVNGVDAG--KRSSYGY---------GGYRANE----YAYVGK--------Y-----
A0A3A0DET7      LGVVLNSVPLR--KQAAYGY---------GDPYGYG----YGHQYG--------Y-----
A0A5C5WDJ1      TAVIVNGVDKN--ALRSYQY---------GGYGQNK----YGYVGR--------Y-----
A0A5C5X547      IGTIVSGHPVRGRYDLYN------------------------------------------
A0A2A2W9R6      DGVIVNGRDSRRRSYGYSSY---------NYYGKGE----YGYVDS--------Y-----
A0A518HKC1      DGVIVNGRDSRRRGYGYSSY---------NYYGKGQ----YGYVDG--------Y-----
A0A518L3P0      DGVIVNGRDSRRRGYGYSSY---------NYYGKDQ----YGYVDG--------Y-----
A0A255R1S0      EAVIVNGRAS-RRGYGYTGY---------NYYSKKE----YGYVST--------Y-----
A0A5B9MKP1      DGVIVNSRDSRRRGYGYSSY---------NYYGKGQ----YGYVDS--------Y-----
A0A0S8FY64      IGAVLNDVRPKTLRRYGSYG---------YYYYDYH----R-YYKD--------Y-----
A0A1N6KFT7      LGFIVNGIDR---QNASGYG---------QGYGY------G-YGYG--------Y-----
L0DFG4          LGFIVNGMDR---QGTGSYG---------QGYGYGQ----G-YGYG--------Y-----
A0A5C5XXG1      VGCVLNTFGA---GKSFDLG---------GGYYG------Y-YESG--------Y-----
A0A518BJJ1      VGCVMNAHRA---DRS-SAS---------DRYQG------D-YGYG--------Y-----
A0A518D182      VGLVMNACRP---EKA-KGA---------GAYSD------Y-YKAR--------S-----
A0A353FIP5      LGAVLNGQKG---GDEKDY---------------------Y-YEEG--------R-----
A0A5B1CIK7      VGCVLNAFGS---GQKFNVQ---------GGYYG------Y-YQSD--------Y-----
A0A5C5WHS2      VGCMLNAFGA---GKKFNVE---------GGYYG------Y-YRSD--------Y-----
A0A5C6B6G8      VGCMLNALGA---GANFDGA---------GGYYG------Y-YRSD--------Y-----
A0A5C5ZZN3      AGCMLNAFGA---GKKFDGG---------GGYHG------Y-YKSD--------Y-----
A0A5C5XS91      VGCMLNTYGA---AKAFDAD---------GGYYG------Y-YRSD--------Y-----
A0A5C6C4E6      VGCMLNTYGA---SKAFDAD---------GGYYG------Y-YRSD--------Y-----
A0A2E1VVJ1      IGAILNGHRPSRLQRDYSSY---------GYGYG------Y----S--------Y-----
A0A3M2AEL0      MGCILNGVRAPRLGR-YSRY---------GYSYG------Y----A--------Y-----
A0A532UT69      LGVVVNNV-----------------------SKKNS----YGYYGG--------Y-----
A0A2D5AWU0      VGTFVNDDSAKKTNAYA------------GGIAYGA----FRKVEA--------L-----
M5RT57          LGTVLNGV---PTRSYA--------------KTYGS----YDYARR--------F-----
A0A356KTN1      VGLIFNQQPQDEAGAYF--------------YYYSR----YGYGGE--------P-----
A0A518HFS8      LGAVVSGVRDDPN------------------LSDDR----YHYLSG--------V-----
                                                                            

A0A5S9IPR9      TRGLNKNPLGRNSKINPLVDNTKKS-----------------------------------
A0A533Q9U4      --GEKEAKEA--------------------------------------------------
A0A1U9NNE1      --YKASSSPADKNGPTRNRPLLLTSGN---------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      --DKKERYYQKA------------------------------------------------
A0A351FYP6      --KSRETEEEPVEDKKDGKEEKLIAQADAAGEDVNP------------------------
A0A2E7ESJ6      --GEYSSDAQEQKAISKYYDDESSQTLQHESPYQS-------------------------
A0A1G2YQB7      --GKPATVKELKQNLPSENTSEKVKQQV--------------------------------
A0A353P687      --GKTNVIKDVKQEPADNIVIPEVK-----------------------------------
A0A356EME5      --ESVEE-----------------------------------------------------
A0A355AI52      --GLDDDGEYGDEEEEENYMRAA-------------------------------------
A0A3L7SI46      --GHDDRSDTTTEATDDEYEVKTPMAA---------------------------------
A0A3L7P4E4      --GGRASKYYAEAPNKR-------------------------------------------
A0A3L7PEB5      --GGRASKYYAEAPNKR-------------------------------------------
A0A2N1UCJ3      --GRKKE-----------------------------------------------------
A0A517ZCB5      --GEHDNDADEDAQTLPAGPKFVSPEQLRKSA----------------------------
A0A432MFP3      --GGVSGS----------------------------------------------------
D5SZ21          --GHTDTDGDHDDLLDDHASSHSSYSSRTAA-----------------------------
A0A518CHE5      EDGYDEDGYGDGNYQKEPAILGYTSPDSGQDAGYEDDDYETNPYQAA-------------
A0A257WS34      --GHDDAIEDPALAAMEDDDGYRIAA----------------------------------
A0A2E8FLY0      --KEDEE----LKQAA--------------------------------------------
