BYKdb

Dataset for cluster tadcd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

222 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------MPGQTVGPVSIKREYRCSPQDRPDIPPIFTGFTYSQALPCFT
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      MPLYIDSQPTARLSVLSSILQALQRAQIPRMLCVSFLSRMTLSPWNIRREPVRRYFGTGY
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------MRRRGRGSQVFKKVGARNEPTGQE
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      ------------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      ------------------------------------------------------------
A0A5C5ZZN3      ------------------------------------------------------------
A0A5C5XS91      ------------------------------------------------------------
A0A5C6C4E6      ------------------------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      -------------------------------------------------------MSSDF
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A2E3GWC6      --------------------------------------------------MPADASRSGF
F0SLB0          --------------------------------------------------MPADAGRSGF
A0A3L7NDH9      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      -------------------------------------------------------MSNPI
A0A7C4Z5R7      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      --------------------------------MSAVRTLSRLTECRGNGRVLCGALFRLF
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A286RD13      -----------------------------------------------------------M
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------MSLALPPSGSEQ
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      --------------------------------------------------MNEDQKSKQS
A0A7C5R0U3      -------------------------------------------------MND--------
A0A517TY85      --------------------------------------------------MNLPPEPTRE
A0A5B9QEI7      -------------------------------------------------MNNSPNPPEHE
F0SI78          -----------------------------------------------------------M
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7C2KUQ9      -----------------------------------------------MSLMAENEGSGES
A0A7C5BZF0      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      ---------------------MNKSEMNLPAFATSNPMLSSVTEEFRPEVDSEMSLLSY-
A0A533Q9U4      ------------------------------------------MLPFKGDESEEIHILDY-
A0A1U9NNE1      --------------------------MNQIDKYYESYLGSYAQEGTKQESENTLTLFKI-
A0A2G2JCA2      ------------------------------------MNMITNSTPNYRPAKPPAEKKPFI
A0A533Q6B7      ---------------------------------MIPVDQRKPQSHTNRRENTEVHLLDY-
A0A5S9IJB5      ------------------------------------------------MDKQEFNIHQY-
A0A1G2XVR0      ---------------------------MLTESEIQP---------------KQLDIRKY-
A0A1G3B0P0      ---------------------------MLTESEIQP---------------KQLDIRKY-
A0A1E3X4X0      ---------------------------MLNNK-------------------EQTHLTDY-
A0A286U4B3      ---------------------------MNNDSFLNQTQDPSNYYSGKTSSLDEIHLRDY-
A0A5C6DDS2      ---------------------------MKNDSYQNQTED--SFYNGETAFLEEINLRDY-
A0A2E3GW02      ----MKIRLSPEGEFSNVTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPPSSESGFDI-
A0A5B9QNZ7      DYFSGLNETDRGPVTTGTIVPPPAVDSPPPGRFPWQSYANESIPMSHEPTTSPEPVLDL-
A0A1Z8N7H5      ------MHLIDLLILGLALRRESRVSNEEGSLMSVETDNETYDAPLTNAAGAIHDGFQF-
A0A1G2YPI3      ------------METNNEFGQTEIVGHNMIDQQENNGHAGLANSHVGMPLPTQMMSESL-
A0A1U7CZ81      -----MDTTDSNDSLLPARLPSSSSSHLPAMSAAN--RHAYDL--TTVSSSVQISPQGV-
A0A142YNY8      -----MDTSDRHDSTLPAR-SHTPSSGVPARAATNFGGGSREL--AVGASTMQVNPTSI-
A0A1U7GLS6      -----MDTSDRPDSMLPAR-PTPPAPPVPSRGPASFGGGPRDLVPTSAAPALQVDPVSI-
A0A532UIN2      SDSISALIYAPKTFSEMTDQNRRRTRGSDVISQYENNRTFARDALQGGPRSAGITSESL-
A0A0S8KNX5      --------------------------MSDLEKYHDQVVGQQVVNFQIPPEPGRVGTSNL-
A0A3D3UVZ8      --------------------------MNELEKYHSQATGQEIVNLQIPPEQESEATSDL-
A0A517NFU9      ------------------------------MESSVSESASK----------ATVIEINL-
A0A5C5YWH4      ------------------------------MDSPTTESASK----------APVIEINL-
A0A3D2TNK4      --------------------MTDLNTSADIQSNFEASAESE----------LVPTIMRL-
A0A7C1Y4F0      ---------------------------------MDNGTIGNGSANTVLSEPDGPPQESL-
A0A6I0ENW6      --MFEINEDAPEGGQDRGSALIPAGGGVSTLARGGESGGYGLASYGPASGPAPHRGFSL-
A0A6L3A0B7      VNMFEINEDAPEGGQDRGSALIPAGGGVSTLARGGESGGYGLASYGPASGPAPHRGFSL-
A0A0J1B4A0      --------------MLFADQSIEFLKIMIRSNPSADDVNGD----------ELDIDLDL-
A0A142WSB9      --------------------------MTQPNPASANGNELAFAPPGLQASSLPGRSIDL-
M5SZR3          ---------------------------MNSNRKLVSRNANS----------QDEQLLDL-
M5TW92          ---------------------------MNSNRKLVSRNANS----------QDEQLLDL-
A0A2S8FKY2      ------------------MSNGNLVISSEKDRRRQGTNVPGTVVANRPQEEDGMQFGQV-
A0A517N8P6      -------------------------------MQPASHTQTSRSDIGMAPPMSGPSDVSV-
A0A432MJP4      ---------------------MRLPDPQGSEADSTMSDRPLASDTNPSAHLGAAELKHL-
M5UQ35          ------------------------------MTNQEDDIDGD----------DFELDLDV-
A0A0S8FY64      -------------------------------------MEDTLAAEAYPDEVREFDIRHH-
A0A1N6KFT7      --------------------------------MAIQQSITGPGSEGPPSRTLQNDLVAL-
L0DFG4          --------------------------------MANQQSITGSVSEGYPSRTLQNDLIAL-
A0A5C5XXG1      --------------------MRLVVDVVGVDDSSESPAVAESRIPPAIDTPSSEGVVES-
A0A7C7YUM8      --------------------MTASTTTEVHAESRHGYGQSPSNGAAGMFADPTVRIGEL-
A0A7C2AHI6      -------------------------------MSEHGYGGHGPEEP----REESLRLGDL-
A0A518BJJ1      ---------------------------------MFRHDQNTAGGV----RDAVPELRAI-
A0A518D182      --------------------------------MPLTHEGTDRNGS----PDPAAGLRHV-
A0A5C5WTY6      MNSSNGPSSKGMTSRLSKVEAAKAHYADESPATAPQSRRGASYYGYGYEQPKWGETINP-
A0A5C5Y033      --------------------MTGSTSVTQHQPNGRGGSTGSPRSGLGLPLRNSVEAINL-
A0A5C6G1Y2      --------------------MTGSTSVTQHQPNRRGGSTGSPRSGLGLPLRNSVEAINL-
A0A354PDV6      ------------------------MNREITSTGTDRQFNLN----------DQELSIDI-
A0A5C6FZ02      ----------------------MTENNAKPSAPAKSESRVT----------EDVVTLDV-
M5TIT3          ---------------------------------------ME----------ELSDSIDV-
A0A5M6CY44      --------------------MRQLPMPAAKSSSTRPRRPVA----------PEPDSLDL-
F2AXG2          --------------------MAESAKPTNRLPSRSPSNSTS----------DGEETLDV-
M2BB46          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDV-
L7CLQ6          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDV-
A0A0J1B719      --------------------MAESAKPTNRLPARGPSSASS----------DGEETLDV-
Q7UF18          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDV-
A0A2G1W1E0      --------------------MAESAKPTNRLPARGPSSSTS----------DGEETLDV-
K5E235          --------------------MAESAKPTNRLPARGPSSSTS----------DGEETLDV-
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      --------------------------------MTESTKSFS----------FASGEIDP-
A0A5C5X547      --MSTDVGKPLAANGRSSRGLNNPQAPYLVQNTVSTAPAEE----------GSGIQLSA-
A0A353FIP5      -------------------------------MPIPTSNAPE----------PKVDFNEA-
A0A5B1CIK7      --------------------MANTNEISASRVRQNARPSVE----------EEQDSLDV-
A0A5C5WHS2      --------------------MATSTENTSLRTQLSNRLSSD----------EDNDGLEI-
A0A5C6B6G8      ------------------MAPTNSQNPNNN-PRRRSAKTTS----------ENADSLDV-
A0A5C5ZZN3      ------------------MNKAENVEPVNRIARRPASSAME----------DPSETLDV-
A0A5C5XS91      ------------------MIMAEPNEPKNRIQALTRPKSDD----------DQADSLDV-
A0A5C6C4E6      ------------------MIMAEPNEPKNRIQSLTRPKPDD----------DQADSLDV-
A0A2E1VVJ1      -----------------------MSTVSGSPPTGPDANTGA----------KQIDVLEL-
A0A3M2AEL0      -----------------------MDTFAAPPPEHDDQ---A----------VTLSLPRL-
A0A2A2W9R6      ----------------------------MKRYQDETLEADD----------AAELSIDL-
A0A518HKC1      ----------------------------MKRYQDEALDADD----------GAELNIDL-
A0A518L3P0      ----------------------------MKRYQDEALDADD----------GPELNIDL-
A0A255R1S0      ----------------------------MSSHSDEA--QSD----------GMEFDIDV-
A0A5B9MKP1      ----------------------------MKRYEDEAFEADD----------GAELNIDL-
A0A0S8J591      -------------------------------------------------MAVKRPERKMH
A0A351FYP6      ----------------------------------------MEPTSRKENSSDKLHILDY-
A0A532UT69      ------------------------MTSDMTDKNTDLKMVGVARSIANTPPTSGFMPESL-
A0A2D5AWU0      --------------------------------MSEIRIPQIEQSSSGGGESVDAGRLFQ-
A0A1G2YQB7      ------------------------MNSLTKFTENQIIMQKSNMIEPDNESETA--NLIA-
A0A353P687      ------------------------MNTLTKYSDNHNLAQSGGMVYPTNEDGDPALNILT-
A0A356EME5      ------MSRRPDLSHSSLTERSAERAGPPAVSTSGMRPLNAPGVRKRTAGSSQEMSPRF-
M5RT57          ------------------------------------------------------MGPRY-
A0A356KTN1      ------------------------------MQAPQTGLESDFGRSPTISDPLDAEDLRE-
A0A518HFS8      --------------------------------------------------------MPA-
L0DC26          --------------MMLNSNPGPGADSVNLPAVVPPHRAEVLSVTPAHFESSASLDPIT-
A0A3L7P4E4      ------------------------------------MSEFVPPSNPNVEPEEAGFDLWG-
A0A3L7PEB5      ------------------------------------MSEFV-TNSPNAEAEEAGFDFWG-
A0A1U9NL64      -------------------------MNESFKTPQVNSSHEEANGDFEGREEGFQRSLFE-
A0A2N1UCJ3      -------------------------------MTDKKTNIENEAGSVEQMMSGTHRTFAV-
A0A7C4EK84      ---------------------------MSSQTERHRRPETVPLQPRDGQEDSAHQNLLG-
A0A7C3F0T2      ---------------------MGEPANAGSAIGRFEGPLPVQGISADHGRPS----LLH-
A0A2E0X4J3      -------------------------MSPNSLVETDPFAPPVESRPGPPSAAGSEVNLLA-
A0A5C5YU10      ------------------------MNPLVTTPHGALDSEPIGQMQSSAAAPPQSTDLLA-
A0A517MPZ6      ------------------------MSSLVEYEDDYSLDADPQPNAGKGDDSALQTNLLS-
A0A5C6CNV7      ------------------------MSSLIEYDSNTQL--EPSGMAHDHAAGAGQTNLLE-
A0A518K5H4      -----------------MASSPANPYAPTPVAMSHVSPLATAAMSVDQEDDSDGVNVLA-
A0A5C6AA28      --------------MALPPSAPASTYAMTPSSAS----LPAPGMIIDQDEDAGGVNVAA-
A0A2E7ESJ6      -----MRHQTELHQPNQSSTDSP------------------AHWGATSMDTVSSQGVDV-
A0A2E9VK20      -----------MKPSSDKNSRNV------------------DTVHGHPLVKADEPAIDL-
A0A3D4PJK1      -----------MKPSSDKNSRNV------------------DTVHGHPLVKADEPAIDL-
A0A355AI52      -------------------------------------MLDHEKQELDSTAQSMRQAVRF-
A0A354PCQ3      --------------------------------------------MPSSSAAQFDPWILW-
A0A0S8GZ23      -------MDKLEKYQPQEITPNI------------------DYLEADSAPKDSSILHLF-
A0A1I3DDV4      -------MSDMPQKPDSQMPVKP------------------MMDTRPMLDPNATGSFDV-
A0A2E0SMM6      ----------MNPYLDQSSTNEK------------------SGGHDNSTSAMMARVMRF-
A0A3L7SI46      VEIQDSRLGGLSDLADDKVSAKLHFISHWLFRMNTNERLTSDLDSTANGPNLLGEAVRF-
A0A5B9PJZ8      ------MSGLRPVQNNNNNYGIP------------------QPQGSGSMPSSGGGLSELY
A0A2S8G191      ----MSLNNANLPQESSKRDIRVDAPVELVTGHANDFLSNNDVESEELGGGGIGVSQIL-
A0A2E7EGG1      ---------------------------------------MSASTKRRRIENLTQFEHDFS
A0A2E2N5A9      ------------MTSKPPSIEHH------------------LTAVPHGPAEAELDLRKL-
A0A7C8AGA2      --------MDELQKYQSQPLSQE------------------VVQFEGPVEEQSDSTMNI-
A0A7C2FXP7      -------MNDQRRFDAVNQRQYL------------------ASFERPAVDHANQNTSVM-
A0A2E3GWC6      ERNIAMRQNETMNQPTVESKNNP------------------APFPSHQMMQTPEPTVDL-
F0SLB0          ERHIAMRQNETMNQPTVESKNNP------------------APFPSHQIMQTPEPTVDL-
A0A3L7NDH9      ------------------------------MQENMSYSGSADGPHVDAMAQIVQNSMRF-
A0A1N6DAJ8      -----------MMSNSNSGPRSDSANLPAVVPPYRTAEVFSIAPAPVGTAAGLDPIALL-
A0A532UD06      ------------------------------MDHEALANGSQDLMSEQGHSQPQEGLFQI-
A0A660URN1      -----------------MRTDNISNPGAQMDKDSPVDNGAYNIAPAAGADHLQSSLLQI-
A0A517ZCB5      -------------------------------MNKLVLEGAGDATGRGESLDFVRGVVRF-
A0A225EH48      ------------MQRSSASEAQMPIPLTPAQPSGQQYASGFQPSVPGQTLAPTAAARAWP
A0A518INW8      ---------------------------------------MQTNHPMNEMTLPAEGITDSQ
A0A518JPH9      ---------------------------------------MQTNHSTKEIAFPADGMLDSP
A0A5C5VEK8      -------MTSLVSSQQGQFDPVP------------------NDQFGPGPSSQAPQSTDL-
A0A532UTJ0      -------MNEIKKLNEPVAGQEL------------------VNLQIPPEQSSEPTSDLV-
A0A432MFP3      -----------MDTSETTRPQYELARLSDLPPALRAPLPPASRPASDGGGLPINPRLVL-
A0A2E2CCW9      -------MNTDFQPLDQQSDFAI------------------DGMEENAEINSSGPGVDI-
A0A3C0AGX3      -------MNTDFQPLDQQSDFAI------------------DGMEENAEINSSGPGVDI-
A0A518AAQ5      -------MNTEFQPLEPHSDLDF------------------DGMEESN-MNSSGPGVDI-
A0A517QBG9      -------MNTEFQPLDPHSDLDF------------------DGMEESN-MNSSGPGVDI-
A0A518FTU3      -------MNTEFQPLDPHTDLDF------------------DGMEESN-MNSSGPGVDI-
A0A517WHH5      -------MNTEFQPLEPHSDLDF------------------DGMEDST-TNASAPGVDI-
A0A5A8BGT3      -------MNTEFQPLEPHSDLDF------------------DGMEDST-TNASAPGVDI-
A0A2E7K7A9      -------MNTEFQPLEPHSDLDF------------------DGMEDST-TNASAPGVDI-
A0A517PTS5      -------MNTEFQPLEPHSDLDF------------------DGMEDST-TNTSAPGVDI-
A0A6I6AH34      -------MNTEFQPLEPHSDLDF------------------DGMEDSI-TNTSAPGVDI-
A0A517VTK3      -------MNTEFQPLENHSDFEF------------------DGMEGHTQSNTSGPGVDI-
A0A517WQT4      -------MNTEFQPLENHSDFEF------------------DGMEGNTPSNTSGPGVDI-
A0A517VID8      -------MNTDFQPLDQQSDFAL------------------DGMEENAEFDSSGPGVDI-
A0A517RK10      -------MNNEFQPLDQQSDFAI------------------DGMEEHAPINSSGPGVDI-
A0A518IH18      -------MSTEFQPLDQQSDFAI------------------DGMEEHAPTNSSGPGVDI-
A0A5C5XLF4      ------------MPSSDKNSNNA------------------DAVHGHPLIKADEPAIDL-
A0A2D5NDU9      -----------------------------------------------------MSFGQV-
A0A1P8WP26      ------------MTTSQRQVNTV------------------GAGGQDALAMTLHAIARF-
A0A3L7V1F3      ------------MSGPENQILGM------------------QEQGQNTAASTLHLMFRF-
D5SZ21          ----------------------------------------------------MQTLMRF-
A0A286RGB6      MTPEREAGMSEHQHLPAPVGQDRTGAARPSAPAPLYLDAEWQPIPAAEAGQGFGAYLHA-
A0A518CHE5      -----------MNPYLDQSNSNE------------------SSNHDNSTSAMMARVMRF-
A0A1V5N3W2      -------MDSVVKYKPQPHPQEF------------------VYTDVPPEAAPAAPLGLF-
A0A3E0MY27      DPKKPSERPLDVVSERPGEGALPVPTSGKDAVFDAIQTSTPARVRPEILTAPPKPMDLL-
A0A7C4Z5R7      -----------MNTLPARIEQNPRPGQASQTVPGNIGSGSPIQPPGSPASAPPSAWAML-
A0A2E0X9P6      -----------MSHSAKEDHDYQLPAPRPPTEWTRQAVTASRPSRRADDSEGMPPDFVR-
A0A286RLF2      ----------------------------------MNESSWIQWAVPDSASHILHAIAQF-
A0A517NSK8      ------------------MTQVD------------------PNLNNQ--TADDSEALDL-
A0A5C5Z0D6      ------------------MNDTT------------------ISSPNE--SAGDTDILDL-
M5UE94          ------------------MNDTA------------------APQPRSYPEQQETDLLDL-
A0A2E8FLY0      ---------------MSRPTDTP------------------IDTSGEPRTATLTAIARF-
A0A3D2U1E1      ------------MSTDQSHPNRP------------------LDETA-PQAATLTRIVRF-
E8R3W3          -------MNPTDPVSAPPRDSHPSSPRPGTAMTRVAVDARPAKPALPPREEALATTLELG
A0A5C5ZM48      ------------------MNKMITPPTQDLTGAAIPAPMVIDAEGDDQSHSALSGQAIV-
A0A5B9WF77      -----------MNTPDRSDANLPARLTSSPRYPAQVSAMRREMDVAGAPSVTIDTRQLF-
A0A518BBX8      ---------------MDRQEPFD------------------PNASDDSPIIAMPDLTRL-
A0A1P8WN28      ------------------------------------MDPYTLEQLDSTEPQGFHALLRF-
A0A3B9CTT0      ------------------------------------MELEQPEQSASSQGNSLQGLLRF-
A0A518ALT3      ------MSESHPNSKDSRHQLTTTHEELAISRRRNITHARQGSGSKQPTQSGITPLFVW-
A0A3M1QRP3      ------MSDKPSRAQDESHALAAGEPLTPAAPFAATDAIDVFAADSGEEREPQKLSLSP-
A0A517TMV0      --------MGTAIEEYSNRQDAL------------------AEPALGGGGDAFESLVRL-
A0A3E0MY88      ----------MSHAPDKLDLEAI------------------GTLDDPSVSHIVHHVVQF-
A0A5B9QF68      -------------MTNTDCKHNL------------------REDAFMPAVDAVSAIARF-
A0A5B9QGF0      -------------MINSDFNQNQ------------------ADADFMPSVDAVSAVARF-
A0A5C6CK24      -------------MTSTDFNQNQ------------------NDAEFMPSVDAVSAIARF-
A0A2E3RCU8      --------------MSVETDDGA------------------YELPLTNAAGAIHDVFQF-
A0A1C3E6N1      ---------------------------------------------MMPEANTMQTLMRF-
A0A518GJT2      ----------------------------------------------------MQTLMRF-
A0A2E8B0L9      MSQTPELRAVSPPHSFDELHDPQ------------------D-----GAAEAVQAVAKF-
A0A5Q4GFE7      -------------MMQHEQHSSA------------------DESMLPSSADSIHALIRF-
A0A257WS34      -------------------------------------------MQQAHHSTVLSELMRF-
A0A7C4LP10      ---------------MSIDADPT------------------APADVPHHSGALGELVRF-
A0A517MLW3      ----------------MNQIENL------------------SGPQHLTAADAIQALLRF-
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      GDGKPDGLPLPRHLATPSAKDPPPPMSSLIESDSFSVGEPTSYGAPHGRAARTGREVSP-
A0A3B8PNV4      --------------MSQSPDDRP------------------IAAPNEPQTATLAAIVRF-
A0A3D1DR40      --------------MSQSPDDRP------------------IAAPNEPQTATLAAIVRF-
A0A2E7RYU8      --------------MSPSPDDRP------------------IAAPNEPQTATLAAIVRF-
A0A3B8LXG8      --------------MSPSPDDRP------------------IAAPNEPQTATLAAIVRF-
A0A286RD13      SDLVRVLGTSPPSTLASGNSVAP------------------TPLQRETLHGPPKPSDVL-
A0A2E3GWX1      -------------MVSPEQYDLA------------------AMPLPQETVNPLTTVIRF-
F0SG60          -------------MVSPEQYDLA------------------AMPLPQETVNPLTTVIRF-
A0A2E9VST2      -------------MPAPENYDPQ------------------MNMHLQENHNPLQTILRF-
A0A356A6X2      -------------MPAPENYDPQ------------------MNIQLQDNHNALQTILRF-
A0A5C5XLM3      -------------MPAPENYDPQ------------------MNIQLQDNHNPLQTILRF-
A0A7C5FXU1      ------MSEQLPANRDERHMVAPVVYRPLDMRDWEGHFGGGWGGSPPQGGSPLGAYWHA-
A0A3M1VCL4      ------MTQDVPSLVLQQEASRA------------------ADLAAVPAINPLASLLRF-
A0A5C5V7Z9      -----------MTAADHQPGFQD------------------EGVQEGSLAESLHGLVRL-
A0A5C5YT05      -----------MTAVDQQGGFPE------------------EAAHEGSLADSLHGLVRL-
A0A518D7F9      ---------MKQSPTAALAREEE------------------WQDDSGAAGAALEGVLRF-
A0A5C5ZIP0      -----------MTQNQEHFHEPE------------------ITVSSAGPNEALQGVLRL-
A0A518KBK3      -----------MSLDTVNDRGEP------------------WGNELDAGGHALEAVVRL-
A0A5C6AKF9      -----------MSLESANEHGEP------------------WRDDNDASEHALEALVRL-
A0A6M5Z0K7      PRGTLSPAAQADRLLPALGVGGP------------------PVAEPPALKQTITPGALL-
A0A350CI62      -------------MTDQDRILAG------------------SQDGTNAAATTLHLLFRF-
A0A4P5WQK6      -------------MTDQDRILAG------------------SQDGANAAATTLHLLFRF-
A0A3C1X4W5      -------------MTEQDRILTG------------------SQDGQNAAATTLHLIFRF-
A0A3D3W3A7      -------------MTEQDRILTG------------------SQDGQNAAATTLHLIFRF-
A0A518DRX3      --------------MTTELSLVS------------------PDAEGSSPRDIMQAALRF-
A0A518DZF9      --------------MTTELSLVS------------------PDAEGSSPRDIMQAALRF-
A0A518AKT8      ----------MLKTPESNNLSSM------------------EQSDDISTSDMIHAGLRI-
A0A5C5ZR72      QLTHRTAGSEGARGGSAHARHAL------------------KPSRAEAAQPQIGPMFFW-
A0A7C5R0U3      --------------------SGH------------------GRDEGARSPHGVAELVFLA
A0A517TY85      PTNLVVRPTQSRAPALANMTPAG------------------G-SDAAAAMQGITPALVL-
A0A5B9QEI7      STGSGLPARIPVAHALRRPMPAA------------------ARQNSTPNEQGITPAFVW-
F0SI78          TTLEAKHTPRWSARATEPKPTQN------------------GSDWQFDSPTSSESGFDI-
A0A517MDV3      --------------------------------------------MSGDNTVSPQPNLDF-
A0A518IQ30      ----------MQRESAPRLSETE------------------QGSDEFQAADAIHAALRF-
A0A517LWP4      ----------MQRESAPRLSETE------------------HGSDEFQAADAIHAALRF-
A0A518JNW8      ----------MQRESAPRLSETE------------------HGNDEFQAADAIHAALRF-
A0A2E7ENQ5      -----------------MNERRA------------------LPPTAGSQTHLVHTAMRL-
A0A7C2KUQ9      GGLLPVARRGEPVEAHRGLLTGP------------------IAAPAPLVGVPAGRTVTL-
A0A7C5BZF0      ------------------------------------------MGDSVSAAQMVHSLARF-
A0A1G3AQE9      ---------------MQEPAVVR------------------DELESESTAHMVHRLVQF-
A0A3L7UQT9      ---------------MNSDVQQP------------------APAPILNTANVVAGMIRF-
A0A4P5YBU2      ---------------MNSDVQQP------------------APAPILNTANVVAGMIRF-
A0A7C7V5U8      ---------------MQEPTVVY------------------HEPEKQSTTHMVHVLMQF-
                                                                            

A0A5S9IPR9      ----WAILRKHLILVAFCG-VV---GAITAVFYTSRLPNM-YRAGASVAVIKPTK---NT
A0A533Q9U4      ----VKIIRKRMWMVIIFF-VV---IVAIVTIKTFKTTPV-YQATARVVLEQNKL-----
A0A1U9NNE1      ----IKALLRRWYIVLLTVVVL---CAIGIPAIFYMFKPS-YETVGAIRVSPILP---NV
A0A2G2JCA2      SPQLVLHALRRWWMIVIPIGMVL--GSAGAAGLWSRYEPV-YKASAWLQIEEVSP---YL
A0A533Q6B7      ----LKIIQKRMWICVIVF-IA---IVAVVVVYTLRTQPL-YQTTASIMLEQKEF-----
A0A5S9IJB5      ----IEIITSRWYIIFLSI-TL---FVGMAFYYAKTTKRI-YQSTGTIAILPKNL-----
A0A1G2XVR0      ----LTTVLRRKWIIIAFL-VI---SGTYSTYKELTKIPY-YTASTQVIITQNTP---KG
A0A1G3B0P0      ----LTTVLRRKWIIIAFL-VI---SGTYSTYKELTKIPY-YTASTQVIITQNTP---KG
A0A1E3X4X0      ----IKIIQKRQWVVILVF-VV---LVATVTISTIRMTPV-YQAKARVLIEKEER---VN
A0A286U4B3      ----FRVVMHRKWVIVAIF-TI---TVLLVTLYTFKQKPI-FQAVTTIRIFKEAP---KV
A0A5C6DDS2      ----FRVVMHRKWVIMAIF-SI---TVLLVTLYTFKQKPV-FQAVTTIRIYKDAP---KV
A0A2E3GW02      ----RSIVWERKWLLIFFA-AL---GAAIGYLEFTKQPPV-YRSSASILVDRYQP---RM
A0A5B9QNZ7      ----WGVLRRRWIIVFLGL-AL---GISLAVFYAVVAPKI-YSSQVEVLVMRKDP---GL
A0A1Z8N7H5      ----LKVVWYRKNSMIMVG-FI---LAIIAGWYAATATRY-YQSSASILIVRNGM---SQ
A0A1G2YPI3      ----VLILWRSRWIVLLTT-VA---VLAAALIYVTKVTPV-YTSTSRIYVEQSGP---KI
A0A1U7CZ81      ----LRGLARNWWRILLLWAVV---SAPLDYLIYSQIQPT-YEAVSTIRAEPTQL---SL
A0A142YNY8      ----LRGLLRNWWKILGLWLIA---SLPLVYGIYTQVKPT-YIAYSVIRIEPTQP---EL
A0A1U7GLS6      ----LRGLLRNWWKILGLWLIL---SAPLAYLVYSQVKPK-YMAYSRIMVQLTQP---DL
A0A532UIN2      ----VQIMWRGRWLILLAT-IL---AVAAAVVYLVKATPI-YSSTSRIYVEQSGP---KI
A0A0S8KNX5      ----LAGIFRRWYIVLLILFVM---CAAGLPAIWFLIDPV-YEVTGAVTIAPIMA---DI
A0A3D3UVZ8      ----VAGILRRWYIVLLILILI---CGSGLPAVWFMVKPI-YDVTGAVRVAPILA---DI
A0A517NFU9      ----LGMLRRRWPHIAFGI-FV---GLSLAGFYYFSTDRM-YESKIEILVGQRSS---EV
A0A5C5YWH4      ----LGMLRRRWPLIVFGI-LV---GVSLAAFYYAATTRM-YESKIEILVGQRSS---EV
A0A3D2TNK4      ----LRMLMIRKKTIIISL-YL---FAVCGVIYYYFAVRL-YESSAKILIDEKNQ---DR
A0A7C1Y4F0      ----LFIVLRHRWTILITT-LV---ALVAAFAYILKATPI-YESESRLYVEQSGP---RI
A0A6I0ENW6      ----RSMLRYKWMVLGITLAGA---AVSVPPVWMLIKPKY-YANTLIQLKPTMQR---QI
A0A6L3A0B7      ----RSMLRYKWMVLGITLAGA---AVSVPPVWMLIKPKY-YANTLIQLKPTMQR---QI
A0A0J1B4A0      ----LGIVRRRYHLIALGI-FV---GVTLATIYFVNQVPI-YESKLAVLVGQRSG---EV
A0A142WSB9      ----VRFVLSIWKWLALGL-FA---GLTLGVVSYLIMGPV-YRASTRVQVSKKAS---LP
M5SZR3          ----KKVALRHKSLIALGI-AI---GLVIGALYYAQSTPV-FRSSAQVLIVRKTP---NT
M5TW92          ----KKVALRHKALIALGI-AI---GLVIGALYYAQSTPV-FRSSAQVLIVRKTP---NT
A0A2S8FKY2      ----LHSLRRQWLASIVLGLLV---AVPVAIAAWVLQSPT-YTSSAYLRISSNDQ---PL
A0A517N8P6      ----GGVLWRRKGVILLLI-LC---GLGAGYWFFTTQDET-FRAAATIEVYSQNV---PT
A0A432MJP4      ----IRVVRREWRWSAVGL-AV---CLTAAAIYLVRTPRM-YQATARVLVLETGR---QP
M5UQ35          ----LGILRRRYHLIALGV-FV---GALLACLFYVKQVPV-YQSNLAVLVGHRSA---DL
A0A0S8FY64      ----FGVIRSRFWTIVACA-VV---LFTVAVLYTFQATPI-YEASARLLIERRAP---QV
A0A1N6KFT7      ----WDVLKRGWKFVSLGL-LV---GLTLASIYLAKTKRI-YQASTSLLVIQHGG---RP
L0DFG4          ----WEVMKRGWKLVIFGL-LV---CLTLASIYLAKTKRA-YQASTSLLVIQHGG---RP
A0A5C5XXG1      ----APWIARRRAA------------------WVILSGPA-GHSS------HHEG---CQ
A0A7C7YUM8      ----LHILLRHKSLIAGAA-FF---VTVCTVLWVSTRQPR-YEASAVLLLEKDES---TG
A0A7C2AHI6      ----LSLVERRMKLILATA-AL---VVVGTFVYLGMRPPT-YRASATLMLLDNGG---ES
A0A518BJJ1      ----LDLIRKRWLAIGACA-AA---TVAAGIGWLSLQPPV-YRATATILLDQSQP---TG
A0A518D182      ----LDLALRRRLALALFA-VA---GLGLALGWIGAQAPV-YRATATVLIDEQDG---AS
A0A5C5WTY6      ----LSIVRRRWKWIAGFA-CL---GILATAIYLSQTPPT-FRSQAKILVNPNRV---EV
A0A5C5Y033      ----PQLIARQRWLILFLG-SC---GLAMGVAYATHAEVL-YESQAKVLVAQRSA---GL
A0A5C6G1Y2      ----PQLIARQRWLILFLG-SC---GLAMGVAYATHAEVL-YESQAKVLVAQRSA---GL
A0A354PDV6      ----LQVLSRQRWLIVFCS-LM---GMAAGVLYSIQSTVW-YRSTAAILVNSKNA---GL
A0A5C6FZ02      ----LQILFRQRWLIAFLT-LA---GLAAGVAYALQARVW-YESTARVLINEKSS---GL
M5TIT3          ----LEILSRQRWAIVFLT-LC---GFTAGVAYAMYSQEW-FESHAKILINQKSA---GL
A0A5M6CY44      ----LDIFRRQRWMIIFLA-VL---GLAAGILYALNATVW-FESRAKLLISERTA---GL
F2AXG2          ----LQILSRQRWLIAFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQASA---GL
M2BB46          ----LQILSRQRWLIAFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQASA---GL
L7CLQ6          ----LQILSRQRWLIAFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQKSA---GL
A0A0J1B719      ----LQILSRQRWLIAFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQKSA---GL
Q7UF18          ----LQILSRQRWLIAFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQKSA---GL
A0A2G1W1E0      ----LQILSRQRWLIAFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQKSA---GL
K5E235          ----LQILSRQRWLIAFLS-IA---GLAAGVAYALNAQVW-YESNAKVLINQKSA---GL
A0A5C6FFI9      ------MLRRRWFHLVLGT-CL---GIAFALLYFYATKPT-YESHIEILVGQRSS---EL
A0A5C5WDJ1      ----LGMIRRRWRLLVFGV-FV---GIALSALYYTTATQQ-YQSSIEVLVGQRSS---EM
A0A5C5X547      ----IWHAFRRRWALGLLIGIL---LTPLAIVPWLLMEPQ-STAVVQLHLHQDDP---ML
A0A353FIP5      ----IGILWRRKVQIALIT-VI---AACVAFLVAVTRTPS-FEAEGRVLLE---------
A0A5B1CIK7      ----FAILGRQRWLIAALS-LA---GLAAGIAYALTAEVW-YSSQAKVLINERSA---GL
A0A5C5WHS2      ----FAILSRQRWLIGLLT-LA---GLAVGLIYALNAEVW-YRSQAKVLINEKSA---GL
A0A5C6B6G8      ----LETITRQRWLLAFFA-ML---GLVVGVAYSLNAQIW-YKSNAKVLIAEKTA---GL
A0A5C5ZZN3      ----LEILSRQRWLIIFLC-LC---GLTAGIAYALYAPVW-YETNATVLINQKSA---GL
A0A5C5XS91      ----LQILQRQRWIILFLC-IC---GLTAGVAYSLYAPVW-YQSSATVLINQKSA---GL
A0A5C6C4E6      ----LQLLHRQRWIIIFLC-IC---GLTAGVAYAKYATVW-YQSSATVLINQKSA---GL
A0A2E1VVJ1      ----LSAILRHKALIVLCT-LL---SSAAVMFYSATKEPV-FNAEGRVALD---------
A0A3M2AEL0      ----LGIFWHQRLLVTSLL-IL---GAVLGFFLSMLVPPR-FAAEATVLLR---------
A0A2A2W9R6      ----LGIVRRRFHLIMLGV-LV---SVTGATVYFVQQKPV-YESKLAVLVGQLSS---EM
A0A518HKC1      ----LGIVRRRFHLIMLGV-LV---GATCATIYFVKQKPV-YESSLAVLVGQLSS---EM
A0A518L3P0      ----LGIVRRRFHLIMLGV-LV---GATCATIYFVKQKPV-YESQLAVLVGQLSS---EM
A0A255R1S0      ----VGILRRRYHLIALGL-LV---GATLATIFYVKQKPV-YQSSLAVLVGQRSS---QL
A0A5B9MKP1      ----LGIVRRRFHLIMLGL-LV---GSTCATIFFVKQKPV-YQSSLAVLVGQLST---KV
A0A0S8J591      LTDYLWVLKRRVLLILFFW-GL---VFASVVVATFMQQPL-YRAYARIEIERSVDTPDVI
A0A351FYP6      ----WRIIRVRIVTILLVF-LL---TAITTTVVTFLIPKT-YMSLSRIAVEKDTSDIAPL
A0A532UT69      ----IRIIWRSRGIVLLTT-FV---SLAAAAVYVTTITPV-YKSTSKIFVEQSGP---KI
A0A2D5AWU0      ----A--LWRGKWYFLLFP-AI---AGGGMYYFLHGQKNL-YRSTAQVQVAPREV---DP
A0A1G2YQB7      ----I---MRKRWKILTVT-AIIICGIGLPLIWLL-VKPY-YLATAAIRVAPVIS---SI
A0A353P687      ----A---VRKRWKILLFT-MIIICSIGLPAVWMF-IKPF-YLATAAIRVAPVIS---SI
A0A356EME5      ----LLNALLHWWKVAMPV-GLILAAVAVAGVWWF-FEPV-FLSRALIQIRENPP---AL
M5RT57          ----LIHSLTTYWYLTIPL-AIVLAGLSATAVLMTFTP-V-YRATAVMKIASYAP---FI
A0A356KTN1      ----TLLGFKRRLPLVIGV-TLFFGVAAGVRS--SNLPTV-YASTARLQLAKEAPDPTRA
A0A518HFS8      ----LLRALRLRWKLAVSG-AILLGAAAGAVAFVAMPPAE-YSSRSLVHVAEKRP---RD
L0DC26          ----LLRALRRRWALAFGT-GLLGAAVIATLTFYLVPPAK-YMARAMLHVNSVKP---RI
A0A3L7P4E4      ----F--LCRRAWLGFFFG-TI---GATAAYYYYLRQPVV-FKATSQILITKQQA---EM
A0A3L7PEB5      ----F--LWRRAWLGFLFG-TI---GATAAYYYYLRQPVV-YKATSQVLVIKQQA---DM
A0A1U9NL64      ----V--AWANRWLILATT-IL---SLTAAFIYLAKATPI-FTSSSRVYVEQSGP---KI
A0A2N1UCJ3      ----T--LQRRRLSILITA-VL---FVAAAILYLIKAEPL-YTSTARLYVEQTGP---KL
A0A7C4EK84      ----V--VWRRRWTVLAVT-AA---SLLAAVVYLAQAEPI-YQSSARVYIEQTGP---RI
A0A7C3F0T2      ----T--LWRRRVIIAAAM-VI---SLALGWLQLNNTTPL-YTSTSRLYVERSTP---KI
A0A2E0X4J3      ----I--AWRSRWLILLFM-IL---GGAVSWVLLQRATPR-YTSFSKLYVERNMP---QI
A0A5C5YU10      ----L--AWQGRWLILIGV-LI---GGSAAWVHLQRVTPL-YQSTSRVYVERSLP---KL
A0A517MPZ6      ----I--AWQARWLLLLTV-LL---GVGCAWLYLQRVVPR-YTSVSRIYVERSLP---QI
A0A5C6CNV7      ----L--AWQARWLLLLTV-LT---GLGAAWILLQRVEPR-FTSVSRLYIERNMP---RI
A0A518K5H4      ----V--AWQSRWLILLFT-LL---GGVAAWAYLQQATPR-YTSLSRIFVEQKLP---SV
A0A5C6AA28      ----I--AWQSRWLILLFT-LL---GGLASWLYLQRVVPR-YTSLARVFVEQNLP---RA
A0A2E7ESJ6      ----GGILSRRKWLVILGF-ML---GLGLGYVYMLQATPR-YESVAQILIEDKQP---PT
A0A2E9VK20      ----VKLALKNVVTLGIAA-AA---GIGLGIFAYKILGPK-YTASSQILVKLKSP---IE
A0A3D4PJK1      ----VKLALKNVVTLGIAA-AA---GIGLGIFAYKILGPK-YTASSQILVKLKSP---IE
A0A355AI52      ----LRVLWHRRIIIMSTL-AL---CGMLGGLYYATAARI-YEAKAQLLIVDTSR---EN
A0A354PCQ3      ----VTFRRCWAWALPIGA-LL---AGLAAFFVLRNFVPI-YRASSLLEANQDYV---VF
A0A0S8GZ23      ----QPVLRRWYWVLVIFI-LV---SAVGAPIIWHVKRPI-YTTSGTIHIRPLVA---DL
A0A1I3DDV4      ----VEIFRRQLPLIACCT-VL---GLLMAVIYWANAEKW-YESSAKMLVTLKDM---RA
A0A2E0SMM6      ----LRVIMLRKKIIVVCV-IL---TSIAGAYWYSTQTPM-YQSTAQLLVLSNGG---FD
A0A3L7SI46      ----LQVIRRKLPTLLVCT-IL---GGVIGTAWYVTATRK-YESVSEIMVLKTDG---NV
A0A5B9PJZ8      NFDVFDMVRRKIWLILFFT-LL---GIAAALLFFFQAPKT-YRSTAKVFVDEKSA---PS
A0A2S8G191      ----HALRRRWLPAFSIGI-VL---ATAGVALAWVLDVPE-YTTRAMLRISSSQG---SL
A0A2E7EGG1      LRMFTSVLIQWWRILIPVT-LF---ALLISTVFVFWSFRPQYRASAWLQINGVQP---YV
A0A2E2N5A9      ----WMSVWLRKWLILGVM-LF---AALAAAWATSWMTPL-YRAGATLLVESERA---KL
A0A7C8AGA2      ----VAAILRRWPVLVATF-VI---VCVLGVPAILFLIEEKYDTEGAIRISPIVS---PI
A0A7C2FXP7      ----VPIMRRWKLVFFVFI-FL---CAATIPFIWSFVKPT-FEVTGAIRVAPILT---NI
A0A2E3GWC6      ----VQLALRNIIWLIIAG-AV---GLGLGIAAYKALGPS-YVAKSQILVKLKTS---VP
F0SLB0          ----VQLALRNIIWLIIAG-AV---GLGLGIAAYKALGPS-YVAKSQILVKLKTS---VP
A0A3L7NDH9      ----LQVLWRRKHLLVASC-AA---AGLLGGLYYTTSKRT-FEAEASILIVGSQG---DS
A0A1N6DAJ8      ----KALRRRWPLAVGAGL-LG---GVVLAVVTYFVVPPAKYTARSMLHVNSTQP---RI
A0A532UD06      ----ALIVLQHRWTILLTT-VG---FLVVGFAYIMKATPI-YTSASRLYVEQSGP---KI
A0A660URN1      ----A---LRHRWVILAAV-LV---SLIAAFGYILKATPI-YTSASKLYVEQSGP---KI
A0A517ZCB5      ----GRVVRNRLHIVLGIL-VS---VSILGGISYVLSPPV-YESAAELLVLQTGS---SV
A0A225EH48      TLPELVNALKRRLVLATFL-GM---LVGMAAAAAVWLALP-SGKHTAMALIQLKP---IV
A0A518INW8      PGDMTRILRRRWPLLMFGL-VV---GLGIAFAYHQNAKDV-FESSMEILVSQRAT---EL
A0A518JPH9      PSDVTRILRRRWPLLLFGL-VV---GLGIAYAYHKNTKVV-YQSSMDILVSQRAS---EL
A0A5C5VEK8      ----LALAWRGRWLILLGV-LI---GGTASWVYLQRVTPL-FLSQSRIYVERSLP---NL
A0A532UTJ0      ----AGIFRRWYIVLLVFL-LI---CGAGLPATLFLVKPI-YSVTGAIKVAPIIA---DI
A0A432MFP3      ----RGLARHWWQALALWV-VG---SAALAALVYLKFQPT-YRSFSLLQIERNQA---NP
A0A2E2CCW9      ----VRLLLRNKYLLVLGL-AA---GLLLGQAAYMKLGPI-FSADTKIQVSQKNP---VP
A0A3C0AGX3      ----VRLLLRNKYLLVLGL-AA---GLLLGQAAYMKLGPI-FSADTKIQVSQKNP---VP
A0A518AAQ5      ----VRLLFRNKYLIVGGL-VA---GLLLGQAAYMKLGPV-FSANTKIQVSQKNP---VP
A0A517QBG9      ----VRLLFRNKYLIVGGL-IA---GLLLGQAAYMKLGPI-FSATTKIQVSQKNP---VP
A0A518FTU3      ----VRLLFRNKYLIVGGL-IA---GLLLGQAAYMKLGPI-FSATTKIQVSQKNP---VP
A0A517WHH5      ----VRLLFRNKYLIVGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQKNP---VP
A0A5A8BGT3      ----VRLLFRNKYLIVGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQKNP---VP
A0A2E7K7A9      ----VRLLFRNKYLIVGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQKNP---VP
A0A517PTS5      ----VRLLFRNKYLIVGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQKNP---VP
A0A6I6AH34      ----VRLLFRNKYLIVGGL-LA---GLLLGQAAYMKLGPV-FSANTKIQVSQKNP---VP
A0A517VTK3      ----VRLLFRNKFLLISGL-AV---GLILGQAAYMKLGPI-YSASTKVQVSQKNP---VP
A0A517WQT4      ----VRLLFRNKFLLISGL-AV---GLILGQAAYMKLGPI-YSASTKVQVSQKNP---VP
A0A517VID8      ----VRLLLRNKYLLVIGL-VA---GLILGQAAYVKLGPI-FSATTKIQVSQKNP---VP
A0A517RK10      ----VRLLFRNKFLLVTGL-VA---GLLLGQVAYMKLGPI-YSASTKVQVSQKNP---VP
A0A518IH18      ----VRLLFRNKFLLITGL-IA---GLMLGQVAYIKLGPI-FSASTKIQVSQKNA---VP
A0A5C5XLF4      ----VKLALKNVVILGIAA-VA---GIGLGIFAYKILGPK-YTASSQILVKLKNP---VE
A0A2D5NDU9      ----LAMLWRGRWTILATT-LV---VTLAAFIYGEVTGSR-WRAESRLFINAGVN---AK
A0A1P8WP26      ----LRTVRHRSGILLLCL-VV---SGALGTLYYVTAPRI-YQSKASLFVVQIGS---GV
A0A3L7V1F3      ----LRTVRLRSGILVATL-VI---SSIAGATYFITAQRI-YQSNASLYIVRKGG---NV
D5SZ21          ----WRSVQYRKGLIILAV-LA---ASALGAAYYIVSTRY-YESKAELLILQTGS---KV
A0A286RGB6      ------FRRRWLAVAFLGM-LC---GAAAAAAAWFLFIPQ-YTATALIRVSSSVQ---SV
A0A518CHE5      ----LRVIMLRKKIIVVCV-IL---SSVAGAYRYSTQIPM-FQSTAQLLILSNGG---FQ
A0A1V5N3W2      ----RALRRRWYIVFLVFV-LL---AGAGLPAVWFLVKPK-YQAAAAIRVAPIIP---SI
A0A3E0MY27      ----RALQRRWLLAFVLGC-ML---GIPAAVITWFVVPIE-YTAEAFLQFNDEEV---II
A0A7C4Z5R7      ----NALRRRWWLALLLAI-PA---SAAAAAAVWFVYPPS-YTAQTLLHLSAIPP---RG
A0A2E0X9P6      ----RVLRNSWKWAIPLGL-LL---AAAAGCAVMYLHVPK-YQASALIQIESKVP---FV
A0A286RLF2      ----LVAVRRRWQIMLGAF-LA---VALLGALYYATAPRI-YSAKAELLILQTGD---NA
A0A517NSK8      ----IGVLRRRIGFIVLGV-TL---GLIAAGLYLLLTTPT-YRAEMEILVGQKSA---DM
A0A5C5Z0D6      ----LGMLRRRKGFIALGL-FL---GVAAAVLYFFLTPPT-YRAKMEILVGQKSG---DL
M5UE94          ----LGILRRRKGLIALGL-FI---GVAAAVLYYVLTPPT-FRAEMEILVGQKSG---DL
A0A2E8FLY0      ----LQVVRIRKGILFSTL-FI---STILGGLYFATATRL-YESKARLYVLQMGS---NV
A0A3D2U1E1      ----LHVVRVRKGLLFASV-FV---AVLLAGLYYATAPRL-YESSSRLYVLQMGS---NV
E8R3W3          DLLRALRRRWLMAAIVAPL-TA---VLAMVVAYPLVIKER-YSSEATLQLALFGR---SI
A0A5C5ZM48      ----GAVRRWWVVATPVGL-FL---SVAAVVAICLMSQPV-YRASAWLKIKAESP---YV
A0A5B9WF77      ----RGLARNWWRILLVWL-VV---SAPLVYVIYTLVEPT-YQASSLVLVESNQN---DP
A0A518BBX8      ----VQIVWERRWTFLVGP-VV---FLALATLYYVQATPR-FESEAKVLVINKKP---TL
A0A1P8WN28      ----LRVVNRHRMILVGLV-AA---AAFLAVVRHKQIPKQ-YESTARLMVRQVSA---DP
A0A3B9CTT0      ----LRVVNRHKLIIVGFV-AA---ACFLAVVKHNRQPQI-YEAGTKMLVRQTGS---D-
A0A518ALT3      ----RVFRNWWKFLVPCSL-LL---AVAAAALVLWLHVPQ-YEARALIKIESNIP---YI
A0A3M1QRP3      ----ARILRFKWTILVVFA-AV---CASALAGVWIFVEPQ-YRSIAQIEVRPQRD---MI
A0A517TMV0      ----VRIVRYRHQAVLWIV-AG---CLALGLTYYAMAPRY-YRSEARLQVIDQSG---ED
A0A3E0MY88      ----LRVVRSRINILIIAI-VV---SSLLGGLYYATATRY-FQANASVLIIRNGG---SE
A0A5B9QF68      ----LSLVRRRKQVVITSV-VI---SGLLGMTYYLLATRK-YASTAELLIIQQKQ---DQ
A0A5B9QGF0      ----VGIVRRRKQVVIASV-VI---SGLLGMTYFMLATRK-YASTAELLIIQQKQ---DH
A0A5C6CK24      ----VGIVRRRKQVVITAI-II---HVLLGTTYYMLATRK-YASTAELLIIQQKQ---DH
A0A2E3RCU8      ----LKIVWYRRNSMLVVG-IV---CAIVAAWYAATATRY-YQSSTSVLIVQNGS---AD
A0A1C3E6N1      ----WRSVQYRKGLIILAV-LA---ASALGAAYYIVSTRY-YESKAELLILQTGS---KV
A0A518GJT2      ----WRSVQYRKGLIILAV-LA---AIALGAAYYIVSTRY-YESKAELLILQTGS---KV
A0A2E8B0L9      ----LRVVYYRRSYVITCV-VV---SALLGGLYYYRASRV-YAATASLLITQTGT---DI
A0A5Q4GFE7      ----LQVVYHRKIYVVSAV-VV---ASLLGGLYYTTATPI-YQATSQLLILSTGP---DI
A0A257WS34      ----LHIVRLQMWTLILTV-AV---TGILGGIYYMTADRV-YDSSADVLVLQTNG---NA
A0A7C4LP10      ----LQVVRLRKWTLVACL-LV---AGAGGAVYYATATRI-YESSAEVLVLQTGG---NV
A0A517MLW3      ----GNGMMRRQRMVASVF-LL---VGLFAGIYYVTADRV-YQASAQLLVEEPSI---GV
A0A5B9QVD0      -------MYRRQRLVVGVF-AV---VGMLAGLFYVTADRV-YQADAQLLVEEPGL---GM
A0A3A0DET7      ----LALAWRNRWLLLLTT-LV---GGGAAWATVQRVTPR-YTSVSRLYVERALP---RV
A0A3B8PNV4      ----LQVVRIRRGILFCTL-FI---SIVLGGLYFATATRL-YESKARLYVLQMGS---NV
A0A3D1DR40      ----LQVVRIRRGILFCTL-FI---SIVLGGLYFATATRL-YESKARLYVLQMGS---NV
A0A2E7RYU8      ----LQVVRIRRGILFCTL-FI---STVLGGLYFATATRL-YESKARLYVLQMGS---NV
A0A3B8LXG8      ----LQVVRIRRGILFCTL-FI---STVLGGLYFATATRL-YESKARLYVLQMGS---NV
A0A286RD13      ----HAVRRRWWLILIMGV-LA---SAGVMVFAWRTIPVE-YTATAWLQVSLERP---RV
A0A2E3GWX1      ----LQSMLRRKWIVMGWL-TI---TVGLGITYFVLAPRL-YESSAELLILHTGE---GN
F0SG60          ----LQSMLRRKWIVMGWL-TI---TVGLGITYFVLAPRL-YESSAELLILHTGE---GN
A0A2E9VST2      ----VQSLIRRKWTVMAWL-TL---TISLGMTYFALATRK-YESSAELLVLHTGE---GN
A0A356A6X2      ----LQSLLRRKWTVMAWL-TF---TVSLGMTYFALAPRK-YESSAELLVLHTGD---GN
A0A5C5XLM3      ----LQSLLRRKWTVMAWL-TF---TVSLGMTYFALAPRK-YESSAELLVLHTGD---GN
A0A7C5FXU1      ----FRRY-WALATILGLL-VG---AAAGLSVWFLIPQKY-TATALLRVAANPEA---IL
A0A3M1VCL4      ----AHAVRMRKAILLGTL-LI---AAVFGALYYLTATRY-YASNARLLVLQTNA---SV
A0A5C5V7Z9      ----LRLMQRNQSTIAWCV-AG---CVALAMAYYVAAPRI-YRSTAKLLLIEQDS---DK
A0A5C5YT05      ----LRLMQRNQATLAWCV-AG---CTVIAMAYYVAAPRF-YSSTAKLLLIEQDP---DS
A0A518D7F9      ----LRVVQRRQKLVALIV-AG---HLAVGAAYYFTATRY-YESTAKLLVIEQNP---DQ
A0A5C5ZIP0      ----VRLAEQRHQTLLWIV-AG---CLGIGALYYGFAPRY-YRSEAKLMVIQQVA---DE
A0A518KBK3      ----TRVVQYRRNTVLWTL-AG---CLAIGAVYYVTAKRY-YRSTAKLLVVDQSA---GE
A0A5C6AKF9      ----ARVIRYRQQTVLWTL-AA---CLVVGAAYYATAPRY-YRSTAKLLVVDQSG---GE
A0A6M5Z0K7      ----AALRRRWQTALGVAL-VL---GAGFAAAVWVLRPDK-YTSVALLQVSSAEL---KV
A0A350CI62      ----LRTVRFRKGILVASL-VM---STILGMTYYITAERI-YESTASLYVVRKGS---GV
A0A4P5WQK6      ----LRTVRFRKGILVASL-VM---STILGMTYYITAERI-YESTASLYVVRKGS---GV
A0A3C1X4W5      ----LRTVRLRKGILVAAL-VM---STILGMTYYITAERI-YESTASLYVVRKGS---GV
A0A3D3W3A7      ----LRTVRLRKGILVAAL-VM---STILGMTYYITAERI-YESTASLYVVRKGS---GV
A0A518DRX3      ----LQVLRRRKGYVLAML-AG---AAVLGAAYYVAAPRM-YEAKASLLITQTGP---DV
A0A518DZF9      ----LQVLRRRKGYVLAML-AG---AAVLGAAYYVAAPRM-YEAKASLLITQTGP---DV
A0A518AKT8      ----------WRTL-SYRR-YY---VIASLVVCCVLGFAY-YLAAPRYYQSTAKL---LI
A0A5C5ZR72      ----WVFTMSWRTVVPIGL-LL---AIPVAAVIYLTYTPM-YEATGLIRIEDSPQ---YV
A0A7C5R0U3      AATVRLVRRRWPVL------------AAAVVIALLVAIVQ-FSTAPRIYESRATV---LV
A0A517TY85      ----KVLRGRWPVVIPLGL-VL---AAAAAAIVLLLYVPK-YRASALIKIEAQPT---FI
A0A5B9QEI7      ----RVFTGWWKWVVPLGL-IL---AAGAGAIVLMFYVPK-YEASALVKIEAETP---FI
F0SI78          ----RSIVWERKWLLIFFA-AL---GAAIGYLEFTKQPPV-YRSSASILVDRYQP---RM
A0A517MDV3      ----WGILRRRWLILFLGL-AF---GISLAVFYAFVAPKV-YASRVEVLVMRKDP---GL
A0A518IQ30      ----LRMLRRKKQYVAFSL-LV---TSALGAFYYLTADKV-YEARAQLLVTQTSP---DM
A0A517LWP4      ----LRMLRRKKQYIAFSL-LV---TCALGAFYYLTADKV-YEAKAQLLVTQTSP---DM
A0A518JNW8      ----LRMLRRKKQYIAFSL-LV---TCALGAFYYLTADKV-YEAKAQLLVTQTSP---DM
A0A2E7ENQ5      ----FRIIRHRRIQVVSCL-VA---TALLGALYYCTAAPL-YSARVSLMMM---------
A0A7C2KUQ9      ----SMMLRHKWLALGLFV-GL---AVVLGGGVWWTTVPL-YKATA---VIEVSP---II
A0A7C5BZF0      ----WLAIRYRRNLLLGAI-AA---SVAIGILYLLFATRY-YGATAQVLVVEAD------
A0A1G3AQE9      ----AVTVRHRKNVVILAL-AV---AAFLGALSYMTATRY-YSASAGVWVL---------
A0A3L7UQT9      ----LHAVRVRRGTLLAAL-LI---SASLGAAYYLTATRM-YDAHAQVRIVQSER---NH
A0A4P5YBU2      ----LHAVRVRRGTLLAAL-LI---SASLGAAYYLTATRM-YDAHAQVRIVQSER---DH
A0A7C7V5U8      ----ALAVRYRKHVLLVTL-LV---AALLGGLYYATATRY-YAARASLLVQHSGS---DI
                                                                            

A0A5S9IPR9      QGL--------------------------------PVNQTYYSKR----------LSTQ-
A0A533Q9U4      -----------------------------------NVGFQQVISESQFTPLDF--YTNQ-
A0A1U9NNE1      LFD--------------------------------------DAETQDVMPNYQGFMNTQ-
A0A2G2JCA2      AFQ--------------------------------DRSDS------------RKFVANQ-
A0A533Q6B7      -----------------------------------NVGIQ-QILSEDKNIYNF--YTDQ-
A0A5S9IJB5      -----------------------------------NLARDRIDLSMFRNMQNY--LQTQ-
A0A1G2XVR0      LTF--------------------------------QA------FSFEGNNSSS--FTTN-
A0A1G3B0P0      LTF--------------------------------QA------FSFEGNNSSS--FTTN-
A0A1E3X4X0      VTG--------------------------------KDIQEVVTYDPYATRGEF--YKNQ-
A0A286U4B3      LSF--------------------------------EEV-----MSTEGGRTDF--YKTE-
A0A5C6DDS2      LSF--------------------------------EDV-----VNTGGGLADF--YKTE-
A0A2E3GW02      PIEGIDPL---------------------------SGQTD------------P--LSTH-
A0A5B9QNZ7      PMMAQNQ----------------------QGAPQQEIGDS------------L--LATH-
A0A1Z8N7H5      EDS--------------------------ALGIN-RNSQH------------L--MPTH-