A0A3D2U1E1      --GSGEESSDGLKQAA--------------------------------------------
A0A1P8WP26      --EENDTHPTDERRQPSHNQADVAVSLSMIGSGPEPEDS--ADKKAA-------------
A0A3L7V1F3      --GYGHENEHEEQPER-----DVASGLSALASGKSREADLRERNRAA-------------
A0A5B9QF68      --GNDEEAFEEEVSDADEPQESIPDPATKRSRTPRRKQGPTEPIRPRRAA----------
A0A5B9QGF0      --GHDEEEFGDE--VADEPLETIPHPSTKMSVTPRRKTSPTDPIRPRRAA----------
A0A5C6CK24      --GHDEQDFEDV--DADSEELIVPHPATQVGVSLRRKETSTDPIRPRRAA----------
A0A2E8B0L9      --GYGM-------------------DEEDEDDIQTSASDSIQPRRAA-------------
A0A5Q4GFE7      --GYGQPADEARIDQDRFASGETDWSDEEDSDVPPGAP---HPRNAA-------------
A0A2E3GWX1      --GHEDPVQDQPAAWSDFYDA----EPERQKKERKRFSRKAA------------------
F0SG60          --GHEDPVQDQSAAWSDFYDA----EPERQKKERKRFSRKAA------------------
A0A2E9VST2      --GHDDPTHDDE---EEAIPM----TQSNSHRPRKRFSRDESSDRYAA------------
A0A356A6X2      --GHDDPTNEVE---EEAIPI----SNNNSQRPRKRFSRDQSSDRYAA------------
A0A5C5XLM3      --GHDDPAYEGE---EEAIPI----SNNNSQRPRKRFSRDQSSDRYAA------------
A0A3M1VCL4      --GYAESDD-------------------EEHDGKRRSGRGKRAKKAA-------------
A0A5C5V7Z9      --GHTEEEE-LAPVAAPPTSP----VDPDPRDWRRLGGDDADPARAA-------------
A0A5C5YT05      --GHSDEEERVEEKVEHDLSP----VEPAAASWRRPTEGPADADRAA-------------
A0A518D7F9      --GHDEPDT--------------------------EDDTPIAPLRAA-------------
A0A5C5ZIP0      --GHTETND--------------------------EILENNAPGKAA-------------
A0A518KBK3      --GHEEEEH--------------------------VSHADENRPMAA-------------
A0A5C6AKF9      --GVDEADH--------------------------DEPNDRSLPVAA-------------
A0A2E0X4J3      --GY--GGYGDPVADEPLPSG----RRKKSRVIEPVAAETE-------------------
A0A5C5YU10      --GY--GNYGEVAYGHEDQRS----LGNRKKRLIQARPETPAVVEQT-------------
A0A517MPZ6      --GHSSGTYGDLAYGEPEPPV----DISRRKKSRARSQQLPSPEATSEAMEPLDI-----
A0A5C6CNV7      --GHAGGSYGESAYQLDAYPA----N-GRRQKGLAISAKAETPSTDPAETSEIST-----
A0A518K5H4      --GY--GSYGQVAYGHEDAAE----ARPAVRRRLKSMADEDLTSIDG-------------
A0A5C6AA28      --GY--GSNGQVAYGGEVAPE----PAPSRRRLLKQDLEPELGAVDS-------------
A0A2E9VK20      --GYDKKSPYQQTNDIPEFLAPTQAVIPS-------------------------------
A0A3D4PJK1      --GYDKKSPYQQTNDIPEFLAPTQAVIPS-------------------------------
A0A0S8GZ23      --GYGRRRGDGNNDKRKRPKPKTLLISGPGSK----------------------------
L0DC26          --RTDKR-----------------------------------------------------
A0A354PCQ3      --IHDDEFSDDNVSLGKGG-----------------------------------------
A0A1I3DDV4      --GNRGYGRRVKDNGSAETENGHSLAGSTPAGRK--------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A2E3GWC6      --GYARQQPAKPTTPPPILTKQ--------------------------------------
F0SLB0          --GYARQQSAKPTTPPPILTKQ--------------------------------------
A0A2E0SMM6      --NEDYGHEDTQAEQGYGDDGYGDDGYVGDGHADDGYRHAPATLEYANYDQQYESGYEDD
A0A1N6DAJ8      --RTRESV----------------------------------------------------
A0A5B9PJZ8      --SYGKNYSGNAPTPAANTPSHQPPIPNLVDAKSSSKSRN--------------------
A0A2S8G191      --KKQLVHVES-------------------------------------------------
A0A2E7EGG1      --SADQEEVT--------------------------------------------------
A0A225EH48      --PA--------------------------------------------------------
A0A3L7NDH9      --GTPYGDEVEEESIDDAFVTDDALAD---HEDSNVDDGSDPGVEDRVLPMNPRSGTSSR
A0A518INW8      --ATQYTRSYASKPNERPVASSSV------------------------------------
A0A518JPH9      --ATQYTKSYSSKPQPRPVSSASV------------------------------------
A0A2E2CCW9      --SDYYIVPPQAQAKQADVPAKTKITH---------------------------------
A0A3C0AGX3      --SDYYIVPPQAQAKQADVPAKTKITH---------------------------------
A0A518AAQ5      --QEYFQGPAQKTASPVAKPARTEVTS---------------------------------
A0A517QBG9      --QEYFQNPAQKTETPVEKPARTEVTS---------------------------------
A0A518FTU3      --QEYFQNPAQKTATPVEKPARTEVTS---------------------------------
A0A2E7K7A9      --QAYFEKPAPEPAKPAANPAKTEVTS---------------------------------
A0A517PTS5      --QAYFEKPAPEPAKPAANPAKTEVTS---------------------------------