A0A1G2YPI3      FAE--------------------------TQEGVMTQSKN------------Y--LYTQ-
A0A1U7CZ81      YGQQ-------------------------NSNAQAQPIER------------F--IGTQ-
A0A142YNY8      FGSS-------------------------SRGDGSSSIER------------I--IETA-
A0A1U7GLS6      FGGI-------------------------APGQANERTV-------------A--IETE-
A0A532UIN2      FSE--------------------------TETSVMTQSKN------------Y--LYTQ-
A0A0S8KNX5      LTDV-------------------------PDSGEISNYSS------------F--MNTQ-
A0A3D3UVZ8      LSGE-------------------------QDRGEISNYES------------F--MNTQ-
A0A517NFU9      TNNGTIT---------------------GANASGDNIQED------------Q--LATH-
A0A5C5YWH4      TSSGTLS---------------------GAAASGDSIQDD------------Q--LATH-
A0A3D2TNK4      VATVGDQ----------------------------SIVSN------------I--LDTH-
A0A7C1Y4F0      INE--------------------------YEGVM-ARSGN------------Y--LYTQ-
A0A6I0ENW6      YKIE-------------------------ETGVM-PLYQQ------------F--VNTN-
A0A6L3A0B7      YKIE-------------------------ETGVM-PLYQQ------------F--VNTN-
A0A0J1B4A0      ANTGVNN----------------------GAKDMASMQED------------V--LSTH-
A0A142WSB9      INSQE------------------------------ARRYS------------D--RSQH-
M5SZR3          E----------------------------IKGQN-AFYND------------Y--MSTH-
M5TW92          E----------------------------IKGQN-AFYND------------Y--MSTH-
A0A2S8FKY2      AFK--------------------------------TIEQT------------N--RNDY-
A0A517N8P6      NTGSASEIVVETAPNLAFIQAEMTSQDVLSDAIA--IGQL------------T--AFDET
A0A432MJP4      LKVTEA-----------------------DAGGG-EGGVD------------R--FPTY-
M5UQ35          NRASSSS---------------------LLEGAT-TIEDV------------I--LSTH-
A0A0S8FY64      SPFEDMQ--------------------------E-RRDKE------------Y--FATQ-
A0A1N6KFT7      LNVSAYT---------------------DPNRIS-EGSED------------P--VPTH-
L0DFG4          LNVTAYT---------------------DPNRIN-EGSED------------P--VPTH-
A0A5C5XXG1      GCKRSTCQSKRFHVDDKSYRPVRLAKPVEPRQVL-TPPPP------------G--RRDK-
A0A7C7YUM8      GVLSEIA--------------------------S-LTSDP------------A--AEAE-
A0A7C2AHI6      GLLANLS--------------------------L-LESTP------------A--AARE-
A0A518BJJ1      GVLGELA--------------------------A-LSSAP------------A--AASE-
A0A518D182      ATLSELS--------------------------L-FGSAP------------R--ASAE-
A0A5C5WTY6      GDS--------------------------DTSND-VVDED------------V--LANH-
A0A5C5Y033      NNS--------------------------GTGTD-VVDED------------V--LANH-
A0A5C6G1Y2      NNS--------------------------GTGTD-VVDED------------V--LANH-
A0A354PDV6      --E--------------------------SNATN-VVEED------------I--LANH-
A0A5C6FZ02      -AS--------------------------SSSNE-MVEED------------I--LANH-
M5TIT3          EGD--------------------------STGQA-IVDED------------I--LANH-
A0A5M6CY44      GGT--------------------------GTGTG-MVEED------------T--LANH-
F2AXG2          GGD--------------------------STGTD-MVDED------------I--LANH-
M2BB46          GGD--------------------------STGAD-MVDED------------I--LANH-
L7CLQ6          GGD--------------------------TTGTD-MVDED------------I--LANH-
A0A0J1B719      GGN--------------------------STGTD-MVDED------------I--LANH-
Q7UF18          GGN--------------------------STGTD-MVDED------------I--LANH-
A0A2G1W1E0      GGN--------------------------STGTD-MVDED------------I--LANH-
K5E235          GGN--------------------------STGTD-MVDED------------I--LANH-
A0A5C6FFI9      TTSGTMS---------------------NSQASGDTIQED------------L--LATH-
A0A5C5WDJ1      TSRGTIN---------------------GNSGSGESIRDD------------Q--LATH-
A0A5C5X547      I-FNTAD---------------------QVQTSA-ITYKL------------F--QSTQ-
A0A353FIP5      --EG-------------------------SAVGG-ILGDL------------S--MLSS-
A0A5B1CIK7      G-SE-------------------------GNATN-VVDED------------I--LANH-
A0A5C5WHS2      G-AG-------------------------SAATD-IIDED------------I--LANH-
A0A5C6B6G8      GEGS-------------------------ATGQG-MVEED------------T--LANH-
A0A5C5ZZN3      G-GD-------------------------STGQS-IVDED------------I--LANH-
A0A5C5XS91      D-SD-------------------------GTGQE-MVEED------------I--LANH-
A0A5C6C4E6      D-KD-------------------------GTGQE-MVEED------------I--LANH-
A0A2E1VVJ1      --SG-------------------------GFQSG-FLSEV------------A--VLSPV
A0A3M2AEL0      --PE-------------------------GSEQS-LLREF------------T--LFEQ-
A0A2A2W9R6      ASTGVRG---------------------TSDGAV-TMQDE------------I--LSTH-
A0A518HKC1      ASTGVRG---------------------TSDGAV-TMQDE------------V--LSTH-
A0A518L3P0      ASTGVRS---------------------TSDGAV-TMQDE------------I--LSTH-
A0A255R1S0      ATTGVRE---------------------ASDNAV-TIQDK------------I--LSTH-
A0A5B9MKP1      AATGVRD---------------------ASDGAV-TMQEE------------I--LSTH-
A0A0S8J591      EAG--------------------------------ARRMA-TEE--------F--YNSQ-
A0A351FYP6      LGM--------------------------------QATQS-SFDPY------F--ISTE-
A0A532UT69      ITE--------------------------------TEQGVLTQSKN------Y--LYNQ-
A0A2D5AWU0      LNG--------------------------------NAGST-GKART------L--LKQQ-
A0A1G2YQB7      LFG--------------------------------GEEAI-PMYRS------Y--MYTQ-
A0A353P687      LFG--------------------------------GEEGI-PMYRN------Y--MYTQ-
A0A356EME5      VFA--------------------------------IEDKS-SGY-----------VETQ-
M5RT57          AYT--------------------------------TPEPQ-MNPED------F--TETQ-
A0A356KTN1      RYE--------------------------------MYSSD-YVATE------Y--LNTQ-
A0A518HFS8      LFE--------------------------------TRESG-VSYAI------Y--QHTQ-
L0DC26          LLQ--------------------------------TGEVQ-SDYGS------Y--QRTQ-
A0A3L7P4E4      PVN--------------------------------TVNGL-APNGR------SDPLASD-
A0A3L7PEB5      PVN--------------------------------SVNGF-DPSGQ------SDPLASD-
A0A1U9NL64      LDE--------------------------------TQGVM-TQSKN------Y--LYTQ-
A0A2N1UCJ3      IAD--------------------------------YEGTM-TQSKN------Y--LYTQ-
A0A7C4EK84      LSD--------------------------------SPWDR-TSF-N------Y--LNTQ-
A0A7C3F0T2      IPG--------------------------------TEELT-FGPWN------Y--LNTQ-
A0A2E0X4J3      IDS--------------------------------GMGLS-QSK-G------F--LYTQ-
A0A5C5YU10      LSS--------------------------------DMQLG-HSN-S------Y--LFTQ-
A0A517MPZ6      FAS--------------------------------DAQRG-TSS-S------Y--LYTQ-
A0A5C6CNV7      LEQ--------------------------------EVQLG-NSA-S------Y--LYTQ-
A0A518K5H4      LAG--------------------------------ESLGA-FST-K------H--LYTQ-
A0A5C6AA28      LNG--------------------------------DALGT-FSN-K------Y--LFTQ-
A0A2E7ESJ6      IPL--------------------------------TGVES-QYITTS-----A--EAKH-
A0A2E9VK20      IRE--------------------------------EGNRI-IAG--------E--RSAH-
A0A3D4PJK1      IRE--------------------------------EGNRI-IAG--------E--RSAH-
A0A355AI52      NPT--------------------------------SMTGS-HNDVA------A--MATY-
A0A354PCQ3      QGV--------------------------------MPVVK-N----------L--AQTE-
A0A0S8GZ23      LTG--------------------------------AHESG-GISNYDI----Y--VNTQ-
A0A1I3DDV4      SDK--------------------------------GESSW-AADGVQDE---I--LANH-
A0A2E0SMM6      TDD--------------------------------VSGQA-LLKN-------Q--MPTY-
A0A3L7SI46      LDT--------------------------------TNQSN-QRSIQD-----I--MPTY-
A0A5B9PJZ8      ISE--------------------------------EDGYA-QD---------T--VEKY-
A0A2S8G191      LKQ--------------------------------DGEKT-GDFDV------Y--KLTH-
A0A2E7EGG1      AFP--------------------------------DREVR-DRDSNRK----F--VHTQ-
A0A2E2N5A9      LAI--------------------------------EQANQ-NETLNND----F--LQTE-
A0A7C8AGA2      LFE--------------------------------TEDRL-PNYQN------F--MNTQ-
A0A7C2FXP7      MSG--------------------------------EHDRG-EISNYHS----F--MNTQ-
A0A2E3GWC6      LGD--------------------------------DDNRP-TAG--------E--RSAH-
F0SLB0          LGD--------------------------------DDNRP-TAG--------E--RSAH-
A0A3L7NDH9      LDT--------------------------------SLTGG-RNDPT------A--MATY-
A0A1N6DAJ8      LLK--------------------------------VGENE-SDYVA------Y--QRTQ-
A0A532UD06      INE--------------------------------YEGVM-TQSHN------Y--LYTQ-
A0A660URN1      ITE--------------------------------YKGVM-TQSKN------Y--LYTQ-
A0A517ZCB5      LDS--------------------------------ERNPQ-GTLSD------Q--MPNF-
A0A225EH48      SAG--------------------------------KQSMG-EDFES------F--KQTQ-
A0A518INW8      MTS--------------------------------SGPDG-RSFDANVVQADL--LATH-
A0A518JPH9      MTS--------------------------------NSPNG-RSFDASVVRADL--LATH-
A0A5C5VEK8      LGA--------------------------------EYQVG-RSNS-------Y--LFTQ-
A0A532UTJ0      MTD--------------------------------EGDHG-GISNYES----F--MNTQ-
A0A432MFP3      YGS--------------------------------LEDPR-SIE--------Y--LQTQ-
A0A2E2CCW9      IKE--------------------------------GEIQT-FG---------E--LTAH-
A0A3C0AGX3      IKE--------------------------------GEIQT-FG---------E--LTAH-
A0A518AAQ5      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A517QBG9      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A518FTU3      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A517WHH5      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A5A8BGT3      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A2E7K7A9      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A517PTS5      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A6I6AH34      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A517VTK3      IKE--------------------------------GEIQT-FG---------E--LTAH-
A0A517WQT4      IKE--------------------------------GEIQT-FG---------E--LTAH-
A0A517VID8      IKE--------------------------------GEIQT-FG---------E--LTAH-
A0A517RK10      IKE--------------------------------GEVQT-FG---------E--LTAH-
A0A518IH18      IKE--------------------------------GEAQT-FG---------E--LTAH-
A0A5C5XLF4      IRE--------------------------------GGNRV-IVG--------E--RSAH-
A0A2D5NDU9      AGP--------------------------------EVMAL-GFGATN-----Y--AQTQ-
A0A1P8WP26      TQD--------------------------------SVQGA-SDPSR------S--MPTF-
A0A3L7V1F3      TEE--------------------------------TPNSG-SSANS------D--MPTF-
D5SZ21          LDG--------------------------------APEGA-AMKD-------L--MPTY-
A0A286RGB6      LFP--------------------------------TQQGA-GPSFDI-----Y--KATQ-
A0A518CHE5      TDD--------------------------------VSGQS-LLKN-------Q--MPTY-
A0A1V5N3W2      LFS--------------------------------DKDSE-GVIPMYES---F--MNTQ-
A0A3E0MY27      DAQ--------------------------------SRSDG-RRIDD------P--LQTH-
A0A7C4Z5R7      VLT--------------------------------ESTPA-SDIAA------F--QRTT-
A0A2E0X9P6      AFE--------------------------------QPSTV-RDEAR------Y--FNTQ-
A0A286RLF2      LSP--------------------------------TIEAQ-GSRENS-----L--IPTF-
A0A517NSK8      VNG--------------------------------ASSNT-SVEGANTDGD-V--LSTH-
A0A5C5Z0D6      VKG--------------------------------ATSDS-SVEGAEAAED-V--LSTH-
M5UE94          VRG--------------------------------ANSSS-SVEGVDTKED-V--LSTH-
A0A2E8FLY0      LKT--------------------------------EQENQ-GGVQE------N--MATN-
A0A3D2U1E1      LQE--------------------------------SMESQ-GGVRE------N--MANY-
E8R3W3          VFN--------------------------------NGVSM-GDAHA------Y--MRTQ-
A0A5C5ZM48      VFK--------------------------------DEETA-LDAKR------F--VETQ-
A0A5B9WF77      FSA--------------------------------FSNPA-LSGQAPT----Y--LKTQ-
A0A518BBX8      MTD--------------------------------RAGLP-VSHFED-----Y--VETH-
A0A1P8WN28      KSQ--------------------------------SNSAT-EG---------L--LASY-
A0A3B9CTT0      MAN--------------------------------FGAPL-EA---------A--MAGY-
A0A518ALT3      AFD--------------------------------SNNSN-SRDSDR-----Y--VQTQ-
A0A3M1QRP3      AFK--------------------------------TDNDG-ITHFYQQ----F--LTTQ-
A0A517TMV0      LAS--------------------------------ISEQS-GTDS-------L--MATQ-
A0A3E0MY88      GSS--------------------------------SMGID-GENRR------Y--MPTH-
A0A5B9QF68      LAT--------------------------------VGDHE-SSED-------T--MATH-
A0A5B9QGF0      LAT--------------------------------VGDHE-SSED-------T--MATN-
A0A5C6CK24      LAT--------------------------------VGDHE-SSED-------T--MATN-
A0A2E3RCU8      HGN--------------------------------VLGVN-RNDQQ------L--MPTH-
A0A1C3E6N1      LDG---------------------------------APEG-AAMKD------L--MPTY-
A0A518GJT2      LDG--------------------------------AAPEG-AAMKD------L--MPTY-
A0A2E8B0L9      LNS--------------------------------TMMPN-AQQDA------L--IPTY-
A0A5Q4GFE7      LSP--------------------------------TLTAE-SSRQA------L--IPTY-
A0A257WS34      LDG--------------------------------KDNNQ-QSIQN------L--MPTY-
A0A7C4LP10      LDQ--------------------------------RDATP-KTIQD------Q--MPTY-
A0A517MLW3      FPG--------------------------------ASPTA-QSN--------K--LPTQ-
A0A5B9QVD0      LPG--------------------------------SGVMA-QPN--------K--LPTQ-
A0A3A0DET7      LES--------------------------------EAPVV-QSAT-------Y--LYTQ-
A0A3B8PNV4      LQN--------------------------------DQENQ-GGVQE------N--MATN-
A0A3D1DR40      LQN--------------------------------DQENQ-GGVQE------N--MATN-
A0A2E7RYU8      LQN--------------------------------DQENQ-GGVQE------N--MATN-
A0A3B8LXG8      LQN--------------------------------DQENQ-GGVQE------N--MATN-
A0A286RD13      LFD--------------------------------TKDDD-PLLRN---------RQTQ-
A0A2E3GWX1      MDE--------------------------------TQQSQ-RTLQD------H--LPTY-
F0SG60          MDE--------------------------------TQQSQ-RTLQD------H--LPTY-
A0A2E9VST2      VDQ--------------------------------TQQSQ-RTLQD------Y--LPTY-
A0A356A6X2      VDQ--------------------------------TQQSQ-RTLQD------Y--LPTY-
A0A5C5XLM3      VDQ--------------------------------TQQSQ-RTLQD------Y--LPTY-
A0A7C5FXU1      FSN--------------------------------AFQSA-TFD-I------Y--RSTQ-
A0A3M1VCL4      LQE--------------------------------QQSTP-RAVLD------Q--LPTL-
A0A5C5V7Z9      VSG--------------------------------VADAG-RAD-D------V--MATH-
A0A5C5YT05      VSS--------------------------------VAEGG-RAD-D------L--MATH-
A0A518D7F9      LSS--------------------------------MGDQA-GSD-N------V--TANH-
A0A5C5ZIP0      LSS--------------------------------MSDQI-GSD-N------L--MTTH-
A0A518KBK3      LTT--------------------------------MNDQA-GAD-N------L--MATH-
A0A5C6AKF9      MVS--------------------------------LNEQA-GAD-N------L--MATH-
A0A6M5Z0K7      IQE--------------------------------GSRSN-DGGI-------Y--MRTQ-
A0A350CI62      TSD--------------------------------ATSNS-ANPVT------E--MPTY-
A0A4P5WQK6      TSD--------------------------------ATSNS-ANPVT------E--MPTY-
A0A3C1X4W5      TAD--------------------------------ATSTS-ANPVT------E--MPTY-
A0A3D3W3A7      TAD--------------------------------ATSTS-ANPVT------E--MPTY-
A0A518DRX3      MSG--------------------------------STPAA-SGGDS------L--IPTY-
A0A518DZF9      MSS--------------------------------GTASA-ASGDS------L--IPTY-
A0A518AKT8      NER--------------------------------KADEL-TSVGDQIANDDL--MANQ-
A0A5C5ZR72      AFR--------------------------------SGSVD-AGGRKFIQ--------TQ-
A0A7C5R0U3      SPR--------------------------------TADAS-EQGGRSLRLADV--MPTY-
A0A517TY85      AFA--------------------------------QDKVS-ATDDRYVQ--------TQ-
A0A5B9QEI7      AFQ--------------------------------QGALN-KDSERYVQ--------TQ-
F0SI78          PIE--------------------------------GIDPL-SGQTD------P--LSTH-
A0A517MDV3      PQM--------------------------------SDSQT-GAAPQQEVGDAL--LATH-
A0A518IQ30      LNA--------------------------------GVSSS-VTNDT------L--VATH-
A0A517LWP4      LNA--------------------------------GVSSN-LNNDA------L--VATH-
A0A518JNW8      LNA--------------------------------GVSSN-LNNDA------L--VATH-
A0A2E7ENQ5      -YH--------------------------------GGEDS-LTGSDTYRRG-M--LPTY-
A0A7C2KUQ9      QRI--------------------------------LYRTD-DNGPIQWYTE-Y--LNMQ-
A0A7C5BZF0      -DE--------------------------------RGTPN-FASEDRWQRT-L--MPTH-
A0A1G3AQE9      -EL--------------------------------GSSSA-GSVEDNLHQT-Q--LPTQ-
A0A3L7UQT9      DSL--------------------------------TSSPQ-SSQANSDVFQ-M--MATY-
A0A4P5YBU2      NSL--------------------------------TSSPQ-SSQANSDVFQ-M--MATY-
A0A7C7V5U8      TET--------------------------------SLRPE-GNRNQG-----L--MPTF-
                                                                            

A0A5S9IPR9      -------VAILQS----------------------RAMA-----------KKVIERLPEA
A0A533Q9U4      -------CEIIKS----------------------RSIA-----------KKVIDTLNLK
A0A1U9NNE1      -------AELMSS----------------------NEIL-----------NRVAEDMAKR
A0A2G2JCA2      -------VALMRS----------------------HIVL-----------GSVVSNKDVS
A0A533Q6B7      -------CEIIKS----------------------RLIA-----------KKVIDILDLK
A0A5S9IJB5      -------YDLIVS----------------------TPLL-----------QKTFDHFNFA
A0A1G2XVR0      -------ERILRS----------------------RSLA-----------QKVLSTMDYK
A0A1G3B0P0      -------ERILRS----------------------RSLA-----------QKVLSTMDYK
A0A1E3X4X0      -------HEILKS----------------------RSLA-----------KRVIEELKLG
A0A286U4B3      -------CEVLKS----------------------LTLA-----------KRVVDSLRLD
A0A5C6DDS2      -------CEVLQS----------------------RTLA-----------KRVINRLRLD
A0A2E3GW02      -------IALFNT----------------------PVIL-----------KKAVE-----
A0A5B9QNZ7      -------MEIIRS----------------------PRVI-----------GDAVD-----
A0A1Z8N7H5      -------QQLIVS----------------------QPVL-----------ENAIQ-----
A0A1G2YPI3      -------AELLKS----------------------TPIL-----------TAVLD-----
A0A1U7CZ81      -------IAFITT----------------------NTVL-----------KPAIG-----
A0A142YNY8      -------RAALIS----------------------DRVL-----------NGAII-----
A0A1U7GLS6      -------MGRIRT----------------------DRVI-----------NDALG-----
A0A532UIN2      -------SELLKS----------------------TPIV-----------AAVLD-----
A0A0S8KNX5      -------AEMITS----------------------SRVV-----------RRVAD-----
A0A3D3UVZ8      -------AEKITS----------------------NSVV-----------QRVAD-----
A0A517NFU9      -------LRLFVG----------------------RRML-----------AEAIQ-----
A0A5C5YWH4      -------MRLFVS----------------------RRLL-----------SDAIK-----
A0A3D2TNK4      -------SDLVTS----------------------PVVI-----------EQAIE-----
A0A7C1Y4F0      -------GELLRS----------------------TPVI-----------GPVVD-----
A0A6I0ENW6      -------VMLIRG----------------------AGVL-----------NPVLN-----
A0A6L3A0B7      -------VMLIRG----------------------AGVL-----------NPVLN-----
A0A0J1B4A0      -------MELFAS----------------------PKIL-----------ENAIQ-----
A0A142WSB9      -------VHFLTS----------------------DAIA-----------AIAIE-----
M5SZR3          -------QALIKS----------------------SVII-----------SRASQ-----
M5TW92          -------QALIKS----------------------SVII-----------SRASQ-----
A0A2S8FKY2      RTFKNTQRQLMVT----------------------PFVL-----------NSALS-----
A0A517N8P6      PADVSSLINMIRA----------------------NLVL-----------SPPFE-----
A0A432MJP4      -------AAILSS----------------------PHIV-----------GRAIE-----
M5UQ35          -------MELFRS----------------------RKVI-----------ERAIS-----
A0A0S8FY64      -------VSLITS----------------------RAVL-----------DKALED----
A0A1N6KFT7      -------MVLIRS----------------------PLVI-----------QAAVDS----
L0DFG4          -------MVLIRS----------------------PLVI-----------QTAVES----
A0A5C5XXG1      -------LAAVKG----------------------RSVY-----------SL--------
A0A7C7YUM8      -------IALIQS----------------------RSLA-----------EVTVGPQAPW
A0A7C2AHI6      -------MALLSS----------------------RSLI-----------ETTAGS----
A0A518BJJ1      -------IALLRS----------------------RSLA-----------EKTIQS----
A0A518D182      -------IALLSS----------------------RALA-----------EQVVAT----
A0A5C5WTY6      -------VELIRS----------------------RRTI-----------ESALN-----
A0A5C5Y033      -------MGLIRS----------------------RKIV-----------SEALA-----
A0A5C6G1Y2      -------MGLIRS----------------------RKIV-----------SEALA-----
A0A354PDV6      -------MQMLRS----------------------RKIV-----------EGALT-----
A0A5C6FZ02      -------IELLLS----------------------RKIV-----------GEAMAA----
M5TIT3          -------IELIQS----------------------RMIV-----------GEALE-----
A0A5M6CY44      -------IELISS----------------------RMIV-----------DEALK-----
F2AXG2          -------MELLLS----------------------RKIV-----------GEALDP----
M2BB46          -------MELLLS----------------------RKIV-----------GEALDP----
L7CLQ6          -------MELIQS----------------------RMIV-----------GEALE-----
A0A0J1B719      -------MELIQS----------------------RMIV-----------GEALE-----
Q7UF18          -------MELIQS----------------------RMIV-----------GEALE-----
A0A2G1W1E0      -------MELIQS----------------------RMIV-----------GEALE-----
K5E235          -------MELIQS----------------------RMIV-----------GEALE-----
A0A5C6FFI9      -------VQLLTS----------------------RLLI-----------SDAIA-----
A0A5C5WDJ1      -------MRLFIA----------------------RKVL-----------TQAIE-----
A0A5C5X547      -------AQLIRS----------------------DLNI-----------SQVLE-----
A0A353FIP5      APPATAELEVLQS----------------------RMIVDPVV-------APQSE-----
A0A5B1CIK7      -------IELLQS----------------------RLIV-----------GEALE-----
A0A5C5WHS2      -------MELLQS----------------------RLIV-----------GEALE-----
A0A5C6B6G8      -------MELIAS----------------------RMIV-----------GDALQ-----
A0A5C5ZZN3      -------IELIQS----------------------RMIV-----------GEALE-----
A0A5C5XS91      -------IQLIKS----------------------RMIV-----------GEALE-----
A0A5C6C4E6      -------IQLIKS----------------------RMII-----------GEALQ-----
A0A2E1VVJ1      QPPESKEAEILGS----------------------RKLVRMVAAHPLSTDGPEFA-----
A0A3M2AEL0      SPATLAEMEVLGS----------------------RAVAQAVA---LPKGESDLA-----
A0A2A2W9R6      -------IELFGS----------------------PKVL-----------QQAID-----
A0A518HKC1      -------IELFSS----------------------PKVL-----------QQAID-----
A0A518L3P0      -------IELFGS----------------------PKVL-----------QQAID-----
A0A255R1S0      -------IALMTS----------------------PKVL-----------GQAAD-----
A0A5B9MKP1      -------VELFGS----------------------PKIL-----------KQAIE-----
A0A0S8J591      -------VENLRS----------------------RRIA-----------RKLYNDMGMY
A0A351FYP6      -------FEKIQS----------------------QKVL-----------DEV-------
A0A532UT69      -------AALLKS----------------------TPIL-----------TAV-------
A0A2D5AWU0      -------QILVKS----------------------PAIL-----------KPL-------
A0A1G2YQB7      -------ADLIIS----------------------DRVL-----------QRV-------
A0A353P687      -------ADLITS----------------------DRVL-----------QRV-------
A0A356EME5      -------KEMIRS----------------------ARVL-----------RPV-------
M5RT57          -------IELIRS----------------------SLVA-----------EQV-------
A0A356KTN1      -------MRILES----------------------HSLA-----------VDA-------
A0A518HFS8      -------TTLIRS----------------------NKVL-----------EAA-------
L0DC26          -------LALLES----------------------RLVL-----------SAA-------
A0A3L7P4E4      -------IQTIMS----------------------ELTV-----------RPA-------
A0A3L7PEB5      -------VRLILS----------------------EVTV-----------GPA-------
A0A1U9NL64      -------AELMKS----------------------TPII-----------KEA-------
A0A2N1UCJ3      -------SEIIKS----------------------TPII-----------AKV-------
A0A7C4EK84      -------AELMRS----------------------TPIL-----------AGA-------
A0A7C3F0T2      -------CALFKS----------------------TPIA-----------ASA-------
A0A2E0X4J3      -------AEMLRS----------------------TPVL-----------AAA-------
A0A5C5YU10      -------KELIKS----------------------TGVL-----------ASV-------
A0A517MPZ6      -------AELITS----------------------TPVL-----------AAA-------
A0A5C6CNV7      -------AELIRS----------------------TPVL-----------AAA-------
A0A518K5H4      -------AQLICS----------------------PSVL-----------NAA-------
A0A5C6AA28      -------AELIRS----------------------SSVL-----------SAA-------
A0A2E7ESJ6      -------AIVIVS----------------------PRIL-----------TQA-------
A0A2E9VK20      -------VEIIRS----------------------PKVV-----------ERA-------
A0A3D4PJK1      -------VEIIRS----------------------PKVV-----------ERA-------
A0A355AI52      -------EKLVSS----------------------PLVL-----------QSA-------
A0A354PCQ3      -------KALFLN----------------------PIVL-----------GPV-------
A0A0S8GZ23      -------AQIIRD----------------------NRVL-----------QNV-------
A0A1I3DDV4      -------MEIVSS----------------------RRII-----------GNA-------
A0A2E0SMM6      -------TRLLSS----------------------DHVL-----------QSA-------
A0A3L7SI46      -------QKVLTS----------------------DRVL-----------EGA-------
A0A5B9PJZ8      -------IEILRS----------------------TATL-----------KNA-------
A0A2S8G191      -------RQLLRG----------------------PFVI-----------NAA-------
A0A2E7EGG1      -------VELLRS----------------------PLIL-----------GRV-------
A0A2E2N5A9      -------IELLKSRGLAERVVRQLDLVNHPEFAAQPLSV-----------GQGVGTWFAR
A0A7C8AGA2      -------AELIRS----------------------NNIL-----------NDV-------
A0A7C2FXP7      -------AVMITS----------------------GKVV-----------ERV-------
A0A2E3GWC6      -------VEIIRS----------------------PRVI-----------ERA-------
F0SLB0          -------VEIIRS----------------------PRVI-----------ERA-------
A0A3L7NDH9      -------EKLIAS----------------------PLVL-----------ESA-------
A0A1N6DAJ8      -------LALLKS----------------------RLVL-----------STA-------
A0A532UD06      -------SELIRS----------------------IPII-----------SDA-------
A0A660URN1      -------GELIKS----------------------TPIV-----------ANV-------
A0A517ZCB5      -------ERVLRS----------------------DEVV-----------KRT-------
A0A225EH48      -------MRLLKT----------------------RMLL-----------DRV-------
A0A518INW8      -------IALLES----------------------PMIL-----------NDAIESGKLS
A0A518JPH9      -------IALLKS----------------------PMIL-----------NDAIEVGNLS
A0A5C5VEK8      -------AELIRS----------------------TGVL-----------AAV-------
A0A532UTJ0      -------AEKVTS----------------------SSVV-----------QRV-------
A0A432MFP3      -------IQLITS----------------------PRVL-----------SVA-------
A0A2E2CCW9      -------IDVIKS----------------------PRIV-----------GEA-------
A0A3C0AGX3      -------IDVIKS----------------------PRIV-----------GEA-------
A0A518AAQ5      -------IDVIKS----------------------PRIV-----------GQA-------
A0A517QBG9      -------IDVIKS----------------------PRIV-----------GQA-------
A0A518FTU3      -------IDVIKS----------------------PRIV-----------GQA-------
A0A517WHH5      -------IDVIKS----------------------PRIV-----------GQA-------
A0A5A8BGT3      -------IDVIKS----------------------PRIV-----------GQA-------
A0A2E7K7A9      -------IDVIKS----------------------PRIV-----------GQA-------
A0A517PTS5      -------IDVIKS----------------------PRIV-----------GQA-------
A0A6I6AH34      -------IDVIKS----------------------PRIV-----------GQA-------
A0A517VTK3      -------IDVIKS----------------------PRIV-----------GEA-------
A0A517WQT4      -------IDVIKS----------------------PRIV-----------GEA-------
A0A517VID8      -------IDVIKS----------------------PRIV-----------GEA-------
A0A517RK10      -------IDVIKS----------------------PRIV-----------GEA-------
A0A518IH18      -------IDVIKS----------------------PRIV-----------GEA-------
A0A5C5XLF4      -------VEIIRS----------------------PKVV-----------ERA-------
A0A2D5NDU9      -------AEVIVS----------------------GEIL-----------RSA-------
A0A1P8WP26      -------RRLMAD----------------------DEVM-----------RRA-------
A0A3L7V1F3      -------IELMSR----------------------DEVI-----------VRA-------
D5SZ21          -------ERIMQG----------------------DIVL-----------ADA-------
A0A286RGB6      -------LEYLRS----------------------RFVL-----------VAA-------
A0A518CHE5      -------TRLLSS----------------------DRVL-----------ETA-------
A0A1V5N3W2      -------ADIIVS----------------------DQVI-----------QRVADELADK
A0A3E0MY27      -------IQLIKS----------------------PFVI-----------NTA-------
A0A7C4Z5R7      -------LASIKT----------------------RSVL-----------TAA-------
A0A2E0X9P6      -------IELLRG----------------------TVV----------------------
A0A286RLF2      -------VNLITS----------------------AKVL-----------EGA-------
A0A517NSK8      -------IQLMTS----------------------RRIL-----------KKAIA-----
A0A5C5Z0D6      -------IELMTS----------------------RRIL-----------QTAID-----
M5UE94          -------IQLFSS----------------------RRIL-----------KSAIE-----
A0A2E8FLY0      -------QGVLTS----------------------DVVL-----------EEA-------
A0A3D2U1E1      -------QGVLTS----------------------DLVL-----------EEV-------
E8R3W3          -------SQLLRS----------------------PIVV-----------EDALK-----
A0A5C5ZM48      -------VELIRS----------------------PMVV-----------APLLGDPA--
A0A5B9WF77      -------LVSVTS----------------------DPVL-----------AGA-------
A0A518BBX8      -------QVLIES----------------------PLIV-----------ERA-------
A0A1P8WN28      -------RQLLLS----------------------DRVL-----------TDT-------
A0A3B9CTT0      -------KHLMLS----------------------DKSL-----------TQT-------
A0A518ALT3      -------IETMKS----------------------PIVL-----------GPL-------
A0A3M1QRP3      -------IHKITS----------------------ARVI-----------ERVLE-----
A0A517TMV0      -------REVVRS----------------------SEVI-----------RRA-------
A0A3E0MY88      -------EQLLKS----------------------AVVL-----------SG--------
A0A5B9QF68      -------QKLIAS----------------------PIVL-----------QNA-------
A0A5B9QGF0      -------RKLISS----------------------PIVL-----------QNA-------
A0A5C6CK24      -------QKLIAS----------------------PIVL-----------QNA-------
A0A2E3RCU8      -------QQLIVS----------------------QPVL-----------ENA-------
A0A1C3E6N1      -------ERIMQG----------------------DIVL-----------ADA-------
A0A518GJT2      -------ERIMQG----------------------DIVL-----------ADA-------
A0A2E8B0L9      -------ERLFSS----------------------AVVL-----------DGAIQ-----
A0A5Q4GFE7      -------ERLFTT----------------------QEVL-----------EGAIE-----
A0A257WS34      -------QKVLLS----------------------DAVI-----------EGA-------
A0A7C4LP10      -------QRLMLS----------------------DKVL-----------EAA-------
A0A517MLW3      -------EKIIRS----------------------DRVL-----------KQALD-----
A0A5B9QVD0      -------EKILRS----------------------DRVV-----------QSTLR-----
A0A3A0DET7      -------AELIRS----------------------TPVL-----------AAA-------
A0A3B8PNV4      -------QGVLTS----------------------DVVL-----------EEA-------
A0A3D1DR40      -------QGVLTS----------------------DVVL-----------EEA-------
A0A2E7RYU8      -------QGVLTS----------------------DVVL-----------EEA-------
A0A3B8LXG8      -------QGVLTS----------------------DVVL-----------EEA-------
A0A286RD13      -------TTLVTS----------------------NRVL-----------TAA-------
A0A2E3GWX1      -------TKVLSS----------------------EEVL-----------KGT-------
F0SG60          -------TKVLSS----------------------EEVL-----------KGT-------
A0A2E9VST2      -------TKVLAS----------------------DEVL-----------KGA-------
A0A356A6X2      -------TKVLAS----------------------DEVL-----------KGA-------
A0A5C5XLM3      -------TKVLAS----------------------DEVL-----------KGA-------
A0A7C5FXU1      -------QQYLVS----------------------RYVL-----------MAA-------
A0A3M1VCL4      -------QEVVVS----------------------DRVL-----------EDA-------
A0A5C5V7Z9      -------RELVKS----------------------PVVL-----------QNA-------
A0A5C5YT05      -------RELVKS----------------------PVVL-----------QNA-------
A0A518D7F9      -------QQIVRS----------------------PVVV-----------REA-------
A0A5C5ZIP0      -------KDLVRS----------------------PVVV-----------RNA-------
A0A518KBK3      -------RELVKS----------------------SEVV-----------TRA-------
A0A5C6AKF9      -------RELVKS----------------------SEVV-----------SRA-------
A0A6M5Z0K7      -------LALIKS----------------------RPVL-----------QDA-------
A0A350CI62      -------IALMSE----------------------EEVI-----------ARA-------
A0A4P5WQK6      -------IALMSE----------------------EEVI-----------ARA-------
A0A3C1X4W5      -------IALMSE----------------------EEVI-----------ARA-------
A0A3D3W3A7      -------IALMSE----------------------EEVI-----------ARA-------
A0A518DRX3      -------EKLFTS----------------------AVVL-----------NSAVE-----
A0A518DZF9      -------EKLFTS----------------------AVVL-----------NSAVE-----
A0A518AKT8      -------RDLVTS----------------------AIVV-----------SNALA-----
A0A5C5ZR72      -------IELMRN----------------------PVVL-----------RETLA-----
A0A7C5R0U3      -------VKLFGS----------------------RTVL-----------TRAAE-----
A0A517TY85      -------IELLRG----------------------PVVL-----------GPALDWSPQT
A0A5B9QEI7      -------IELLRG----------------------PVVL-----------TPVLG-----
F0SI78          -------IALFNT----------------------PVIL-----------KKA-------
A0A517MDV3      -------MEIIRS----------------------PRVI-----------GDAID----N
A0A518IQ30      -------ERLIES----------------------SVVL-----------GGALD----R
A0A517LWP4      -------ERLIES----------------------SVVL-----------GGALD----R
A0A518JNW8      -------ERLIES----------------------SVVL-----------GGALD----R
A0A2E7ENQ5      -------ERLFYS----------------------SVVL-----------EQAAA----R
A0A7C2KUQ9      -------TAIIRS----------------------NTVL-----------QPV-------
A0A7C5BZF0      -------RSILCS----------------------SAVV-----------AKA-------
A0A1G3AQE9      -------VDIVRS----------------------DKVL-----------DAA-------
A0A3L7UQT9      -------QRIMSG----------------------DRVL-----------SAA-------
A0A4P5YBU2      -------QRIMSG----------------------DRVL-----------SAA-------
A0A7C7V5U8      -------EKLVTE----------------------KKVL-----------KRA-------
                          .                                                 

A0A5S9IPR9      ICLSFFGRE--------------RTDVTA-------------------------------
A0A533Q9U4      NDPVFNPPEKDEYPESAGNRTQDPSAETQFI-----------------------------
A0A1U9NNE1      GIRICEPDM----------------------------------------------DPVAI
A0A2G2JCA2      -------------------------------------------------------STPEL
A0A533Q6B7      NHPGFNPYK------------------------------------GIENPALAADNPSDP
A0A5S9IJB5      -------------------------------------------------------EKEKF
A0A1G2XVR0      DSPEFNPVK--------------KANIFSIKELTRGNSSPTVRKPEPGKESQEPETPVKY
A0A1G3B0P0      DSPEFNPVK--------------KANIFSIKELTRGNSSPTVRKPEPGKESQEPETPVKY
A0A1E3X4X0      NGPEL-----------------------------------------PSGSSKR-------
A0A286U4B3      LDPEF-----------------------------------------IGNSKALDGSVNKS
A0A5C6DDS2      LHPEF-----------------------------------------IAKLKTKESDADKP
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      ---------------------------YISP-----------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      ------------------------DLADRNL-----------------------------
A0A3D3UVZ8      ------------------------DLVGKNL-----------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      PPLGPDLSYHFAVSPSIYGTLAILASSTGLL-----------------------------
A0A7C7YUM8      PADIALFDATAPDFDPVASGDTTSMEGMGLE-----------------------------
A0A7C2AHI6      PASPRSTDGVFEVTPPDSMLQGDSMRRLGLE-----------------------------
A0A518BJJ1      PP-----DGSIPTPENP-----HAQRNQGLT-----------------------------
A0A518D182      PA-----D----VLDAD-----ERARHLGLE-----------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ----------------------KDDD----------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ----------------------EDVKDEETG-----------------------------
M2BB46          ----------------------EPVKDEETD-----------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ----------------------TE------------------------------------
A0A5C5WDJ1      ----------------------LG------------------------------------
A0A5C5X547      ----------------------LD------------------------------------
A0A353FIP5      ----------------------SSLGLNLTL-----------------------------
A0A5B1CIK7      ----------------------AN------------------------------------
A0A5C5WHS2      ----------------------SN------------------------------------
A0A5C6B6G8      ----------------------ETQVPGQDY-----------------------------
A0A5C5ZZN3      ----------------------QN------------------------------------
A0A5C5XS91      ----------------------QN------------------------------------
A0A5C6C4E6      ----------------------QN------------------------------------
A0A2E1VVJ1      ----------------------QGLGIGLSI-----------------------------
A0A3M2AEL0      ----------------------PEVGLGLSV-----------------------------
A0A2A2W9R6      ----------------------RA------------------------------------
A0A518HKC1      ----------------------RA------------------------------------
A0A518L3P0      ----------------------RA------------------------------------
A0A255R1S0      ----------------------EH------------------------------------
A0A5B9MKP1      ----------------------RE------------------------------------
A0A0S8J591      NWEYFRKLG----------------------------------------------PDRDP
A0A351FYP6      ----VKSCE--------------LREKWKKH------------------------YGGKQ
A0A532UT69      ----LNDHN--------------ARQMQTFT------------------------GAGNP
A0A2D5AWU0      ----SESKA--------------LRGLKSFS--------------------REIIGSKPM
A0A1G2YQB7      ----VDDLS--------------DKNI-IAS------DIEKPDPLKSVRNKWSAKKNSDL
A0A353P687      ----VDDLS--------------DKNIKLME------EAKSRDPVTAVRNKFSKNNSSDL
A0A356EME5      ----VESPE--------------IRSLPELQ------------------------EKKDK
M5RT57          ----LDDSE--------------IAELPGLQ------------------------SIEKP
A0A356KTN1      ----VKANP--------------KIAREL------------------------------E
A0A518HFS8      ----LKKSG--------------IGSLEMVR------------------------SRTDP
L0DC26          ----LKQAS--------------VAKLPILT------------------------KMSDP
A0A3L7P4E4      ----ISDGR--------------LRELPSLS------------------------GASNL
A0A3L7PEB5      ----ITDGR--------------LKELPSLS------------------------GSPNL
A0A1U9NL64      ----IEEND--------------MASMRTFD------------------------EIDNP
A0A2N1UCJ3      ----VQRSD--------------IKRLRTFEAKPESIAEKIKKQIGLAEPSFTTGEIDNL
A0A7C4EK84      ----LELA---------------AQKLPSLA------------------------DLNNG
A0A7C3F0T2      ----LDRPG--------------IRDLRTFA------------------------GMTNP
A0A2E0X4J3      ----LEAPG--------------MAQLQAVR------------------------DSDSP
A0A5C5YU10      ----ADSPM--------------ASGMETFR------------------------GVENR