A0A517WHH5      --QAYFEKPEPQTTKPAANPAKTEVTS---------------------------------
A0A5A8BGT3      --QAYFEKPAAQDKKSAVNPVKTEVTS---------------------------------
A0A517VTK3      --HDYYLTPQQNNSPEPTVSVHTEVPG---------------------------------
A0A517WQT4      --HDYYLAPQQNNSPEPTVSVHTEVPG---------------------------------
A0A517VID8      --SDYYIVPSQVQAKQADATAKTKITQ---------------------------------
A0A517RK10      --QEYFEAQPKKKIRQPAVPVNSDITG---------------------------------
A0A518IH18      --QEYFEAQPKKKTTQPVVPANTEITS---------------------------------
A0A5C5VEK8      --YGAYGEIAYGHEEDATLS----------------------------SRKKRLIKSRPA
A0A532UTJ0      --YTQSAQSREAAVGHKRKLMFSMEEGADDGKDSETPDGGVTTDV---------------
A0A517NSK8      --GGYYRSADATAETVKVSSRDAEEAPVAAGSRV--------------------------
A0A5C5Z0D6      --KAYYRESKKGSRPLQSTSS---------------------------------------
M5UE94          --KAYYGE-KSAPFDLQSVS----------------------------------------
A0A1P8WN28      --GYGHDDEEDDLDSVDFPP----------------------------------------
A0A3B9CTT0      --GYGHDEDDDEYDQM--------------------------------------------
A0A5C5XLF4      --PYQQTNDMPEFLAPTQAVIPS-------------------------------------
A0A2D5NDU9      --GVQARQPYAFTAAGPEVE-----------------------VTRQPTSGPSRDSSAAD
A0A286RGB6      --VEGDSQRQEAPERG--------------------------------------------
A0A1V5N3W2      --GHKHNPPDGKQIDMKQLM------------------------------LLLRPDEKKK
A0A3E0MY27      --GYGREELSHEVAES--------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      --DESHEEKEVPEITESIST----------------------------------------
A0A5C5ZM48      --GDEGAEPVGAESYAANETSV--------------------------------------
A0A5B9WF77      ---------------------------------------------------------SRQ
A0A518BBX8      --E----------------------------------------------------KYLDE
A0A518ALT3      ------------------------------------------------------------
A0A517MDV3      -------------------------------------------------------GQRKV
A0A3M1QRP3      --VYGPATDNDPLDVRVI------------------------------------------
A0A517TMV0      --DDTAEALEEKPLAA--------------------------------------------
A0A2E3RCU8      --GYGYGDDDSGSLDEADGT---------------TLNAEDNYADINFQMRPLDQKVSEI
A0A3E0MY88      --NYGGSDEETHHVEEPLPH---------AESPELAAPGSVSFELDSTAPWPPQTQQQVV
A0A1C3E6N1      --GHTDTDGDHDDLLDDHAS----------------------------------------
A0A518GJT2      --GHTDTDGDHDDLLDDHAS----------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A517MLW3      --GDELTDEKQAVV---------------------MPSQNAVSQSELVVHTDSAAPKTAP
A0A5B9QVD0      --GDDNQDEKIHLI------------------------------AEPTADQPPAAPQAP-
A0A3B8PNV4      ---------------------------------------------------------GED
A0A3D1DR40      ---------------------------------------------------------GED
A0A2E7RYU8      ---------------------------------------------------------GED
A0A3B8LXG8      ---------------------------------------------------------GED
A0A350CI62      --GHDQEPEEQSGSGGHSG------------------SPEQPVAAGHSVSAGLYSISVGG
A0A4P5WQK6      --GHDQEPEEQSGSGGHSG------------------SPEQPVAAGHSVSAGLYSISVGG
A0A3C1X4W5      --GHDQEPDEQSGAGSQPS-----------------------------------------
A0A3D3W3A7      --GHDQEPDEQSGAGSQPSL------------SGYGMTSGQSATAGQSVSAGLYSISVGG
A0A518DRX3      --GENDSDDDHISPTSTTATSTPQHSPVVRRPDRSTSSQPTSTPTTPTRRRPAATQSDDH
A0A518DZF9      --GENDSDDDHISPTSTTATSTPQHSPVVRRPDR-TSSQPTSTPTTPTRRRPAATQSDNH
F0SI78          --NYSYHQRRYRYYYEGTDA----------------------------------------
A0A518IQ30      --GYGDEEQDDVVESLPLQQ---------------APTQAPH------------------
A0A517LWP4      --GYGDEEQDDTVDALPMQQ---------------APTQPPH------------------
A0A518JNW8      --GYGDEEHDDAVEALPMEQ---------------TPTQSPH------------------
A0A2E7ENQ5      --HEDANVDDDPTTLPIQDP---------------QVFQRPADDA---------------
A0A1G3AQE9      --IYKYGADADSKDESELAE---------------AAAIGKDAAGAQGNGVSRWKEADPP
A0A3L7UQT9      --GYGYGHDD--------AN---------------AAAESEHEAG----------DEEPA
A0A4P5YBU2      --GYGYGHDD--------AN---------------AAAESEHEAG----------DEEPA
A0A518AKT8      ------------------YS---------------YHSEDEEEPL----------PGEAS
A0A5C5ZR72      ------------------FP---------------EQEERPEGLV----------GVPGG
A0A517TY85      ------------------AH---------------R------------------------
A0A5B9QEI7      ------------------QH---------------E------------------------
A0A5S9IJB5      --YGNDGLTT--------------------------------------------------
A0A1G2XVR0      --GYGYGAEPPKEKRKREKR-----EKKEINV----------------------------
A0A1G3B0P0      --GYGYGAEPPKEKRKREKR-----EKKEINV----------------------------
A0A1E3X4X0      --GYGEEEEKKGRKKRRSKG----------------------------------------
A0A286U4B3      --GYGYGVEEKGKKGIIERMKWTKGKEKVENT----------------------------
A0A5C6DDS2      --GYGYGEDTGKKKGLIERM---KGKIKLKNV----------------------------
A0A0S8J591      --QPVAEMMEEAGV----------------------------------------------
A0A2E3GW02      --SYHQRRYRYYYEGTDA------------------------------------------
A0A1U9NL64      --GYSYEEDDKSSAKSA-------------------------------------------
A0A5B9QNZ7      --KAEKYFRPTASAK---------------------------------------------
A0A1U7CZ81      ---GRSGYGEP-DASPTT------------------------------------------
A0A142YNY8      --ASTTDRERPADATSAG------------------------------------------
A0A1U7GLS6      ---QQSDRERPAGATPAD------------------------------------------
A0A1Z8N7H5      --NNDEDEGEIEQQGNRDSYQGISFQSKTFDQSENXQEKLPAKFRKTA------------
A0A1G2YPI3      --GYYYGDDRKKKKTGDRRPDGVVKDSALDAKAID-------------------------
A0A532UIN2      --GRNGKKKTGNREPAAGVRRTVVSPSRMAKDSRWRTPLMKT------------------
A0A532UD06      --GGYYDDDISAESRDQDEANVHVHV----------------------------------
A0A660URN1      --YGHYGYGRDERQRQYA------------------------------------------
A0A0S8KNX5      --AQSRESARRSRRKLMFSVDGGVDHSSGLETSVAERSADNYSYTQSSESRKDTGRK--R
A0A3D3UVZ8      --AQTRESARVSRRKLMFSMEEGADNTYDSKIPESDKPGEGFSYSQSVESRKSVMRKRTR
E8R3W3          --QRASEDGAA-------------------------------------------------
A0A517NFU9      --HNQYAATNTENLPSVRTVPSPKGELGPKGEAGLSGELGPKGRSSRSSERASL------
A0A5C5YWH4      --HSQYEATDIES------------------------TIPQRSPRILAAERSVG------
A0A3D2TNK4      --SHEEEQDMVDTADTMMTPMPEIVQLPSIASEEHLPSASPQEHQSHETPFQTKSANSTT
A0A0J1B4A0      --RRYYEANDDDDAGSAPRRKRSSSKRTAAASTRSLPIPEAASSNGHVANGSTVNGSSNG
A0A142WSB9      --YSTAPATSGGAARSKAAAGKLW------------------------------------
M5SZR3          --HQSRNGTTSKSPNRLTSNNGHANGALVTSTGDVEVNGHGDKHSSNPLEERGNPNS---
M5TW92          --HQSRNGTTSKSPSRLTSNNGHANGALVTSTGDVEVNGHGDTHSSNPLEERGNPNS---
A0A2S8FKY2      --TSTVEVE---------------------------------------------------
A0A517N8P6      --DRYLDASKGQTITVRSQRSRNADPARAATLSEPVKTTE--------------------
A0A432MJP4      --GRSYGSVDGSGPRTGSVWPSGTAAGEGASASWAPASLLRRLRTGGPGPGFGNGGRGVN
M5UQ35          --RRYYAASDVADEETPVSSSARLSAAKLRGVSGLPAQEGRPSRIDVFADGPVMEEQSVN
A0A5C5WTY6      --YRSRIPVKSQPSKMAAIRSFAAEESVI-------------------------------
A0A5C5Y033      --TRSSSQRKRG--RAAATPGSVNNAA---------------------------------
A0A5C6G1Y2      --TRSSSQRKRG--RAASATGSVNNAA---------------------------------
A0A354PDV6      --SEVSVPQRSL-----QNGAIPSYNGRVGSVITTRASDIGSRD----------------
A0A5C6FZ02      --SRPTNRTKPV--TSARI-VEVDNDA---------------------------------
M5TIT3          --TRAASSNGRKPRVGESSASAATVNGRASHD----------------------------
A0A5M6CY44      --TRKSSRNGKA--VNGRAKAGRQLSARKTDS----------------------------
F2AXG2          --TRPSSSTTRQ--AAPKA-ATISSNGRVAE-----------------------------
M2BB46          --TRPSSSTTRQ--AAPKA-ATISSNGRVAE-----------------------------
L7CLQ6          --TRPSSSTTRQ--AAPKA-ATISSNGRVAE-----------------------------
A0A0J1B719      --TRPTSSATRQ--AAPKA-ATISANGQPKSK----------------------------
Q7UF18          --TRPSSSTTRQ--AAPKA-ATISSNGRVAE-----------------------------
A0A2G1W1E0      --TRPSSSTTRQ--SAPKA-ATISSNGQPKPE----------------------------