A0A517MPZ6      ----ANAPE--------------SSQLETFR------------------------STDNP
A0A5C6CNV7      ----AEQGE--------------NASLETFR------------------------DVDNR
A0A518K5H4      ----IEAPE--------------NVGIETFR------------------------NTDNP
A0A5C6AA28      ----VEAPE--------------NAALETFR------------------------KTDNP
A0A2E7ESJ6      ----FDNFN--------------LFRLPTFK------------------------DDPDP
A0A2E9VK20      ----VRDSQ--------------LDQLATLA------------------------GSEEP
A0A3D4PJK1      ----VRDSQ--------------LDQLATLA------------------------GSEEP
A0A355AI52      STLLEAPVR----------------ELFGSQ------------------------DSEIL
A0A354PCQ3      ----LADAD--------------LRRAPSLS------------------------DPEIA
A0A0S8GZ23      ADVLDDNNT-------------------LLG------------------------TGIDR
A0A1I3DDV4      LQRVNAEEM--------------PGIKAHTD------------------------SKTDA
A0A2E0SMM6      AMQLPPEHQ---------------IDIGG-T------------------------PLEMQ
A0A3L7SI46      ITRLPNAHR---------------IDLKG-T------------------------PKSRW
A0A5B9PJZ8      ----IRDGK--------------FEQMETFE------------------------DVDSV
A0A2S8G191      ----LRDPE--------------VAKLPVIK------------------------EKVDP
A0A2E7EGG1      LSQPEITAM---------------PEIRSRR------------------------DPIDW
A0A2E2N5A9      LGAFVRTKQ---------------PDQAAQG------------------------EGTSS
A0A7C8AGA2      ----ADTLK--------------ESELTLFE------------------------DSVDL
A0A7C2FXP7      ADDLSTKDLKFFAEASMSIIDKMGLTLTKTT------------------------QTVEP
A0A2E3GWC6      ----VHESH--------------LDKLPTLA------------------------GSEDP
F0SLB0          ----VHESH--------------LDKLPTLA------------------------GSEDP
A0A3L7NDH9      AKLLDGPTR---------------VALGS-Q------------------------DPEIV
A0A1N6DAJ8      ----LKDPE--------------VAKLEVIA------------------------KVVDP
A0A532UD06      ----VNDTR--------------IGHLETFA------------------------GIDNL
A0A660URN1      ----ADDSE--------------IGRFKTFE------------------------QIDNP
A0A517ZCB5      LKQLPPEHR---------------SDFRG-V------------------------RPERW
A0A225EH48      ----VSNPN--------------VSRLPDIK------------------------GTDDP
A0A518INW8      DLDSFVAAR---------------------R------------------------EGISA
A0A518JPH9      DLDSFVAAR---------------------R------------------------EGNSA
A0A5C5VEK8      ----AESPE--------------AASMETFR------------------------GVENR
A0A532UTJ0      ANALVDKNLSFFDTEPAGLLTKWKQKLLGTT------------------------PKPEI
A0A432MFP3      ----KLDPK--------------VASQSGVR------------------------EAPDA
A0A2E2CCW9      ----VKEAR--------------LNQLPSLA------------------------GEKDP
A0A3C0AGX3      ----VKEAR--------------LNQLPSLA------------------------GEKDP
A0A518AAQ5      ----VKAAH--------------LTELPTLE------------------------GEKDP
A0A517QBG9      ----VKAAH--------------LTELPTLE------------------------GEKDP
A0A518FTU3      ----VKAAH--------------LTELPTLE------------------------GEKDP
A0A517WHH5      ----VKAGK--------------LTELPSLE------------------------GEKDP
A0A5A8BGT3      ----VKAGK--------------LTELPSLE------------------------GEKDP
A0A2E7K7A9      ----VKAGK--------------LTELPSLE------------------------GEKDP
A0A517PTS5      ----VKAGK--------------LTELPSLE------------------------GEKDP
A0A6I6AH34      ----VKAGK--------------LTELPSLE------------------------GEKDP
A0A517VTK3      ----VKEAK--------------LYNLPSLA------------------------GETDP
A0A517WQT4      ----VKEAK--------------LYNLPSLA------------------------GETDP
A0A517VID8      ----VKEAK--------------LNQLSSLA------------------------GEKDP
A0A517RK10      ----VKEAK--------------LNELPSLA------------------------GEKDP
A0A518IH18      ----VKEAK--------------LNELPSLA------------------------GEKDP
A0A5C5XLF4      VRDSHLDQL--------------ATLAGSTE------------------------PARDI
A0A2D5NDU9      LTRFHEEFP--------------DSEINK--------------------------DETIT
A0A1P8WP26      LERLPERFK---------------QHFSE-L------------------------TEAEA
A0A3L7V1F3      LKTLPKNAR---------------VDLVG-Y------------------------PEGQW
D5SZ21          AQKLPVKYR---------------TDFRG-V------------------------APADW
A0A286RGB6      -LRQPEVAR--------------LPSIREQI------------------------DPVQW
A0A518CHE5      ASHLPPEHQ---------------VDVSG-N------------------------PMEMQ
A0A1V5N3W2      KLALFEDPD--------------PIARYLTK------------------------DSKPL
A0A3E0MY27      LSEPGIADI--------------SWLKEVKA------------------------EGEDQ
A0A7C4Z5R7      IHKLEADGV--------------LEPGKA-A------------------------ENLAW
A0A2E0X9P6      LIPLLGRSE--------------IGAMEEFQ------------------------NEPEP
A0A286RLF2      IQKLSREDL--------------AVDLNM-D------------------------KPETW
A0A517NSK8      DHELTDIAS--------------VSNAIDEG------------------------K--NP
A0A5C5Z0D6      KHGLEDLAS--------------IAEVVAEG------------------------R--SS
M5UE94          KHDLDEVKS--------------VVDAISES------------------------ENLSP
A0A2E8FLY0      LQKLPEKHR---------------IDLKG-I------------------------PRNKW
A0A3D2U1E1      LQKLPAKHR---------------VDLKD-V------------------------PRAKW
E8R3W3          DEKYKGLKT--------------LEDLNE-N------------------------ERFNW
A0A5C5ZM48      IAQLEILRG--------------ELDPIG-------------------------------
A0A5B9WF77      ---FVVEPR--------------IAKFSMFK------------------------NSNDP
A0A518BBX8      IRTNPEILQ--------------LESAKPSS------------------------EDEDA
A0A1P8WN28      VKELKSLPP----------------ELAAEP------------------------DRTVW
A0A3B9CTT0      AENLDPKPP----------------ELSG-V------------------------DSLRW
A0A518ALT3      LSRPSVSEI--------------EEINSE-F------------------------DPQAY
A0A3M1QRP3      RDDVRQTSL--------------FDEVEQ-N------------------------VLTKL
A0A517TMV0      IERLSPEHR---------------VDLAD-T------------------------PPRKW
A0A3E0MY88      VRQLVEPSH--------------QVDFQG-T------------------------RGPGV
A0A5B9QF68      IKRLPPKHR---------------IDLVG-E------------------------PTHKW
A0A5B9QGF0      IKQLAPQHL---------------IDLVG-K------------------------PTHEW
A0A5C6CK24      IKQLSPQYL---------------IDLVG-E------------------------PTHKW
A0A2E3RCU8      IQHIPSECL---------------QEFKG--------------------------NRESW
A0A1C3E6N1      AQKLPVKYR---------------TDFRG-V------------------------APADW
A0A518GJT2      AQKLPVKYR---------------TDFRG-V------------------------APSDW
A0A2E8B0L9      RLLKSPAEA--------------RIDLAG-L------------------------PRDKW
A0A5Q4GFE7      SLLQGPAEN--------------RIDFAS-A------------------------PRHRW
A0A257WS34      IKGLPSKHR---------------HVLRK-V------------------------PRARW
A0A7C4LP10      IKSLPAKHR---------------IDFEG-V------------------------PKTKW
A0A517MLW3      QLRQMDSSL--------------QIDLVG-L------------------------SDEQA
A0A5B9QVD0      SLREQPAAA--------------QIDIRD-K------------------------SDEAA
A0A3A0DET7      -ADAPENAN--------------LETFHG-V------------------------DNRV-
A0A3B8PNV4      LQKLPAKHR---------------IDLKG-I------------------------PRSKW
A0A3D1DR40      LQKLPAKHR---------------IDLKG-I------------------------PRSKW
A0A2E7RYU8      LQKLPAKHR---------------IDLKG-I------------------------PRSKW
A0A3B8LXG8      LQKLPAKHR---------------IDLKG-I------------------------PRSKW
A0A286RD13      LQRPGISQL--------------PYIRNQ-V------------------------DPIMW
A0A2E3GWX1      LQRLPRDQQ---------------AKFLG-M------------------------SKRQA
F0SG60          LQRLPRDQQ---------------AKFLG-M------------------------SKRQA
A0A2E9VST2      LLRLPDTAR---------------TKFIG-M------------------------TKHQA
A0A356A6X2      LVRLPDTAR---------------TKFIG-M------------------------TKHQA
A0A5C5XLM3      LVRLPDTAR---------------TKFIG-M------------------------TKHQA
A0A7C5FXU1      LRQ--PQVA--------------ELESIR-N------------------------HPDP-
A0A3M1VCL4      IERLSPEYR--------------MVDLQD-V------------------------PRSKW
A0A5C5V7Z9      IANLPPEHR---------------VDLLT-V------------------------KPSRW
A0A5C5YT05      ISDLPPEHR---------------IDLET-I------------------------NPSHW
A0A518D7F9      IQALEPQHR---------------LDLLG-V------------------------PSQRW
A0A5C5ZIP0      IEQLKPEHR---------------IDLVE-S------------------------PPHKW
A0A518KBK3      IERLAPEHR---------------IDFVD-Q------------------------KPNRW
A0A5C6AKF9      IDRLGPEYR---------------IDFVD-K------------------------KANEW
A0A6M5Z0K7      VSSAEVRSL--------------RLVAAQ-S------------------------DPVEW
A0A350CI62      LRIMPEKYR--------------RVDLAG-Y------------------------PQSAW
A0A4P5WQK6      LRIMPEKYR--------------RVDLAG-Y------------------------PQSAW
A0A3C1X4W5      LKILPEKYR--------------RVDLEG-Y------------------------PQSAW
A0A3D3W3A7      LKILPEKYR--------------RVDLEG-Y------------------------PQSAW
A0A518DRX3      KLQDAPPEV--------------VLAFDA-A------------------------PSKEW
A0A518DZF9      KLQDAPPEV--------------VLAFDA-A------------------------PSKEW
A0A518AKT8      ---NLDSEH--------------LIDLER-V------------------------PRSDW
A0A5C5ZR72      -----DEDV--------------GSAEHL-K------------------------EESNR
A0A7C5R0U3      -RLAGVPDV--------------AAMWRK-V------------------------PESER
A0A517TY85      KNGQKLPKL--------------GELAEV-K------------------------EQADP
A0A5B9QEI7      -----RPEI--------------ASIPEI-K------------------------RSPDP
F0SI78          VEDFRLGEL--------------SSISSS-N------------------------PMA--
A0A517MDV3      RQLEELESI--------------RSEL---------------------------------
A0A518IQ30      IRQLDS-DL--------------KIDLAG-V------------------------SPEKW
A0A517LWP4      IRKLDS-EL--------------KVDLAG-V------------------------PEEKW
A0A518JNW8      IRKLDS-EL--------------KVDLAG-V------------------------PEEKW
A0A2E7ENQ5      IQELPA-PL--------------RVDVTP-K------------------------PRDEW
A0A7C2KUQ9      LEDPEI-QA--------------TGWFNE-R------------------------PRSLF
A0A7C5BZF0      VGKLDA-VH--------------RVDLVG-K------------------------PKDQW
A0A1G3AQE9      VRQLRP-ED--------------CIDFAG-A------------------------PKSEW
A0A3L7UQT9      LEDLPK-EY--------------CVDFEG-F------------------------NPEVW
A0A4P5YBU2      LEDLPK-EY--------------CVDFKG-F------------------------NPEVW
A0A7C7V5U8      IQKLTRPED--------------RVDFAE-V------------------------PPEKW
                                                                            

A0A5S9IPR9      -------GQLLRTISVAV------------------------------------------
A0A533Q9U4      -------NRFLSPLKVSL------------------------------------------
A0A1U9NNE1      L------KLMINKETILIEP----------------------------------------
A0A2G2JCA2      KNSVDIIAALGRNINVRA------------------------------------------
A0A533Q6B7      FTETYLINAFLSGLNVSL------------------------------------------
A0A5S9IJB5      RNVPDPLKVFRGLFTVTP------------------------------------------
A0A1G2XVR0      DVDDALINNYLSKLTVQM------------------------------------------
A0A1G3B0P0      DVDDALINNYLSKLTVQM------------------------------------------
A0A1E3X4X0      ----RLIDVYLKKLSITP------------------------------------------
A0A286U4B3      VSMDRLARQLLGRTEILS------------------------------------------
A0A5C6DDS2      VSVEKLVTIFLNMINIEL------------------------------------------
A0A2E3GW02      -----------DFRLGELSSISSSNPMASISS----------------------------
A0A5B9QNZ7      -----------NRQLEALESIRQQLDPELARL------------------------DHRR
A0A1Z8N7H5      -------ECLSEFQGQQRESWHRQLAGKISTRV---------------------------
A0A1G2YPI3      --------TAGIQQMQTFSEVDNHISYLKKTL----------------------------
A0A1U7CZ81      -----------DSTVAELPFIKNSTDKLTDLR----------------------------
A0A142YNY8      -----------DPQVSGLPFIKGSLSPRTELK----------------------------
A0A1U7GLS6      -----------DATVSELPFIKNSMAPQADLL----------------------------
A0A532UIN2      --------VPGIAQMKTLAGVDNSIAYLKKEL----------------------------
A0A0S8KNX5      -------PFLEDEPTDPISKLKRKIDGTQDKR----------------------------
A0A3D3UVZ8      -------FFFEAEPNDLVSNWKRKILGTKKID----------------------------
A0A517NFU9      -----------KGNLDQLASFQQVVANGG-------------------------------
A0A5C5YWH4      -----------DGKLAELESFKNAAKEGR-------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      --------DPKIARLRTFADVDNHVAFLRQNL----------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      -----------------IAGLNVKVGDLAE------------------------------
A0A142WSB9      --------KYGLKDIPGIANARDPLKAVWEDA----------------------------
M5SZR3          -----------------LPEISALKTKTKELH----------------------------
M5TW92          -----------------LPEISALKTKTKELH----------------------------
A0A2S8FKY2      ------------------REDIMSLDIVREEE----------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      -----------QVGVENLPTLQLAKREGKTPT----------------------------
M5UQ35          ---------------------VARLDRTVGEI----------------------------
A0A0S8FY64      ----------------------DRLTGLFQAE----------------------------
A0A1N6KFT7      -------------------------LGSNTPT----------------------------
L0DFG4          -------------------------LGPKKTP----------------------------
A0A5C5XXG1      -------VDFIDLPIRPSIRMTENNAKPSAPAKSESRVTEDVVTLDVLQILFRQRWLIAF
A0A7C7YUM8      -------TVVDAHDRRPSDGILRRLRGSRFLD---------------------HRLRARL
A0A7C2AHI6      -------TRVEAKDLTPFATLWRKLTGTPHQP---------------------HRLFASA
A0A518BJJ1      -------TVVESPDQQPVRRIFDRMVGIRRGK---------------------GALHARA
A0A518D182      -------AQVDDLARRPLAAAVGRLTG-QIPA---------------------PRIAVRS
A0A5C5WTY6      -----------QAGLIAEPSIVAKAE---PPE----------------------------
A0A5C5Y033      -----------EYGLMELPSLVAKVS---DET----------------------------
A0A5C6G1Y2      -----------EYGLMELPSLVAKVS---DET----------------------------
A0A354PDV6      -----------KDGLMDLASIQPLLTPA-KGE----------------------------
A0A5C6FZ02      -----------GNSLMTLPSVVEHLDPEIETV----------------------------
M5TIT3          -----------QSNLMALPSIVERIDVDNPSS----------------------------
A0A5M6CY44      -----------TNGLTEIESLQSQVS---PET----------------------------
F2AXG2          -------ELIKREKLIDLPSVLPHLD---EKT----------------------------
M2BB46          -------ELIKREKLIDLPSVLPHLD---EKT----------------------------
L7CLQ6          -----------QTKLLDLPSILQQLS---EKT----------------------------
A0A0J1B719      -----------QNELLDLPSIETHLN---EKT----------------------------
Q7UF18          -----------QTELVNLPSIESHLD---EKT----------------------------
A0A2G1W1E0      -----------QTELVDLPSIESHLD---EKT----------------------------
K5E235          -----------QTELLDLPSIESHLD---EKT----------------------------
A0A5C6FFI9      ----------------NLEKLPSIGAVVAGGD----------------------------
A0A5C5WDJ1      ----------DLTQYPSFAEIRQSGGSYVDHI----------------------------
A0A5C5X547      -------------------SEISNLPQVVAEP----------------------------
A0A353FIP5      -------RVDDLDRYSPWKLVRRKLAGKTLD-----------------------------
A0A5B1CIK7      -------GLLEL------DSILPHLNEKI-------------------------------
A0A5C5WHS2      -------GLMNL------ESITPHLGDSG-------------------------------
A0A5C6B6G8      -------SLMEL------PSIKAQLSDTE-------------------------------
A0A5C5ZZN3      -------SLVSL------PSIVEQLDETKPQF----------------------------
A0A5C5XS91      -------ELSEL------PSITTHLNQERPGF----------------------------
A0A5C6C4E6      -------DLATL------PSIVERLNPERTGF----------------------------
A0A2E1VVJ1      -------KVDDFDRYWPEASILRRFTGGSVPN----------------------------
A0A3M2AEL0      -------TVDDVDRNWPWPAVLRKLGRGEEPT----------------------------
A0A2A2W9R6      -----------------------KLNRSVGQL----------------------------
A0A518HKC1      -----------------------NLNRSVGQL----------------------------
A0A518L3P0      -----------------------KLNRSVGQL----------------------------
A0A255R1S0      -----------------------DLGKSAGEI----------------------------
A0A5B9MKP1      -----------------------SLGRSVGQL----------------------------
A0A0S8J591      I------AVVRNWIRVS--------------R----------------------------
A0A351FYP6      LTDVEARKHLEKVIDVS--------------Q----------------------------
A0A532UT69      I------GVLRSGLD-VSVG----------------------------------------
A0A2D5AWU0      I------TELNDRIG-TVVD----------------------------------------
A0A1G2YQB7      V------LALKNAIASNQLS---------VAP----------------------------
A0A353P687      I------LLLRKAIADNKLT---------VAP----------------------------
A0A356EME5      V------QWLQRELRLTSVG----------------------------------------
M5RT57          I------AWLTDNIRVQQVG----------------------------------------
A0A356KTN1      L------ELGREATP-EELGGMFQRGVRVEAL----------------------------
A0A518HFS8      V------AWLRERLR-TEFG----------------------------------------
L0DC26          I------EWLEGQLQ-VDFA----------------------------------------
A0A3L7P4E4      T------QTILNGLN-AERT----------------------------------------
A0A3L7PEB5      P------MTILAGLS-ATRT----------------------------------------
A0A1U9NL64      T------GYLKKQLQ-VSVG----------------------------------------
A0A2N1UCJ3      V------IYLKKLLD-VQVG----------------------------------------
A0A7C4EK84      V------AYLKSALQ-VEVG----------------------------------------
A0A7C3F0T2      V------GYLKAILR-VGLG----------------------------------------
A0A2E0X4J3      V------GMLYEGLA-IQVG----------------------------------------
A0A5C5YU10      V------GLLYSGLN-VDVG----------------------------------------
A0A517MPZ6      I------GLLKKNLS-VQVG----------------------------------------
A0A5C6CNV7      V------AFLRKNID-VQVG----------------------------------------
A0A518K5H4      L------ALLREEIE-VVVG----------------------------------------
A0A5C6AA28      V------GLLRESLE-VAVG----------------------------------------
A0A2E7ESJ6      L------LKLSENLKVEL-------------V----------------------------
A0A2E9VK20      A------RDIIDSLKVSRTA---------GED----------------------------
A0A3D4PJK1      A------RDIIDSLKVSRTA---------GED----------------------------
A0A355AI52      A------EIFSKSLSVR--------------G----------------------------
A0A354PCQ3      E------QNLRKNLSIS--------------G----------------------------
A0A0S8GZ23      I------SALKTALADGTIT---------IKH----------------------------
A0A1I3DDV4      V------DYVSEHISLTKGG---------QGS----------------------------
A0A2E0SMM6      V------KTLRTQLSTS--------------V----------------------------
A0A3L7SI46      T------AVLKKNLTVS--------------S----------------------------
A0A5B9PJZ8      I------RYLRDGKALIAKS---------ADV----------------------------
A0A2S8G191      V------SWLQGALSVN--------------F----------------------------
A0A2E7EGG1      L--------STQGLLIA--------------P----------------------------
A0A2E2N5A9      KAFDRATEKLMAAISVN--------------P----------------------------
A0A7C8AGA2      V------QALRKAVVKGDIK---------IEP----------------------------
A0A7C2FXP7      A------AVLKQAIANETII---------AHS----------------------------
A0A2E3GWC6      A------RDIIDGLKVERTA---------GED----------------------------
F0SLB0          A------RDIIDGLKVERTA---------GED----------------------------
A0A3L7NDH9      A------VILKNHLKIK--------------G----------------------------
A0A1N6DAJ8      I------EWLEKELQVD--------------F----------------------------
A0A532UD06      V------GYVKRELKVA--------------V----------------------------
A0A660URN1      A------AFLKKNINVA--------------V----------------------------
A0A517ZCB5      I------ESFQSHLEVS--------------A----------------------------