K5E235          --TRPSSSTTRQ--AAPKA-ATISSNGRVAE-----------------------------
A0A5C6FFI9      --HNEYAASEPSSISTLPRVKGATKSATSSGSPNASRAVVLGSATPTLPGMASQKAALE-
A0A3A0DET7      --GEYAAIE----EASAPDRGRKKSRALVKAATEPAITSQE-------------------
A0A5C5WDJ1      --HHQYGSKPVTKDDSNTTTLEDTWENRLRHSDDLGSRLHHNIDRLNEIVKN--------
A0A5C5X547      ------------------------------------------------------------
A0A2A2W9R6      --RQYYESE----EEDS-SPTSKRS------QKRINGEAAKLNGRS-ARDRLISGKR---
A0A518HKC1      --RRYYESD----EEEA-VISNGRS------RKRVNGEAVKMNGRG-ASDRLITGKR---
A0A518L3P0      --RRYYESD----DEDAPTSSNGRS------RKRVNGKAAKMNGHA-ASDRLITGKR---
A0A255R1S0      --RRYYEADADGQDEDRPIRSARAATSSRVVNGKVNGHAKHASDVAEAAHPVTLDRK---
A0A5B9MKP1      --RRYYEAE----EEDEPARVNGRS------HKRINGQVAKVNGRTATSDRLISGKR---
A0A0S8FY64      --QEDEGDE----LEMPASVPVAVEDERPDDGPDEEGSAERFEPGTVSFVVRGGQDFSFS
A0A1N6KFT7      --GTYGRGD----DGLDQITPSTKEITTSVSSSESTNGLPQPLLKD--------------
L0DFG4          --GTYGR------DEVSPIVSDGKEIAAFGPPSKPTNGLPQGILKD--------------
A0A5C5XXG1      --SRPT-------NRTKP-----VTSARIVEVDNDA------------------------
A0A518BJJ1      --TDAG-------GDGGPPALEGVEAALPSELEREVASASARDERF--------------
A0A518D182      --AYYQ-------DDRSP--------------DRQAA-----------------------
A0A353FIP5      --SR--------------------------------------------------------
A0A5B1CIK7      --TKSPKKN----GAV---------------------------KPL--PARSAAISSDIA
A0A5C5WHS2      --SRPASKN----GSS---------------------------KRIASPARASSIPTDMN
A0A5C6B6G8      --TRKKKNG----RAEAA-------------------------RPIGSLPAAAKTENESD
A0A5C5ZZN3      --TRPTNAG------SKPARSG---------------------SLNGFSAAPAEAPVNGK
A0A5C5XS91      --TRPTSKS------ASAERTSRVATVQVNGKSQANGKA----QANGKASAGGNASANGK
A0A5C6C4E6      --TRPKSKS----AAAAAERSNRVATAQVNGKAHTNGHANGTSQTNGTSQTSGKAKTNGK
A0A2E1VVJ1      --KQEGRSS----GSEL-------------------------------------------
A0A3M2AEL0      --GY-GYGD----GSK--------------------------------------------
A0A532UT69      --KV--------------------------------------------------------
A0A2D5AWU0      --EAPLPPRSDAGV----------------------------------------------
M5RT57          --E---------------------------------------------------------
A0A356KTN1      --KDEES-----------------------------------------------------
A0A518HFS8      --KR--------------------------------------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A2E0SMM6      DYEANPYHAA--------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A3L7NDH9      SRGASNPRAVA-------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A5C5VEK8      PAESATVVEQT-------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A1P8WN28      -PPSSDLGKVA-------------------------------------------------
A0A3B9CTT0      ----TDGELAA-------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A2D5NDU9      DGHADERPSAD-------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A1V5N3W2      DTSPSEESSKN-------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      -PERTVPRRVA-------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      RATQTPSADAV-------------------------------------------------
A0A518BBX8      SPLSSDSQDAT-------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A517MDV3      NAYFRAPQSNG-------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A2E3RCU8      ENASIHFRKSA-------------------------------------------------
A0A3E0MY88      HDGTTVPRKVA-------------------------------------------------
A0A1C3E6N1      SHSSYSSRTAA-------------------------------------------------
A0A518GJT2      SHSSSSSRTAA-------------------------------------------------
A0A286RD13      --IDVESRAAE-------------------------------------------------
A0A517MLW3      VRRSTPRRRAA-------------------------------------------------
A0A5B9QVD0      -RRAAPRRRVA-------------------------------------------------
A0A3B8PNV4      EPASSPHRLAA-------------------------------------------------
A0A3D1DR40      EPASSPHRLAA-------------------------------------------------
A0A2E7RYU8      EPASSPHRLAA-------------------------------------------------
A0A3B8LXG8      EPASSPHRLAA-------------------------------------------------
A0A350CI62      SRSSGDSSRAA-------------------------------------------------
A0A4P5WQK6      SRSSGDSSRAA-------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      SRGSGDSSRAA-------------------------------------------------
A0A518DRX3      QPQVTRRRAA--------------------------------------------------
A0A518DZF9      QPQVTRRRRAA-------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A518IQ30      -------RKVA-------------------------------------------------
A0A517LWP4      -------RKAA-------------------------------------------------
A0A518JNW8      -------RKAA-------------------------------------------------
A0A2E7ENQ5      ---SEPRRRAA-------------------------------------------------
A0A1G3AQE9      PGLVP--RRVA-------------------------------------------------
A0A3L7UQT9      SDEVQPLRRAA-------------------------------------------------
A0A4P5YBU2      SDEVQPLRRAA-------------------------------------------------
A0A518AKT8      LPHDDDSRRAA-------------------------------------------------
A0A5C5ZR72      V-----------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A0S8KNX5      KKPRLSVEDGAD-------KTDDPETPRTS------------------------------
A0A3D3UVZ8      KKPPVSNEDIADADNTDTSETDSENRPTEA------------------------------
E8R3W3          ------------------------------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      PLKPRRVA----------------------------------------------------
A0A0J1B4A0      HPTT--------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      GNGKLG------------------------------------------------------
M5UQ35          GHSHENVKSGGLNGVASTEARLSDR-----------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A0S8FY64      FELEDGQQTVVGRSSAECDIGLPSASVSPQHCRIANSGGRIVVEDLGSANGTFVGYRRVR
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      GRDG--------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      A-----------------------------------------------------------
A0A5C5ZZN3      AH----------------------------------------------------------
A0A5C5XS91      AKTK--------------------------------------------------------
A0A5C6C4E6      VKSK--------------------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      ----------------------------
A0A533Q9U4      ----------------------------
A0A1U9NNE1      ----------------------------
A0A2G2JCA2      ----------------------------
A0A533Q6B7      ----------------------------
A0A351FYP6      ----------------------------
A0A2E7ESJ6      ----------------------------
A0A1G2YQB7      ----------------------------
A0A353P687      ----------------------------
A0A356EME5      ----------------------------
A0A355AI52      ----------------------------
A0A3L7SI46      ----------------------------
A0A3L7P4E4      ----------------------------
A0A3L7PEB5      ----------------------------
A0A2N1UCJ3      ----------------------------
A0A517ZCB5      ----------------------------
A0A432MFP3      ----------------------------
D5SZ21          ----------------------------
A0A518CHE5      ----------------------------
A0A257WS34      ----------------------------
A0A2E8FLY0      ----------------------------
A0A3D2U1E1      ----------------------------
A0A1P8WP26      ----------------------------
A0A3L7V1F3      ----------------------------
A0A5B9QF68      ----------------------------
A0A5B9QGF0      ----------------------------
A0A5C6CK24      ----------------------------
A0A2E8B0L9      ----------------------------
A0A5Q4GFE7      ----------------------------
A0A2E3GWX1      ----------------------------
F0SG60          ----------------------------
A0A2E9VST2      ----------------------------
A0A356A6X2      ----------------------------
A0A5C5XLM3      ----------------------------