A0A225EH48      V------TFLEDRIKLR-------------------------------------------
A0A518INW8      L------GLLKQDLNISRGG---------SGD----------------------------
A0A518JPH9      L------GLLSGNLNIQRGG---------AGG----------------------------
A0A5C5VEK8      V------AMLYEALSVG--------------V----------------------------
A0A532UTJ0      AARLKQAIVGEKSIVVA--------------A----------------------------
A0A432MFP3      E------QYLREMIKVA--------------A----------------------------
A0A2E2CCW9      T------QDIIDTLKVKRIS---------GND----------------------------
A0A3C0AGX3      T------QDIIDTLKVKRIS---------GND----------------------------
A0A518AAQ5      A------QEIIDSLKVKRLS---------GTD----------------------------
A0A517QBG9      A------QEIIDSLKVKRLS---------GTD----------------------------
A0A518FTU3      A------QEIIDSLKVKRLS---------GTD----------------------------
A0A517WHH5      A------QEIIDSLKVKRLS---------GTD----------------------------
A0A5A8BGT3      A------QEIIDSLKVKRLS---------GTD----------------------------
A0A2E7K7A9      A------QEIIDSLKVKRLS---------GTD----------------------------
A0A517PTS5      A------QEIIDSLKVKRLS---------GTD----------------------------
A0A6I6AH34      A------QEIIDSLKVKRLS---------GTD----------------------------
A0A517VTK3      T------EEILGSLKVKRIS---------GND----------------------------
A0A517WQT4      T------EEILGSLKVKRIS---------GND----------------------------
A0A517VID8      T------QDIIDTLKVKRIS---------GND----------------------------
A0A517RK10      T------QDIIDTLKVKRIS---------GND----------------------------
A0A518IH18      T------QDIIDTLKVKRIS---------GND----------------------------
A0A5C5XLF4      I----------DSLKVTRTA---------GED----------------------------
A0A2D5NDU9      V------PWLKYHLRAE--------------V----------------------------
A0A1P8WP26      V------AEMQKSLSVS--------------S----------------------------
A0A3L7V1F3      V------RTIKDNLSVS--------------C----------------------------
D5SZ21          P------GVLKKMVTVR--------------S----------------------------
A0A286RGB6      V---------SEHLSVR--------------F----------------------------
A0A518CHE5      V------KILRSQLSTS--------------V----------------------------
A0A1V5N3W2      NPVVAIRQAIRDGIIAVV-------------P----------------------------
A0A3E0MY27      V------AWLNERIDVV--------------N----------------------------
A0A7C4Z5R7      L---------EKGLLGD--------------F----------------------------
A0A2E0X9P6      L------KHLQEHLAVA--------------Q----------------------------
A0A286RLF2      V------EGLRRNLAAS--------------A----------------------------
A0A517NSK8      L------EYIRDHLHVTKGG---------LGV----------------------------
A0A5C5Z0D6      L------KFVMDNLSVSKGG---------EGV----------------------------
M5UE94          L------AYILDNLEVTKGG---------DGV----------------------------
A0A2E8FLY0      T------ETLRNNLAVT--------------T----------------------------
A0A3D2U1E1      I------DALRKQLGVS--------------A----------------------------
E8R3W3          L-----------SANIQ--------------S----------------------------
A0A5C5ZM48      --------MLGELVHVF--------------Q----------------------------
A0A5B9WF77      A------AELRKRLEVQ--------------I----------------------------
A0A518BBX8      VDVIIEEIDVKRTTGRL--------------S----------------------------
A0A1P8WN28      P------IRLREMLVVT--------------F----------------------------
A0A3B9CTT0      P------GELRKMLTVK--------------F----------------------------
A0A518ALT3      I---------REHLSVR--------------Q----------------------------
A0A3M1QRP3      LRSPSPGKRLMDGLDVN--------------V----------------------------
A0A517TMV0      I------SSINSRLSAS--------------T----------------------------
A0A3E0MY88      -------GVLASNISVS--------------T----------------------------
A0A5B9QF68      V------EKLSENLSAR--------------V----------------------------
A0A5B9QGF0      V------ETLSENLSAQ--------------V----------------------------
A0A5C6CK24      V------ETLSKNLSAR--------------V----------------------------
A0A2E3RCU8      H------RELASKISTH--------------V----------------------------
A0A1C3E6N1      P------GVLKKMVTVR--------------S----------------------------
A0A518GJT2      P------GVLKKMVTVR--------------S----------------------------
A0A2E8B0L9      I------DALRANLSAS--------------G----------------------------
A0A5Q4GFE7      A------NILRGNLSAQ--------------A----------------------------
A0A257WS34      A------DTLRSGLSVS--------------A----------------------------
A0A7C4LP10      T------QSLRSRMSVS--------------S----------------------------
A0A517MLW3      L------TTLQGNLTVQ--------------L----------------------------
A0A5B9QVD0      V------KTIRANLSVN--------------L----------------------------
A0A3A0DET7      -------AFLRDNINVG--------------V----------------------------
A0A3B8PNV4      T------EALRNNLAVT--------------A----------------------------
A0A3D1DR40      T------EALRNNLAVT--------------A----------------------------
A0A2E7RYU8      T------EALRNNLAVT--------------A----------------------------
A0A3B8LXG8      T------EALRNNLAVT--------------A----------------------------
A0A286RD13      L---------RRNLRVR--------------F----------------------------
A0A2E3GWX1      I------GTLRENLSVS--------------T----------------------------
F0SG60          I------GTLRENLSVS--------------T----------------------------
A0A2E9VST2      I------EKLRSNLTVN--------------S----------------------------
A0A356A6X2      I------EKLRSSLTVN--------------T----------------------------
A0A5C5XLM3      I------EKLRSSLTVN--------------T----------------------------
A0A7C5FXU1      V------SLVQEGLRVR--------------F----------------------------
A0A3M1VCL4      V------KEVRSNTYVS--------------T----------------------------
A0A5C5V7Z9      I------EALNENLSAT--------------T----------------------------
A0A5C5YT05      V------EELGRGLSAS--------------T----------------------------
A0A518D7F9      L------EDILSRLSAS--------------S----------------------------
A0A5C5ZIP0      V------DSISDRLSAS--------------A----------------------------
A0A518KBK3      V------ETIGDSLTAS--------------T----------------------------
A0A5C6AKF9      V------ETINEQLTAS--------------T----------------------------
A0A6M5Z0K7      L---------EKQLVVE--------------Q----------------------------
A0A350CI62      V------RMVRDNLQAS--------------S----------------------------
A0A4P5WQK6      V------RMVRDNLQAS--------------S----------------------------
A0A3C1X4W5      I------RKVRDNLQAS--------------S----------------------------
A0A3D3W3A7      I------RKVRDNLQAS--------------S----------------------------
A0A518DRX3      A------KTIEQNLRAS--------------S----------------------------
A0A518DZF9      A------KTIEQNLRAS--------------S----------------------------
A0A518AKT8      V------EDLTDRLSAS--------------I----------------------------
A0A5C5ZR72      V------KAIQKRLKVK--------------Q----------------------------
A0A7C5R0U3      L------RHIQEHLTAR--------------G----------------------------
A0A517TY85      V------DYLKRNLSVS--------------Q----------------------------
A0A5B9QEI7      L------KYLQKQLTVR--------------Q----------------------------
F0SI78          -------SISSGLSVSR--------------S----------------------------
A0A517MDV3      -------DPVLAKFDHR--------------R----------------------------
A0A518IQ30      K------DTLRNNLSAS--------------A----------------------------
A0A517LWP4      K------DLLRGKLSAS--------------A----------------------------
A0A518JNW8      K------DLLRGNLSAS--------------A----------------------------
A0A2E7ENQ5      V------EILRKNLTAR--------------A----------------------------
A0A7C2KUQ9      GGEQSPLERLREALTVT--------------V----------------------------
A0A7C5BZF0      V------ETIQKNLTVR--------------A----------------------------
A0A1G3AQE9      S------KKLRDKLSVN--------------A----------------------------
A0A3L7UQT9      P------TLLKNHVSVT--------------N----------------------------
A0A4P5YBU2      P------TLLKNHVSVT--------------N----------------------------
A0A7C7V5U8      A------EVLERNLSAR--------------T----------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      AVITYILD----------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      SVIDHILK----------------------------------------------------
A0A5C5YWH4      GGIDHILQ----------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          QGLNVELD----------------------------------------------------
M5TW92          EGLNVELD----------------------------------------------------
A0A2S8FKY2      NPLEWLQE----------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ---QAAIE----------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A0S8FY64      -----------------------------DMRQMARPGLWHSAFREVRAVLGYEPVRPVE
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      LTLAGLAAGVAYALQARVWYESTARVLINEKSSGLASSSSSEMVEEDILANHIELLLSRK
A0A7C7YUM8      EPLAGKTADESEVRELDVYFVDEATVRIAPHGGYLFAEVPGAQDGEDFVEFDYKPGVDLE
A0A7C2AHI6      SGPID--P-----RRLTVSFPSD-----PSAGTVRVRDEEGGEE----VEVPYRPDEPFA
A0A518BJJ1      RALADGAA-----EAIRVSFDGEGQIRLTPVDVAASPDDDAREARPQRPDGRYRVG----
A0A518D182      ERLDGSAP-----ERVRLRFVSPTRVELAALGDMAYAEHFGSDA----TELDYAAGEPVE
A0A5C5WTY6      DTVTYVAS----------------------------------------------------
A0A5C5Y033      DQVDYVIQ----------------------------------------------------
A0A5C6G1Y2      DQVDYVIQ----------------------------------------------------
A0A354PDV6      DAADYVIS----------------------------------------------------
A0A5C6FZ02      DAVDYVID----------------------------------------------------
M5TIT3          DAVDYVIN----------------------------------------------------
A0A5M6CY44      DAAEYVIE----------------------------------------------------
F2AXG2          DAIDYVID----------------------------------------------------
M2BB46          DAIDYVID----------------------------------------------------
L7CLQ6          DAIDYVID----------------------------------------------------
A0A0J1B719      DAIDYVID----------------------------------------------------
Q7UF18          DAIDYVID----------------------------------------------------
A0A2G1W1E0      DAIDYVID----------------------------------------------------
K5E235          DAIDYVID----------------------------------------------------
A0A5C6FFI9      NAVDYIIE----------------------------------------------------
A0A5C5WDJ1      LD----------------------------------------------------------
A0A5C5X547      DPIEWILE----------------------------------------------------
A0A353FIP5      GALSGELALPIARQNSAPVTVTFHSSNSGVATSGKI-------LRQQSKAFSLANSPLVE
A0A5B1CIK7      DSVDYVIE----------------------------------------------------
A0A5C5WHS2      DPVEYVID----------------------------------------------------
A0A5C6B6G8      DAIDYVID----------------------------------------------------
A0A5C5ZZN3      DAVDYVIE----------------------------------------------------
A0A5C5XS91      DATDYVVE----------------------------------------------------
A0A5C6C4E6      DATDYVVE----------------------------------------------------
A0A2E1VVJ1      GSLEMELLQPYTDPWTHRIELEFLAEGEVLARSSRI------AEPETIRFDPNDTEPIVT
A0A3M2AEL0      GSLRVEVEQLPRDLTYRAWRIHFSSPEVVEVLPDSLWAAVLPGRKQVVRLD--DGKPL-E
A0A2A2W9R6      RG----------------------------------------------------------
A0A518HKC1      RG----------------------------------------------------------
A0A518L3P0      RG----------------------------------------------------------
A0A255R1S0      AG----------------------------------------------------------
A0A5B9MKP1      QR----------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7C4Z5R7      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      ------------------------------------------------------------
A0A7C5R0U3      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7C2KUQ9      ------------------------------------------------------------
A0A7C5BZF0      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      -----------------------------------------------------------G
A0A533Q9U4      -----------------------------------------------------------M
A0A1U9NNE1      -----------------------------------------------------------G
A0A2G2JCA2      -----------------------------------------------------------V
A0A533Q6B7      -----------------------------------------------------------M
A0A5S9IJB5      -----------------------------------------------------------L
A0A1G2XVR0      -----------------------------------------------------------T
A0A1G3B0P0      -----------------------------------------------------------T
A0A1E3X4X0      -----------------------------------------------------------V
A0A286U4B3      -----------------------------------------------------------V
A0A5C6DDS2      -----------------------------------------------------------V
A0A2E3GW02      ----GLSVSRS------------------------------------------------A
A0A5B9QNZ7      ----NLWVERGGQEL--------------------------------------------A
A0A1Z8N7H5      -----------------------------------------------------------V
A0A1G2YPI3      ----NATV---------------------------------------------------G
A0A1U7CZ81      ---QKLKVKN-------------------------------------------------K
A0A142YNY8      ---ERLAIVN-------------------------------------------------P
A0A1U7GLS6      ---ERLVVTN-------------------------------------------------Q
A0A532UIN2      ----DVSV---------------------------------------------------G
A0A0S8KNX5      ----------------------------------------TPEEILKQAITNGVIVAAAD
A0A3D3UVZ8      ----------------------------------------PAMKLKLAIVEDETITVAAD
A0A517NFU9      ----NIEVNRGGE---------------------------GS-----------------A
A0A5C5YWH4      ----HIEVIRGGE---------------------------GS-----------------S
A0A3D2TNK4      ----YLAPEHRTDIEGMPPSTWVRIIGSRLHTRV-------------------------T
A0A7C1Y4F0      ----TVNI---------------------------------------------------G
A0A6I0ENW6      ----DPEVLKTSWYRDPPQKLLSSAVKPAYERLLEDLNVVN------------------V
A0A6L3A0B7      ----DPEVLKTSWYRDPPQKLLSSAVKPAYERLLEDLNVVN------------------V
A0A0J1B4A0      ----NLSVSKGGD---------------------------GL-----------------A
A0A142WSB9      ----TAKLVSGQD----------------------------------------------Q
M5SZR3          -----------------------------------------------------------E
M5TW92          -----------------------------------------------------------E
A0A2S8FKY2      ----ELIVGFPGD-----------------------------------------------
A0A517N8P6      ----------GAE----------------------------------------------S
A0A432MJP4      ----ELDVSRP------------------------------------------------D
M5UQ35          --QENLAVGRGGS---------------------------GD-----------------A
A0A0S8FY64      AW-----------------------------ELLREIVGVRP-----------------V
A0A1N6KFT7      ---------------------SLAQSSDPVGFARGNLKVSRP-----------------D
L0DFG4          ---------------------SLALATNPLEAVRGSLKVTRP-----------------D
A0A5C5XXG1      IVGEAMAAQDDDGNS-------LMTLPSVVEHLDPEIETVDAVDYVIDHMEVVKGGEGGA
A0A7C7YUM8      VFDLRLRLQASGAFAGQTYCVGLRSTEEAVLHLMKTTRAAEA-----------------G
A0A7C2AHI6      AFGLSLRLRAIGAFAGQTYEIERFTLPELVDEIEDGLSVHET-----------------A
A0A518BJJ1      --GVELNLAVRGDVSRREFVVRRVSEASAVKRLLSDTRVVES-----------------Q
A0A518D182      WSGLRLWIDADADRSLGTYVVHVRTPDDAARDLMNNTRVMET-----------------Q
A0A5C5WTY6      ----NLRIDRGGL---------------------------GA-----------------A
A0A5C5Y033      ----NTSIGKGGD---------------------------GS-----------------A
A0A5C6G1Y2      ----NTSIGKGGD---------------------------GS-----------------A
A0A354PDV6      ----QLEIVKGGA---------------------------GA-----------------A
A0A5C6FZ02      ----HMEVVKGGE---------------------------GG-----------------A
M5TIT3          ----HLSVSKGGD---------------------------GS-----------------A
A0A5M6CY44      ----HLEIVKGGS---------------------------GG-----------------A
F2AXG2          ----QLSIVRGGD---------------------------GS-----------------A
M2BB46          ----QLSIVKGGD---------------------------GS-----------------A
L7CLQ6          ----QLSIVKGGD---------------------------GS-----------------A
A0A0J1B719      ----QLSIVKGGD---------------------------GS-----------------A
Q7UF18          ----QLSIVKGGD---------------------------GS-----------------A
A0A2G1W1E0      ----QLSIVKGGD---------------------------GS-----------------A
K5E235          ----QLSIVKGGD---------------------------GS-----------------A
A0A5C6FFI9      ----NLDVARGGK---------------------------GA-----------------S
A0A5C5WDJ1      ----SIEVERGGD---------------------------GN-----------------A
A0A5C5X547      ----NLHVMQLPD-----------------------------------------------
A0A353FIP5      IADTKIRLFPEGDLTGRQFRLNVATRREAVERVLKELAVSET-----------------A
A0A5B1CIK7      ----HLSIVKGGD---------------------------GS-----------------A
A0A5C5WHS2      ----RLELVKGGD---------------------------GS-----------------A
A0A5C6B6G8      ----HLELVKGGE---------------------------GS-----------------A
A0A5C5ZZN3      ----QLSIVKGGE---------------------------GS-----------------A
A0A5C5XS91      ----HISISKGGE---------------------------GS-----------------A
A0A5C6C4E6      ----HLSISKGGE---------------------------GS-----------------A
A0A2E1VVJ1      MFGRRYKLMITGTLSGRKFGVTLRNLDATVGDLLSRLRIRET-----------------S
A0A3M2AEL0      LAGARIRLIPDGDLSGRTFRLTLRSVRRAIRDTQESCRVVET-----------------H
A0A2A2W9R6      ----GLSISKGGQ---------------------------GA-----------------G
A0A518HKC1      ----GLSISKGGQ---------------------------GA-----------------G
A0A518L3P0      ----GLSISKGGQ---------------------------GA-----------------G
A0A255R1S0      ----KLSVGKDGE-----------------------------------------------
A0A5B9MKP1      ----GLSISTGGE---------------------------GA-----------------G
A0A0S8J591      -----------------------------------------------------------V
A0A351FYP6      -----------------------------------------------------------Y
A0A532UT69      -----------------------------------------------------------K
A0A2D5AWU0      -----------------------------------------------------------P
A0A1G2YQB7      -----------------------------------------------------------E
A0A353P687      -----------------------------------------------------------E
A0A356EME5      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A356KTN1      -----------------------------------------------------------E
A0A518HFS8      ------------------------------------------------------------
L0DC26          -----------------------------------------------------------P
A0A3L7P4E4      -----------------------------------------------------------V
A0A3L7PEB5      -----------------------------------------------------------V
A0A1U9NL64      -----------------------------------------------------------K
A0A2N1UCJ3      -----------------------------------------------------------I
A0A7C4EK84      -----------------------------------------------------------K
A0A7C3F0T2      -----------------------------------------------------------K
A0A2E0X4J3      -----------------------------------------------------------A
A0A5C5YU10      -----------------------------------------------------------R
A0A517MPZ6      -----------------------------------------------------------K