A0A3M1VCL4      ----------------------------
A0A5C5V7Z9      ----------------------------
A0A5C5YT05      ----------------------------
A0A518D7F9      ----------------------------
A0A5C5ZIP0      ----------------------------
A0A518KBK3      ----------------------------
A0A5C6AKF9      ----------------------------
A0A2E0X4J3      ----------------------------
A0A5C5YU10      ----------------------------
A0A517MPZ6      ----------------------------
A0A5C6CNV7      ----------------------------
A0A518K5H4      ----------------------------
A0A5C6AA28      ----------------------------
A0A2E9VK20      ----------------------------
A0A3D4PJK1      ----------------------------
A0A0S8GZ23      ----------------------------
L0DC26          ----------------------------
A0A354PCQ3      ----------------------------
A0A1I3DDV4      ----------------------------
A0A2E2N5A9      ----------------------------
A0A2E3GWC6      ----------------------------
F0SLB0          ----------------------------
A0A2E0SMM6      ----------------------------
A0A1N6DAJ8      ----------------------------
A0A5B9PJZ8      ----------------------------
A0A2S8G191      ----------------------------
A0A2E7EGG1      ----------------------------
A0A225EH48      ----------------------------
A0A3L7NDH9      ----------------------------
A0A518INW8      ----------------------------
A0A518JPH9      ----------------------------
A0A2E2CCW9      ----------------------------
A0A3C0AGX3      ----------------------------
A0A518AAQ5      ----------------------------
A0A517QBG9      ----------------------------
A0A518FTU3      ----------------------------
A0A2E7K7A9      ----------------------------
A0A517PTS5      ----------------------------
A0A517WHH5      ----------------------------
A0A5A8BGT3      ----------------------------
A0A517VTK3      ----------------------------
A0A517WQT4      ----------------------------
A0A517VID8      ----------------------------
A0A517RK10      ----------------------------
A0A518IH18      ----------------------------
A0A5C5VEK8      ----------------------------
A0A532UTJ0      ----------------------------
A0A517NSK8      ----------------------------
A0A5C5Z0D6      ----------------------------
M5UE94          ----------------------------
A0A1P8WN28      ----------------------------
A0A3B9CTT0      ----------------------------
A0A5C5XLF4      ----------------------------
A0A2D5NDU9      ----------------------------
A0A286RGB6      ----------------------------
A0A1V5N3W2      ----------------------------
A0A3E0MY27      ----------------------------
A0A2E0X9P6      ----------------------------
A0A286RLF2      ----------------------------
A0A5C5ZM48      ----------------------------
A0A5B9WF77      ----------------------------
A0A518BBX8      ----------------------------
A0A518ALT3      ----------------------------
A0A517MDV3      ----------------------------
A0A3M1QRP3      ----------------------------
A0A517TMV0      ----------------------------
A0A2E3RCU8      ----------------------------
A0A3E0MY88      ----------------------------
A0A1C3E6N1      ----------------------------
A0A518GJT2      ----------------------------
A0A286RD13      ----------------------------
A0A517MLW3      ----------------------------
A0A5B9QVD0      ----------------------------
A0A3B8PNV4      ----------------------------
A0A3D1DR40      ----------------------------
A0A2E7RYU8      ----------------------------
A0A3B8LXG8      ----------------------------
A0A350CI62      ----------------------------
A0A4P5WQK6      ----------------------------
A0A3C1X4W5      ----------------------------
A0A3D3W3A7      ----------------------------
A0A518DRX3      ----------------------------
A0A518DZF9      ----------------------------
F0SI78          ----------------------------
A0A518IQ30      ----------------------------
A0A517LWP4      ----------------------------
A0A518JNW8      ----------------------------
A0A2E7ENQ5      ----------------------------
A0A1G3AQE9      ----------------------------
A0A3L7UQT9      ----------------------------
A0A4P5YBU2      ----------------------------
A0A518AKT8      ----------------------------
A0A5C5ZR72      ----------------------------
A0A517TY85      ----------------------------
A0A5B9QEI7      ----------------------------
A0A5S9IJB5      ----------------------------
A0A1G2XVR0      ----------------------------
A0A1G3B0P0      ----------------------------
A0A1E3X4X0      ----------------------------
A0A286U4B3      ----------------------------
A0A5C6DDS2      ----------------------------
A0A0S8J591      ----------------------------
A0A2E3GW02      ----------------------------
A0A1U9NL64      ----------------------------
A0A5B9QNZ7      ----------------------------
A0A1U7CZ81      ----------------------------
A0A142YNY8      ----------------------------
A0A1U7GLS6      ----------------------------
A0A1Z8N7H5      ----------------------------
A0A1G2YPI3      ----------------------------
A0A532UIN2      ----------------------------
A0A532UD06      ----------------------------
A0A660URN1      ----------------------------
A0A0S8KNX5      ----------------------------
A0A3D3UVZ8      ----------------------------
E8R3W3          ----------------------------
A0A517NFU9      ----------------------------
A0A5C5YWH4      ----------------------------
A0A3D2TNK4      ----------------------------
A0A0J1B4A0      ----------------------------
A0A142WSB9      ----------------------------
M5SZR3          ----------------------------
M5TW92          ----------------------------
A0A2S8FKY2      ----------------------------
A0A517N8P6      ----------------------------
A0A432MJP4      ----------------------------
M5UQ35          ----------------------------
A0A5C5WTY6      ----------------------------
A0A5C5Y033      ----------------------------
A0A5C6G1Y2      ----------------------------
A0A354PDV6      ----------------------------
A0A5C6FZ02      ----------------------------
M5TIT3          ----------------------------
A0A5M6CY44      ----------------------------
F2AXG2          ----------------------------
M2BB46          ----------------------------
L7CLQ6          ----------------------------
A0A0J1B719      ----------------------------
Q7UF18          ----------------------------
A0A2G1W1E0      ----------------------------
K5E235          ----------------------------
A0A5C6FFI9      ----------------------------
A0A3A0DET7      ----------------------------
A0A5C5WDJ1      ----------------------------
A0A5C5X547      ----------------------------
A0A2A2W9R6      ----------------------------
A0A518HKC1      ----------------------------
A0A518L3P0      ----------------------------
A0A255R1S0      ----------------------------
A0A5B9MKP1      ----------------------------
A0A0S8FY64      RATVGPGDVIRISPYTISVEGPTGNRAG
A0A1N6KFT7      ----------------------------
L0DFG4          ----------------------------
A0A5C5XXG1      ----------------------------
A0A518BJJ1      ----------------------------
A0A518D182      ----------------------------
A0A353FIP5      ----------------------------
A0A5B1CIK7      ----------------------------
A0A5C5WHS2      ----------------------------
A0A5C6B6G8      ----------------------------
A0A5C5ZZN3      ----------------------------
A0A5C5XS91      ----------------------------
A0A5C6C4E6      ----------------------------
A0A2E1VVJ1      ----------------------------
A0A3M2AEL0      ----------------------------
A0A532UT69      ----------------------------
A0A2D5AWU0      ----------------------------
M5RT57          ----------------------------
A0A356KTN1      ----------------------------
A0A518HFS8      ----------------------------
                                            

© 1998-2020Legal notice