A0A5C6CNV7      -----------------------------------------------------------Q
A0A518K5H4      -----------------------------------------------------------E
A0A5C6AA28      -----------------------------------------------------------E
A0A2E7ESJ6      -----------------------------------------------------------E
A0A2E9VK20      -----------------------------------------------------------H
A0A3D4PJK1      -----------------------------------------------------------H
A0A355AI52      -----------------------------------------------------------L
A0A354PCQ3      -----------------------------------------------------------G
A0A0S8GZ23      -----------------------------------------------------------L
A0A1I3DDV4      -----------------------------------------------------------A
A0A2E0SMM6      -----------------------------------------------------------S
A0A3L7SI46      -----------------------------------------------------------T
A0A5B9PJZ8      -----------------------------------------------------------K
A0A2S8G191      -----------------------------------------------------------P
A0A2E7EGG1      -----------------------------------------------------------K
A0A2E2N5A9      -----------------------------------------------------------R
A0A7C8AGA2      -----------------------------------------------------------V
A0A7C2FXP7      -----------------------------------------------------------S
A0A2E3GWC6      -----------------------------------------------------------H
F0SLB0          -----------------------------------------------------------H
A0A3L7NDH9      -----------------------------------------------------------V
A0A1N6DAJ8      -----------------------------------------------------------A
A0A532UD06      -----------------------------------------------------------G
A0A660URN1      -----------------------------------------------------------G
A0A517ZCB5      -----------------------------------------------------------E
A0A225EH48      -----------------------------------------------------------W
A0A518INW8      -----------------------------------------------------------A
A0A518JPH9      -----------------------------------------------------------S
A0A5C5VEK8      -----------------------------------------------------------G
A0A532UTJ0      -----------------------------------------------------------D
A0A432MFP3      -----------------------------------------------------------R
A0A2E2CCW9      -----------------------------------------------------------R
A0A3C0AGX3      -----------------------------------------------------------R
A0A518AAQ5      -----------------------------------------------------------R
A0A517QBG9      -----------------------------------------------------------R
A0A518FTU3      -----------------------------------------------------------R
A0A517WHH5      -----------------------------------------------------------R
A0A5A8BGT3      -----------------------------------------------------------R
A0A2E7K7A9      -----------------------------------------------------------R
A0A517PTS5      -----------------------------------------------------------R
A0A6I6AH34      -----------------------------------------------------------R
A0A517VTK3      -----------------------------------------------------------R
A0A517WQT4      -----------------------------------------------------------R
A0A517VID8      -----------------------------------------------------------R
A0A517RK10      -----------------------------------------------------------R
A0A518IH18      -----------------------------------------------------------R
A0A5C5XLF4      -----------------------------------------------------------H
A0A2D5NDU9      -----------------------------------------------------------G
A0A1P8WP26      -----------------------------------------------------------D
A0A3L7V1F3      -----------------------------------------------------------A
D5SZ21          -----------------------------------------------------------A
A0A286RGB6      -----------------------------------------------------------P
A0A518CHE5      -----------------------------------------------------------S
A0A1V5N3W2      -----------------------------------------------------------G
A0A3E0MY27      -----------------------------------------------------------P
A0A7C4Z5R7      -----------------------------------------------------------T
A0A2E0X9P6      -----------------------------------------------------------I
A0A286RLF2      -----------------------------------------------------------V
A0A517NSK8      -----------------------------------------------------------A
A0A5C5Z0D6      -----------------------------------------------------------A
M5UE94          -----------------------------------------------------------A
A0A2E8FLY0      -----------------------------------------------------------P
A0A3D2U1E1      -----------------------------------------------------------P
E8R3W3          -----------------------------------------------------------S
A0A5C5ZM48      -----------------------------------------------------------R
A0A5B9WF77      -----------------------------------------------------------L
A0A518BBX8      -----------------------------------------------------------S
A0A1P8WN28      -----------------------------------------------------------E
A0A3B9CTT0      -----------------------------------------------------------N
A0A518ALT3      -----------------------------------------------------------V
A0A3M1QRP3      -----------------------------------------------------------A
A0A517TMV0      -----------------------------------------------------------V
A0A3E0MY88      -----------------------------------------------------------A
A0A5B9QF68      -----------------------------------------------------------T
A0A5B9QGF0      -----------------------------------------------------------T
A0A5C6CK24      -----------------------------------------------------------T
A0A2E3RCU8      -----------------------------------------------------------V
A0A1C3E6N1      -----------------------------------------------------------A
A0A518GJT2      -----------------------------------------------------------A
A0A2E8B0L9      -----------------------------------------------------------L
A0A5Q4GFE7      -----------------------------------------------------------I
A0A257WS34      -----------------------------------------------------------A
A0A7C4LP10      -----------------------------------------------------------A
A0A517MLW3      -----------------------------------------------------------V
A0A5B9QVD0      -----------------------------------------------------------L
A0A3A0DET7      -----------------------------------------------------------G
A0A3B8PNV4      -----------------------------------------------------------P
A0A3D1DR40      -----------------------------------------------------------P
A0A2E7RYU8      -----------------------------------------------------------P
A0A3B8LXG8      -----------------------------------------------------------P
A0A286RD13      -----------------------------------------------------------A
A0A2E3GWX1      -----------------------------------------------------------T
F0SG60          -----------------------------------------------------------T
A0A2E9VST2      -----------------------------------------------------------T
A0A356A6X2      -----------------------------------------------------------A
A0A5C5XLM3      -----------------------------------------------------------A
A0A7C5FXU1      -----------------------------------------------------------P
A0A3M1VCL4      -----------------------------------------------------------I
A0A5C5V7Z9      -----------------------------------------------------------V
A0A5C5YT05      -----------------------------------------------------------V
A0A518D7F9      -----------------------------------------------------------V
A0A5C5ZIP0      -----------------------------------------------------------T
A0A518KBK3      -----------------------------------------------------------V
A0A5C6AKF9      -----------------------------------------------------------V
A0A6M5Z0K7      -----------------------------------------------------------V
A0A350CI62      -----------------------------------------------------------A
A0A4P5WQK6      -----------------------------------------------------------A
A0A3C1X4W5      -----------------------------------------------------------A
A0A3D3W3A7      -----------------------------------------------------------A
A0A518DRX3      -----------------------------------------------------------K
A0A518DZF9      -----------------------------------------------------------K
A0A518AKT8      -----------------------------------------------------------S
A0A5C5ZR72      -----------------------------------------------------------V
A0A7C5R0U3      -----------------------------------------------------------V
A0A517TY85      -----------------------------------------------------------V
A0A5B9QEI7      -----------------------------------------------------------I
F0SI78          -----------------------------------------------------------A
A0A517MDV3      -----------------------------------------------------------A
A0A518IQ30      -----------------------------------------------------------A
A0A517LWP4      -----------------------------------------------------------A
A0A518JNW8      -----------------------------------------------------------A
A0A2E7ENQ5      -----------------------------------------------------------V
A0A7C2KUQ9      -----------------------------------------------------------R
A0A7C5BZF0      -----------------------------------------------------------V
A0A1G3AQE9      -----------------------------------------------------------L
A0A3L7UQT9      -----------------------------------------------------------E
A0A4P5YBU2      -----------------------------------------------------------E
A0A7C7V5U8      -----------------------------------------------------------Y
                                                                            

A0A5S9IPR9      DGTDILY-------------------ITCRGKNA-ENVAYIANLYVDVFVDEN-------
A0A533Q9U4      RNSGVVS-------------------ISYDGHNP-QLITRIANMIVKTYIEQD-------
A0A1U9NNE1      EKTELIN-------------------IKMKTNNT-AFSEELVDSFIRVYMTMQ-------
A0A2G2JCA2      SGSEMYS-------------------VEFQSTDP-VKASLIVNEVAKSYYNLH-------
A0A533Q6B7      RNSGVVC-------------------ITYTGDDP-YLITTITNAIVKTYIEQD-------
A0A5S9IJB5      RKSFIVR-------------------VSFKWTDP-RLPPRVVDFLQKAYIQQD-------
A0A1G2XVR0      GNSDIIS-------------------ISFTGTHP-ETLAKMCNMHAKKFLETH-------
A0A1G3B0P0      GNSDIIS-------------------ISFTGTHP-ETLAKMCNMHAKKFLETH-------
A0A1E3X4X0      RNTGVVN-------------------VSFSGNYP-DIITDILNAHVKFYKDQE-------
A0A286U4B3      RNSQLVK-------------------IKVSTGYP-ELCKKIADTIADEYIKKN-------
A0A5C6DDS2      RNSQLVK-------------------LKAETGSP-GLCVSIVDTLADEYIKKN-------
A0A2E3GW02      KAEDILL-------------------FTFTCGHP-KDAQKVLEAVIASYFAFL-------
A0A5B9QNZ7      YAPLTFV-------------------AEFRHGQA-ADCATVLTAITESYQDFM-------
A0A1Z8N7H5      KSTTVLN-------------------ISYTSTKP-QNAVAIVTAVIKSYLQFV-------
A0A1G2YPI3      KKDDIIS-------------------ISYDSPYP-NEAAQLVNTVIDSYITYH-------
A0A1U7CZ81      DGTVHIQ-------------------VSFDSTDA-HEAAAIVNAVVASYLRSY-------
A0A142YNY8      RNTEFVH-------------------VSLESTNP-EEAAAIVNAVVASYLQAQ-------
A0A1U7GLS6      KNTNYVV-------------------VSLELNDP-EEAALIVNAVVAAYLRNY-------
A0A532UIN2      KKDDIIS-------------------LSFNSPYP-AEAAQLINEAVDSYITYH-------
A0A0S8KNX5      RLSELIR-------------------ITVLHPDR-EQARQIVDAFINAYTAVE-------
A0A3D3UVZ8      RRSELIN-------------------ITMRSANE-EEAKQIVDAFIKAYMEIE-------
A0A517NFU9      RDAMVLR-------------------ASYRDTNP-EDAAIVLSAIYDSYRDYV-------
A0A5C5YWH4      RDAMVLR-------------------AAYRDSSP-EDAALVLSTIYDSYRDYV-------
A0A3D2TNK4      RKKSFIE-------------------VTYRSKDP-KTAAAVVRAIIRAYLAFV-------
A0A7C1Y4F0      RKDDVIT-------------------VSLESPYP-VEAAQIVNELVRSYIAYH-------
A0A6I0ENW6      KGTELIE-------------------IGFYATDP-KDAELIVKTIQQVYLDQT-------
A0A6L3A0B7      KGTELIE-------------------IGFYATDP-KDAELIVKTIQQVYLDQT-------
A0A0J1B4A0      KSASVLK-------------------ATYQDPDP-EVAAAALQAIFDSYQDYI-------
A0A142WSB9      SFDAIIE-------------------VAYESADK-AVAKTVVEAIVKAYEDWL-------
M5SZR3          NADNILH-------------------VSFEGEVP-EECPVIIRGILNTYQDYL-------
M5TW92          NADNILH-------------------VSFEGEVP-EECPVIIRGILNTYQDYL-------
A0A2S8FKY2      --AEILQ-------------------VSMMSKDP-TSAPKIVNAVVSAYKDEV-------
A0A517N8P6      PDRTIVE-------------------VSFESGDP-TVATAIVNAVVDAYDKSI-------
A0A432MJP4      RAASVLR-------------------IDYRARTK-EEAVLLTDALIRSFEAFL-------
M5UQ35          EAANMLT-------------------ATFQDEDP-EMAAKILQAVYESYFSYI-------
A0A0S8FY64      KDTNLVD-------------------ILVRAPDA-NVASLVANLVAQAYVDYS-------
A0A1N6KFT7      RLTKIIV-------------------LQYQSAST-QESLQMIHAIVASYKKLL-------
L0DFG4          RLTKIIV-------------------VQYQSASP-QESLDMIRAVVASYKKLL-------
A0A5C5XXG1      KTARTLR-------------------ISLNHTEP-EDAQRLLTAVLQTYSRYL-------
A0A7C7YUM8      RKTNVVK-------------------VTVDDSCP-YRAAETANALAKNYIRRS-------
A0A7C2AHI6      RNSGVIS-------------------LTIADHDP-NRAAELANALCQNYIQRS-------
A0A518BJJ1      RNSGVIA-------------------LTVDDSDP-ERAAAVANALCHNYFDLN-------
A0A518D182      RNSGVLE-------------------LTVSDSDP-LRAAAKANALCLNYFDLK-------
A0A5C5WTY6      KKARSLT-------------------VTFDHSDP-VVAQQVLQAVIDQYLQTL-------
A0A5C5Y033      RSAAIMN-------------------ITLQHNSP-EDVQKILAAIMRRYERFI-------
A0A5C6G1Y2      RSAAIMN-------------------ITLQHNSP-EDVQKILAAIMRRYERFI-------
A0A354PDV6      KSARSLS-------------------LAFAHTDP-EESRKILESVLVEYQNYI-------
A0A5C6FZ02      KTARTLR-------------------ISLNHTEP-EDAQRLLTAVLQTYSRYL-------
M5TIT3          KNARSLS-------------------VSFEHTNP-EDAQVLLTAVMKRYEQFI-------
A0A5M6CY44      KTARTLN-------------------ISFSHPDP-EDARLILTAVMKQYEKFI-------
F2AXG2          KTARTLN-------------------ITFTHTDP-DDAKRILTAVMSRYQQFL-------
M2BB46          KTARTLN-------------------ITFTHTDP-DDAKRILTAVMSRYQQFL-------
L7CLQ6          KTARSLN-------------------ITFTHTEP-DDAKLILTAVMKRYEQFI-------
A0A0J1B719      KTARSLN-------------------ITFTHTDP-DDAKLILTAVMKRYEQFI-------
Q7UF18          KTARSLN-------------------ITFTHTEP-DDAKRILTAVMKRYEQFI-------
A0A2G1W1E0      KTARSLN-------------------ITFTHTEP-DDAKLILTAVMKRYEQFI-------
K5E235          KTARSLN-------------------ITFTHTEP-DDAKRILTAVMKRYEQFI-------
A0A5C6FFI9      KNAMVLS-------------------ATFRDPNP-DDAATILAAIYGSYERYV-------
A0A5C5WDJ1      QNAMVLR-------------------VTYRANDP-EEAAMVLSSIYNSYKTYI-------
A0A5C5X547      --TELLN-------------------VSFRDPDP-QAAMAIANAVVKNYYDKY-------
A0A353FIP5      RGSGVLQ-------------------ITYKDTDP-DRAAQVVNNLISSYAERS-------
A0A5B1CIK7      KTARSLK-------------------VLFDHTDA-EDTQLVLTAILKRYEEFI-------
A0A5C5WHS2      KTARSLN-------------------IALTHTDP-EDTQLILTAVLKRYEQFI-------
A0A5C6B6G8      KTARSLN-------------------VSFKHTEP-DDAQLVLTAVMKRYEQFI-------
A0A5C5ZZN3      KTARSLS-------------------VTFTHTEP-DDAQIILTAVMKRYEQFI-------
A0A5C5XS91      KAARSLR-------------------VTMTHTDP-DDAQLILTAVMKRYEQFI-------
A0A5C6C4E6      KAARSLR-------------------VTLTHTDA-DDAQLILTAVMKRYEQFI-------
A0A2E1VVJ1      RGSGVLQ-------------------ITYSDTSP-SRAQRFVNRLAEMYVAYK-------
A0A3M2AEL0      KGSNVLR-------------------LSYFDTDP-ERAAQVANALLRAYIEHN-------
A0A2A2W9R6      ASASILR-------------------ATYRDSDP-ETAAKVLQAIFDSYQLYI-------
A0A518HKC1      ASASILR-------------------ATYRDGDP-ETAAKVLQAVFDSYQLYV-------
A0A518L3P0      ASASILR-------------------ATYRDGDP-EVAAKVLQAIFDSYQLYI-------
A0A255R1S0      --ASILR-------------------ATYQDGNP-EVAAKVLEAVFETYFDYV-------
A0A5B9MKP1      SAASLLK-------------------ATYKDEDP-EVAARVLQAIFDTYQNYV-------
A0A0S8J591      PKTHHVE-------------------IWVLWPDP-KMAARMVNAVTDAYTDIL-------
A0A351FYP6      RNTSIIE-------------------LRAYDRDK-NLAQQIAQALAKEYENYR-------
A0A532UT69      R-DDIIS-------------------VSFSSPYP-DEAVEIVNAAVDSYKAHY-------
A0A2D5AWU0      N-TDRLS-------------------IAYLSPFP-DEAAKIARATVEEYIAYH-------
A0A1G2YQB7      DNTELIK-------------------IAVKSSNP-TSASKIANAFVQAYMTIV-------
A0A353P687      DKTELIK-------------------ISVKSSNP-SNASKIANSFVQAYMTIV-------
A0A356EME5      K-SEFLQ-------------------VDFQGPDP-KNAAKIVNAVVKRYFDLL-------
M5RT57          S-SELYN-------------------ISLATSDP-ESSAKLVNAILDTYFAVR-------
A0A356KTN1      S-TYLVD-------------------VSYESTDP-KRCDRYANAVAEAYREQLQTLWGEK
A0A518HFS8      N-SEILT-------------------ISMSGGNP-EAVATVVNAVTEAYLEQI-------
L0DC26          G-SEILR-------------------ISMTGEKP-EIPMLLVNAVTQAYMDEI-------
A0A3L7P4E4      EDGQVLD-------------------ISFKGTDP-DDCAKVVNAVVASYDKNL-------
A0A3L7PEB5      E-GQILD-------------------ISFKGSDP-VDCAKVVNAVVASYDKSL-------
A0A1U9NL64      K-DDILS-------------------VSFDSPYP-AEAAHVVNEIIDSYITYH-------
A0A2N1UCJ3      K-DDIIA-------------------VSCLSPYR-EEAAQIVNAVIEAYVDYQ-------
A0A7C4EK84      N-DDLVT-------------------VSLESPDP-RQAAVLVNSVVESYVEYQ-------
A0A7C3F0T2      D-DDIIS-------------------VSLESPYP-EEAAQIVNAVVDAYVTYQ-------
A0A2E0X4J3      D-NEIIT-------------------VSLELPDP-EEAAQLVNAVVDAYVSKY-------
A0A5C5YU10      D-DEIIN-------------------VSLTLPNP-VEAAQLVNEIVAAYITQY-------
A0A517MPZ6      N-DDIIN-------------------VMIELPSA-EDAAQIVNSVVDAYISKY-------
A0A5C6CNV7      N-DDIIN-------------------VSAELANS-ADAAQLVNSVVEAYISKY-------
A0A518K5H4      R-DDIIN-------------------ISIELENP-TDAAQIVNSVVDAYITKY-------
A0A5C6AA28      R-DDIIN-------------------IAIELENP-TDAAVIVNSVVDAYITQY-------
A0A2E7ESJ6      DGTNVLN-------------------IRFIGPYP-EDTQKVVNAVLHTYQQFL-------
A0A2E9VK20      HQLNILN-------------------LQYTTSKS-KDATAILNGVIKAYDDYL-------
A0A3D4PJK1      HQLNILN-------------------LQYTTSKS-KDATAILNGVIKAYDDYL-------
A0A355AI52      RQTNLLE-------------------LNFRSSHQ-DATAVVVAAIIQAYAKFM-------
A0A354PCQ3      GTASRLV-------------------VSYQDSDR-EAAATVCNAIVQSYLRQR-------
A0A0S8GZ23      TRTEFLG-------------------VSMTSRKP-RQAEQIVNAFMKEYMKVV-------
A0A1I3DDV4      RDARSLN-------------------IAFRHTNP-DEALLILQALVAEYESFL-------
A0A2E0SMM6      PQTSLID-------------------VRFISKSP-ETAAYTTNQIIACYIKFM-------
A0A3L7SI46      RLTNMIQ-------------------VRYVSKNA-KTAKLVVDAIVAAYLEYM-------
A0A5B9PJZ8      SNSGVIK-------------------ISFDGGNQ-KEAEQILDAVVKAFGSYI-------
A0A2S8G191      DNAEIME-------------------VKLSGESP-QSISKIVNAVVQAYMDEV-------
A0A2E7EGG1      GSSELLE-------------------VAFEGVNP-ENSALLVNAIIDAYFTMR-------
A0A2E2N5A9      GKSQVVA-------------------VEVLLADS-YVAMKAANALVEGYIASK-------
A0A7C8AGA2      SNTELIR-------------------IKMTTDHQ-KQAERIVDAFIQAYMARV-------
A0A7C2FXP7      QDTELIM-------------------ITIEWHDV-KEAQQIVDSFINSYMAVE-------
A0A2E3GWC6      HKLNILN-------------------LQYTSTSE-EDAKQILNAVVKAYDEYL-------
F0SLB0          HKLNILN-------------------LQYTSTSE-EDAKQILNAVVKAYDEYL-------
A0A3L7NDH9      RSTNLID-------------------LKYRAQDP-RAAAMAVGAIIKAYSLFM-------
A0A1N6DAJ8      SGSEILR-------------------ISINGEKP-QVPMLLVNAITQAYIDEI-------
A0A532UD06      RKDDIIT-------------------VSFDSPYP-QEAAQLVNAMVDSYVRYH-------
A0A660URN1      KKDDIIK-------------------VSFDSPYP-AEAAQIVNAVVNSYVDYH-------
A0A517ZCB5      RKTNVMN-------------------IRYRSGDA-DTAYVVVSTLIGAYLEYM-------
A0A225EH48      GSPEILE-------------------VSMNGDDP-KQILLIVNTMVDEYIKDA-------
A0A518INW8      EGASVLQ-------------------VSFQSADP-EDAQHVLEVIYERYCHHV-------
A0A518JPH9      QGASVLQ-------------------VTYQSSDP-EDAEYVLEVVYERYCHHI-------
A0A5C5VEK8      QDDEIIN-------------------VGLELPNR-FEAAQLVNAIVDAYITQY-------
A0A532UTJ0      RRSELIH-------------------VTMQTTKP-EEARQIVDAFITAYMDIE-------
A0A432MFP3      PNTSLIE-------------------VAAEAERA-HEAADVVNAVVRSYLDAN-------
A0A2E2CCW9      AFLNILT-------------------ITYENPNA-KDARTVTQAIVDAYKRYL-------
A0A3C0AGX3      AFLNILT-------------------ITYENPNA-KDARTVTQAIVDAYKRYL-------
A0A518AAQ5      TYLNILN-------------------LTYENPNS-HDAKVIMQAIVDAYQHYL-------
A0A517QBG9      TYLNILN-------------------LTYENPNS-HDAKVIMQAIVDAYQHYL-------
A0A518FTU3      TYLNILN-------------------LTYENPNS-HDAKVIMQAIVDAYQHYL-------
A0A517WHH5      TYLNILN-------------------LTYENKNS-HDAKAIMQAIVDAYQHYL-------
A0A5A8BGT3      TYLNILN-------------------LTYENKNS-HDAKAIMQAIVDAYQHYL-------
A0A2E7K7A9      TYLNILN-------------------LTYENKNS-NDAKVIMQAIVDAYHHYL-------
A0A517PTS5      TYLNILN-------------------LTYENKNS-NDAKVIMQAIVDAYHHYL-------
A0A6I6AH34      TYLNILN-------------------LTYENKNS-HDAKVIMQAIVDAYQHYL-------
A0A517VTK3      AYLNILN-------------------ILYENPRS-QDAKIVTQAIVDAYQRYL-------
A0A517WQT4      AYLNILN-------------------ILYENPRS-QDAKIVTQAIVDAYQRYL-------
A0A517VID8      AFLNILT-------------------ITYENPNA-KDAQAVTQAIVDAYKRYL-------
A0A517RK10      AYLNILS-------------------ITYENPLS-ADAKAVTEAVVKAYRKYL-------
A0A518IH18      AYLNILS-------------------ITYENPLS-QDAKAVTEAVVKAYRKYL-------
A0A5C5XLF4      HQLNILN-------------------LQYTTSKS-KDATAILNGIIKAYDDYL-------
A0A2D5NDU9      SDNDVIT-------------------LTLDNRHK-HEACALVNEVVEAYQKFQ-------
A0A1P8WP26      FGTNVLD-------------------VSYRSTDA-KVAAAVVAHVLVAYNSFM-------
A0A3L7V1F3      FSTTVLD-------------------LSYKSKDP-KAAQAVLRSMLAAYVEFL-------
D5SZ21          RQTNVLE-------------------LTCRSRDP-KAAAAILYAVLSASIDFL-------
A0A286RGB6      GNSEFMN-------------------VSFTSTRP-DETAVIVNAIVDAYMREV-------
A0A518CHE5      PQTNLID-------------------IRFTSQSP-ETAAYTIDQVIMAYLKFM-------
A0A1V5N3W2      RKTELIK-------------------ITMDSLNP-KEAELVVDAFVRAYMNIE-------
A0A3E0MY27      RMTAVLR-------------------ISMSGDEK-EPVRMIVEAVAQAYLENV-------
A0A7C4Z5R7      QGPEVLR-------------------LTLKGQNP-EELAAILNTITSVYLDQV-------
A0A2E0X9P6      GESELYS-------------------VDYVSPSA-SDAATVANLVVLEYLQMQ-------
A0A286RLF2      YRTNIIT-------------------VEYRSKDP-GVAARIVGAVVQSYLDFM-------
A0A517NSK8      KDAHTLQ-------------------ATYDDPSP-EDCAVVLRAIFDAYDVYL-------
A0A5C5Z0D6      RDAHILQ-------------------ASYDDPSP-SDCAVILRAIFDEYAAYL-------
M5UE94          KDAHTLK-------------------ATYDDPSP-VDCALILRAIFDEYKIYL-------
A0A2E8FLY0      RRTNLID-------------------VRYRSRDP-QVAATVVNHIVESYLTLM-------
A0A3D2U1E1      RRTNLID-------------------VRYRSRDP-QTAAAIVNHVVNSYLKLM-------
E8R3W3          FAGDLMM-------------------VSIPTPYP-EEASTLTNTLVNSYLRFA-------
A0A5C5ZM48      GDSELFR-------------------LSMESTDP-QAAKDVINALARSYLDFR-------
A0A5B9WF77      PDTNFIK-------------------ISLESTNP-QEAADTVNAVALAYKLAT-------
A0A518BBX8      SPDNVLE-------------------VSFSGKLP-EESRLILAAVIDSYRDFL-------
A0A1P8WN28      TDEYVLE-------------------IKCRSTSP-ESTVNVIEGLSVASGKFM-------
A0A3B9CTT0      SASQDLT-------------------ISCRSRDP-ESTVAVIEALQEVSEQFI-------
A0A518ALT3      GKSELYE-------------------VAYTSSSA-DDAATVANYVVAEYMTVE-------
A0A3M1QRP3      HNSSILE-------------------IAVTLPDS-YDSAVVANAIADEYLRAV-------
A0A517TMV0      RKTNIIR-------------------LGYESLDP-ETAAAVVRAVLDSYLDFV-------
A0A3E0MY88      KGTNIIH-------------------VRYQSKDP-DAAEAVLNSLLTSYKNFI-------
A0A5B9QF68      RKTNFIN-------------------VSFRSKSP-DAAAAVVRAIIHSYLQFV-------
A0A5B9QGF0      RRTNFID-------------------VTYRSKSP-DAAAAVVRAVINSYLQFV-------
A0A5C6CK24      RKTNFID-------------------VTYRSKHP-EAAAAVVRAIINSYLQFV-------
A0A2E3RCU8      RSTTVLN-------------------ISATSTQP-KNAVAMVNAVIQSYLQFV-------
A0A1C3E6N1      RQTNVLE-------------------LTCRSRDP-KAAAAILYAVLSASIDFL-------
A0A518GJT2      RQTNVLE-------------------LTCRSRDP-KAAAAILYAVLSASIDFL-------
A0A2E8B0L9      RRTNIVE-------------------LNYRSKSP-HAAEAVVDAVVDSYIEFM-------
A0A5Q4GFE7      RRTNVIE-------------------ISYKSRSP-GAAEAVVGAVVQSYLEFM-------
A0A257WS34      RQTNVMT-------------------LRYRSTDP-ELSAYIVSSVLNSYLKFM-------
A0A7C4LP10      RLTNIIT-------------------LRCTSKNP-QTAAFVVGAIVESYLRFM-------
A0A517MLW3      RNTNVIE-------------------LSYRSASP-KAAEVVLDVLVQSYLDFM-------
A0A5B9QVD0      RNTNVVE-------------------LSYKSGSP-EAAKAVLDTLVDAYLAFM-------
A0A3A0DET7      SQDDIIN-------------------VSAELPNA-ADAAQLVNSIVDAYVSKY-------
A0A3B8PNV4      RRTNLID-------------------VRYRSRDP-QVAATVVNHIVESYLTLM-------
A0A3D1DR40      RRTNLID-------------------VRYRSRDP-QVAATVVNHIVESYLTLM-------
A0A2E7RYU8      RRTNLID-------------------VRYRSRDP-QVAATVVNHIVESYLTLM-------
A0A3B8LXG8      RRTNLID-------------------VRYRSRDP-QVAATVVNHIVESYLTLM-------
A0A286RD13      DQAEILE-------------------ISMTGGDP-EQIAAIVNAVKDAYMSEV-------
A0A2E3GWX1      RQTNLLS-------------------VNYRTTDP-KSAAIIVTEILNSYFAFM-------
F0SG60          RQTNLLS-------------------VNYRTTDP-KSAAIIVTEILNSYFAFM-------
A0A2E9VST2      RQTNLLQ-------------------VSYCSESP-EVASLIVTEILNSYFQFM-------
A0A356A6X2      RQTNLLE-------------------VKYCSESP-EESSTIVTEILNSYFKFM-------
A0A5C5XLM3      RQTNLLE-------------------VKYCSESP-EESSMIVTEILNSYFKFM-------
A0A7C5FXU1      GNSELME-------------------VSYTAKNP-QEAAAIVNSVVESYLQEV-------
A0A3M1VCL4      KQTSLID-------------------VRYRSRDP-KAAAAMVEAILAAYLDFM-------
A0A5C5V7Z9      RRTKFIQ-------------------VSYRSHQP-ESAVAVVNSVINSYLRFV-------
A0A5C5YT05      RRTKFIQ-------------------VSYKSRRP-ESAVAVVNAVINSYLHFV-------
A0A518D7F9      RKTNVIE-------------------VRYRSKEP-EAATAVVTSVINSYLAFV-------
A0A5C5ZIP0      RKTNFVS-------------------VAYESLHP-EAAAAVVNAVINSYLEFV-------
A0A518KBK3      RKTNFIN-------------------VGYDSLDP-EAAAAVVRAVIEAYVDFV-------
A0A5C6AKF9      RKTNFIN-------------------VGYDSLDP-EAAAAVVRAVIEAYLDFV-------
A0A6M5Z0K7      PSTELVR-------------------VSMSSRGSGDDLRPIVHAVVRSYMSKS-------
A0A350CI62      YNTNVMD-------------------ISYRSRDP-RAAAAMLTAMLAGYEQFL-------
A0A4P5WQK6      YNTNVMD-------------------ISYRSRDP-RAAAAMLTAMLAGYEQFL-------
A0A3C1X4W5      YNTNVMD-------------------ISYRSRDP-RAAAAMLTAMLAGYERWL-------
A0A3D3W3A7      YNTNVMD-------------------ISYRSRDP-RAAAAMLTAMLAGYERWL-------
A0A518DRX3      RGTNLIE-------------------LSYRAKSP-EAATAVVAAILSSYLDFM-------
A0A518DZF9      RGTNLIE-------------------LSYRAKSP-EAATAVVAAILSSYLDFM-------
A0A518AKT8      RKGSFVE-------------------VRYRSLDP-DAAAAVVSEVVNSYLSFV-------
A0A5C5ZR72      GGSELYE-------------------VAYTSPSA-KESADVVRAVLQQYFARQ-------
A0A7C5R0U3      RRTHLIE-------------------LAYRSRSP-RVAHATLESLISAYHDFI-------
A0A517TY85      GKSELFE-------------------VAFHSRSP-DDAATVVNAVVMTYLEKN-------
A0A5B9QEI7      GKSELYE-------------------VSFVSPSS-QDAASVANVVVAEYLALQ-------
F0SI78          KAEDILL-------------------FTFTCGHP-KDAQKVLEAVIASYFAFL-------
A0A517MDV3      VVNYIIEQLWIERGGQELAYAPLTFVAEFRHNDA-ADCALVLSAITESYQDFM-------
A0A518IQ30      RRTSIIE-------------------LSYRSKST-PAAQAVLQAVVESYLEFI-------
A0A517LWP4      RRTSIIE-------------------LSYRSKST-LAARAVLEAVVESYLEFI-------
A0A518JNW8      RRTSIIE-------------------LSYRSKST-LAARAVLEAVVESYLEFI-------
A0A2E7ENQ5      RSTNFIE-------------------VSYRSRDD-EAAVAILDAVVESYLDFI-------
A0A7C2KUQ9      PRTSLID-------------------ITMQARDK-TSAAKIVNAVARRYEAHS-------
A0A7C5BZF0      QHTNVLE-------------------LQYRSKEP-RAAVAVVDAILDAYMEFI-------
A0A1G3AQE9      RNKNIIT-------------------ASYRSRDP-DAAVSVVSAVVACYLKFT-------
A0A3L7UQT9      RGTTLID-------------------VRYRSRSP-KVAAFIVQRIVTEYINNI-------
A0A4P5YBU2      RGTTLID-------------------VRYRSRSP-KVAAFIVQRIVTEYINNI-------
A0A7C7V5U8      QNTNVIK-------------------IEYRSRDP-DAAVAVVNAVLDSYLEFM-------
                                                                            

A0A5S9IPR9      EREIKNAQDKLLNWLKQV-------------VPNLEKKIREKRDILIKLQQEYPEIRT--
A0A533Q9U4      WEKRYNVAKDALDWLNKQ-------------LKDVKIALEESEAALQRYKRENDLISV--
A0A1U9NNE1      AYEENQGEDNKLALLENK-------------RASTAKQMQQQRKIIRQLAE------E--
A0A2G2JCA2      NQTEAVKDKRVLDLLETE-------------KNSRESGLKDLRGVVKTLAIETTGKDP--
A0A533Q6B7      WERRYSVAKEALEWLNKQ-------------MENVKDAVEQSELALQKYKKENNIFGI--
A0A5S9IJB5      RERRVGLSGTGIDILYRK-------------EGELRAELETFANQIQDYVL------K--
A0A1G2XVR0      LELRFAASQDAVKWLQDQ-------------LVDKKLKVEEAEEALILYKE------K--
A0A1G3B0P0      LELRFAASQDAVKWLQDQ-------------LVDKKLKVEEAEEALILYKE------K--
A0A1E3X4X0      LERRFLASQDAVEWIDGR-------------LKDLGKDLEKDEEELQKYKE------D--
A0A286U4B3      LEDKVLTTSGATDEIVEQ-------------LKEIKIKIEDSEKKLYKYAR------E--
A0A5C6DDS2      LEDKVLTTTGATGEIGKQ-------------LKEIKKRIEDSEKELYKYAR------Q--
A0A2E3GW02      DESQRTASNRTVELIKEA-------------KDDLTESLTKKETAYQQFREDS----A-L
A0A5B9QNZ7      AETLQDANSEATGLIQQA-------------RDDMSLEIDQLENTYREFRRST----P-L
A0A1Z8N7H5      DETHKGTAAKIINVMTQE-------------KDDIGRQLMEEETKLADARVAS----GDF
A0A1G2YPI3      ATQKRSTSSEILKILRAD-------------KTKRDKELSETLKKLLDFQNDN----PDI
A0A1U7CZ81      KDVQQSRDESHLKRLTVY-------------LDRLKKDKEEKVEALKEIVERGNVNGQSA
A0A142YNY8      NELTEGADGLMKKSLEDY-------------LKKMIDDKKEKVKELSTLMSKGKVDSQSL
A0A1U7GLS6      KDYKAGADKILRANLKTY-------------LDEKQKERKQKEKDLAALVDSG-VDARNV
A0A532UIN2      ATRKRSTSAEVLKILQSE-------------KTKRGKELTEKLTTMLDFKKEN----EAL
A0A0S8KNX5      VSASVEDEDKKLTILENE-------------RKLLAEKMESQRQAIYRLGQEY------G
A0A3D3UVZ8      VVSADEDENRQLAILENR-------------RDYLYEKIENDRQTIYQLGQEY------G
A0A517NFU9      ESHGHNSTEQAVELMEKA-------------RETHELELATADREYREFVTSV----P-V
A0A5C5YWH4      ESHGHDSTEQAVELIQQA-------------RQTHEEELAAADIAYREFVKSV----P-V
A0A3D2TNK4      EKHHKGTAGEIIADLTNE-------------RNQIQASLKSKQLQLQKFRQEV----GHL
A0A7C1Y4F0      AERKRDTASEVLKILQKE-------------KESRDKYLTDKLEEMIAFTEEN----GIV
A0A6I0ENW6      KGTADQRTRDLQQRLQEE-------------EGRLKNTLTSLISSRGTFTGKF-------
A0A6L3A0B7      KGTADQRTRDLQQRLQEE-------------EGRLKNTLTSLISSRGTFTGKF-------
A0A0J1B4A0      DEQTSSVGNEAAELIARA-------------QVQNEKALREADQAYREFVASV----P-A
A0A142WSB9      GQTKDKNSADLYAALQGS-------------RTALIDDISKMEAAWKAWRDASPYFYPTP
M5SZR3          EETYDTMSTDTVQLISEA-------------RDLLLRDIRKQEFEYREFRRES----P-L
M5TW92          EETYDTMSTDTVQLISEA-------------RDLLLRDIRKQEFEYREFRRES----P-L
A0A2S8FKY2      IETERLARVTRLENLERV-------------HSETENKARQMRSDFKQLAETLGTSDS-E
A0A517N8P6      NGRHQGNIENVVGFFRDS-------------RDSIIPKLDELENEFTEFRANA----P-L
A0A432MJP4      EESYQSNNTKVVTLITEA-------------RDLISKELVDLEQKYLEIRKKN----T-V
M5UQ35          DNQSRAIGSEAADLIANA-------------QLKNEETLRRADKAYREFLASM----P-A
A0A0S8FY64      VAARQQSAGEAFEMLQRQ-------------MKEQEKALVKAEDDLLTYREQT----TIP
A0A1N6KFT7      ETNYQKNNQEVITLVSRA-------------RDDLKKELDLLQAEYHKFRKDN----P-G
L0DFG4          ETNYQKNNQEVITLVSRA-------------RDELKSELDTLQDEYHKFRKNN----P-G
A0A5C5XXG1      DQQISDMMDLATAKINEA-------------KNEVEGELHIAEKKYLEHRQTA----P-M
A0A7C7YUM8      VQIGRLKAERTLGFIERQ-------------LQGQLVTLQAAERVVADLQSEN----P-E
A0A7C2AHI6      IRIGRYRASQTVTFVSEQ-------------LAAQEQALREAEDEVVQLQSLH----P-E
A0A518BJJ1      VERGRKRASQTVGFIQSQ-------------LDEQLAALETAEHEVVDLQAEN----L-D
A0A518D182      VERSRRRASQSIGFIEDQ-------------LDEQTAALETAEADVVALRKQY----P-D
A0A5C5WTY6      SQKVDEILERSHRVVLDT-------------QQQLAAKIGELEQRQKLARDQA----P-I
A0A5C5Y033      VSQVESVMGEAGRMIQDA-------------KRALEADLQAAEEEYLVSRQNA----P-L
A0A5C6G1Y2      VSQVESVMGEAGRMIQDA-------------KRALEADLQEAEEEYLVSRQNA----P-L
A0A354PDV6      AGQLESVMSKANEYITHA-------------KDEVESELRNAEQDYLTARKAA----P-M
A0A5C6FZ02      DQQISDMMDLATAKINEA-------------KNEVEGELHVAEKKYLEHRQTA----P-M
M5TIT3          IAQVEQLMGKANEMIHEA-------------KQEVESELLASEQEHLKARQNA----P-L
A0A5M6CY44      VAQVEQVMGRANELVQKA-------------KSDVEESLATAEQEQLKARQEA----P-L
F2AXG2          IDQIDQVMSHADKMVQEA-------------KSVVQKNLKEAEDEYLAARRKA----P-L
M2BB46          IDQIDQVMGHANDMVTEA-------------KSKVEKSLEDAENEYLAARQKA----P-L
L7CLQ6          KDQIEQVMGQANNLVEQA-------------KTDVQGKLTNLEAEHLKFRRDA----P-L
A0A0J1B719      IDQVEQVMGRANEMVNKA-------------KTEVETDLIAAEQEHLKARQEA----P-L
Q7UF18          IDQVEQVMGRANEMVNKA-------------KTEVEAELVAAEQEHLKARQEA----P-L
A0A2G1W1E0      IDQVEQVMGRANEMVNKA-------------KTEVEAELVAAEQEHLKARQEA----P-L
K5E235          IDQVEQVMGRANQMVNKA-------------KTEVEAELVAAEQEHLKARQEA----P-L
A0A5C6FFI9      ESHTQDTSREAAELIDAA-------------RIENEKELDAADREYREFISSV----P-V
A0A5C5WDJ1      DSQDQDKSKLAVELIDAA-------------RETHEKELRDADEDYRNYVASV----P-V
A0A5C5X547      VKADEQKDNKRLADLQLL-------------YQEKTKELKAARTRLVDLAETAGSGSS-E
A0A353FIP5      RERLALPAEKTVTYIEGQ-------------VERIQLELAEAEAELVA------------
A0A5B1CIK7      ISQVEQVVGQANQMVNQA-------------KNEVETELVAAEQEYLTARQNA----P-L
A0A5C5WHS2      INQVEQVMGRANEMVNKA-------------KTEVETDLVAAEQEYLTARQEA----P-L
A0A5C6B6G8      IDQVEQVMGRANELVQTA-------------KSEVEAELNAAEQEHLASRKAA----P-L
A0A5C5ZZN3      IAQVEQLMGRANEMVNEA-------------KQEVESELLAAEQEHLQSRQNA----P-L
A0A5C5XS91      IAQVEQLMGRANEMVNEA-------------KQDIEADLVAAEQEHMKSRQSA----P-L
A0A5C6C4E6      IAQVEQLMGRANEMVNEA-------------KQDIEADLIAAEQEHLKSRQDA----P-L
A0A2E1VVJ1      HDRLAAQAGATEAFVSKE-------------IERIQGELDAAEDEIVK------------
A0A3M2AEL0      KSRLSRQASSTVQFIKDE-------------IERVRRELEDAEQELVS------------
A0A2A2W9R6      DGQSRDVGAEAVELIAKA-------------QVQNEIALQKADQEYRDFVASV----P-A
A0A518HKC1      DGQSHDVGAEAVELIAKA-------------QVQNEIALQEADQAYRDFVASV----P-A
A0A518L3P0      DGQSHDVGAEAVELIAKA-------------QDQNEVALQKADQEYRDFVASV----P-A
A0A255R1S0      ETRSQSVGSEAAELIANA-------------QAKNEEELRAADKAYRDFVASV----P-A
A0A5B9MKP1      EGHSENVGAEAAELIAKA-------------QLRNEMDLRKADEEYRNFVASV----P-A
A0A0S8J591      KEWRSSAFDASVRALLNR-------------AQDIKREQDKASRAVQDFSA------E-R
A0A351FYP6      SSLQEERVKAGIDKLRER-------------MKKTNDEITAMQANVDDLRA------K-L
A0A532UT69      VSRKRNTSAEVLKIIQSE-------------KTKRTQELSEKLKTMTDFKK------A-N
A0A2D5AWU0      KRKKRESAEESAAIIRGE-------------LGSILKVRDDLTEKIIRLRT---------
A0A1G2YQB7      ASEEVKDGDHKLTVLENE-------------RRVMGEKIERQRKTLNDMAQ------E-F
A0A353P687      ATEELKDGDHKLTVLEDE-------------RRVMAEKIERQRKTLNDMAQ------E-F
A0A356EME5      AEVTDERVAKVIALLDRE-------------IANRKKHVEEKRRQIQTRTL-AETGKD-P
M5RT57          AKDNEDQTARVLELLGQE-------------KQARSVEIQNLREKMRQLGQ------D-V
A0A356KTN1      TQIAEKKVSEQADLLYQK-------------LTKSEQDLR----DFLNQSA------E-T
A0A518HFS8      VRQEEQERVERLERLEQL-------------FEKYQEELRAKREDYREQAQ------S-A
L0DC26          VDVEMKQSRQRYDLLKST-------------WNRYQESLREKRKQLKRLTELAGSDDK-T
A0A3L7P4E4      RETYTDQGMVVSNLLKDA-------------KEEWLTTLRKCEDEYAEFRK------S-S
A0A3L7PEB5      RESYADKGTVVAKLLTNA-------------KDEWTTNLRKLEAEYAEFRK------T-T
A0A1U9NL64      SQRKRSTSAEVLKILQKE-------------KTKRAKELEENLHAMMNFKR------E-N
A0A2N1UCJ3      TSQKKSSVSEVLKILQKE-------------KITRDQELSANFKELLEFTR------Q-Y
A0A7C4EK84      SRQQRWTAAELLKILNRE-------------KDRRDAELAEKLRAMLEFKQ------A-N
A0A7C3F0T2      GASRRSTAAEVLRILQRE-------------KARRETELAAALKAMTDYQK------S-N
A0A2E0X4J3      AGDYQDSALELLNILREE-------------KRDRQAELDAAQTALDDFRN------A-H
A0A5C5YU10      AEKHNTETFKILEILNGE-------------KQRRDKVLIEARRELTAFRE------A-N
A0A517MPZ6      AEERRTDTVEVLNILRNE-------------KQRRDAELEQRIEALEKFRG------Q-N
A0A5C6CNV7      AEERRTDTVEVLTILRNE-------------KQRRDAELEARRQELIEFRQ------Q-N
A0A518K5H4      AEERRSDVVDVVNILRSE-------------KQRSDQDLEERRQALDEFRR------D-H
A0A5C6AA28      AEERRTNVVDVVNILRSE-------------KQRRDDELESRRKALESFRQ------E-H
A0A2E7ESJ6      QEAYEDSGTETRDLIVKA-------------KDDLLKKWQMLEREYGEFKA------S-T
A0A2E9VK20      KDDARKNHAELQTLLEQI-------------NNDLSPRLAAKTKEYHEFRR------N-A
A0A3D4PJK1      KDDARKNHAELQTLLEQI-------------NNDLSPRLAAKTKEYHEFRR------N-A
A0A355AI52      DESHRGTANSIVDLLQNE-------------KEEVDKKIQVKQEEFLAVRK------K-V
A0A354PCQ3      DAFDSIRVNNLERWLEPE-------------IQRWEQEVAERRRVVQKLSE------Q-T
A0A0S8GZ23      DNIDLGMEDQDLANLRKL-------------KLELENKLKNHLQELRKINE------K-Y
A0A1I3DDV4      DEQVSRIMSEANRLITQA-------------QGKIESDLKSLEEQYVQARQ------S-A
A0A2E0SMM6      QETHQYGTQNLLTLLQQD-------------QANLIAQYKQNATDLIELQR------R-S
A0A3L7SI46      NEIHKGNSKESMVLLNRE-------------KAQSEVAIRNKETDLLGLKR------D-S
A0A5B9PJZ8      DSDAEEIGGQTTQLWKTL-------------NENMLSRTKEVQEEIEKLMG------L-P
A0A2S8G191      VDAEANMRRSRLSSLERA-------------YSETENELRSKRSEFRRLAD------T-L
A0A2E7EGG1      QEKRGQRAQSVISLLEDE-------------RARRSEEIKLLQAEVRQLQK------Q-L
A0A2E2N5A9      FEAGVATSATATAWMDSR-------------LEELRQKLQESENRLQAYRE------S-E
A0A7C8AGA2      VRDEIRGEDQKLNTLAEE-------------RRNLAEKIQRQQDTIRQLAD------E-F
A0A7C2FXP7      VSTSIQGEDRTISVLEEE-------------RRVLAENMQRQRHDILEMGK------E-Y
A0A2E3GWC6      QDDAQKSHRELTQLLNQI-------------NNDLTPRLNAKTEEYQRFRD------E-A
F0SLB0          QDDAQKSHRELTQLLNQI-------------NNDLTPRLNAKTEEYQRFRD------E-A
A0A3L7NDH9      QETHRGSAGTLVEVLTKE-------------KTDVDLRLQKTEAEFLVIRQ------R-V
A0A1N6DAJ8      VDVETKQRRQRYDLLKET-------------WNRYQENLREKRKELKRLTE------L-A
A0A532UD06      SARQKSTVSEVLRIIEKE-------------KVRRDEELSGKFSELLAFTR------E-N
A0A660URN1      SSRKRSTVSEVLKILQKE-------------KVKRDAQLTEKFQQLVQFTK------E-N
A0A517ZCB5      DHVMENTARDLLGILSQR-------------KDALERDLKAREAELIEMKS------R-S
A0A225EH48      DSDERQGRQRRRKIIEAH-------------LETLNRLIKSREDRLKDWVK------L-G
A0A518INW8      ESRTQNVGQEAATLINQA-------------QLTNEQELQQATQAYTNFLS------T-S
A0A518JPH9      ESRTQNVGEEAAALIIQA-------------QATNEQELQDATQAYTAFLA------T-S
A0A5C5VEK8      AEKRRNDTVEVLKILRSE-------------QERRDAALAEARQDLTAFRE------A-N
A0A532UTJ0      VLSAVEGENARLTLLEDR-------------RKGLYEKIDNERKTIYQLGQ------E-Y
A0A432MFP3      KEWSEARTNNAIRMLVEY-------------EKELGDKVEAQQKKLIELFK------E-A
A0A2E2CCW9      HEVREENTEDIIQQLKEA-------------EKQIAAELELKKNEYKKFRE------N-A
A0A3C0AGX3      HEVREENTEDIIQQLKEA-------------EKQIAAELELKKNEYKKFRE------N-A
A0A518AAQ5      DEVRDQNTGEIIQQLNKA-------------NKSLLAELERKKKEYTEFRK------D-A
A0A517QBG9      DEVRDQNTGEIIQQLNKA-------------NKSLLAELERKKKEYTEFRK------D-A
A0A518FTU3      DEVRDQNTGEIIQQLNKA-------------NKSLLAELERKKKEYTEFRK------D-S
A0A517WHH5      DEVRDQNTGEIIEQLNKA-------------NKALLTELEQKKKEYKEFRK------D-A
A0A5A8BGT3      DEVRDQNTGEIIEQLNKA-------------NKALLTELEQKKKEYKEFRK------D-A
A0A2E7K7A9      DEVRDQNTGEIIDQLNKA-------------NESILSDLEKKKQEYKEFRK------D-A
A0A517PTS5      DEVRDQNTGEIIDQLNKA-------------NESILSDLEKKKQEYKEFRK------D-A
A0A6I6AH34      DEVRDQNTGEIIDQLNKA-------------NESILSDLEQKKKEYKEFRK------D-A
A0A517VTK3      HEVRQVNTNEIREQLDQA-------------NKQILNDLERKKKEYREFRE------D-A
A0A517WQT4      HEVRQVNTNEIREQLDQA-------------NKQILTDLERKKKEYREFRE------D-A
A0A517VID8      SEVREENTEDIIQQLKDA-------------EQQIATELELKRNEYQKFRE------N-A
A0A517RK10      NDVSDENTKDIIKQLNVA-------------NQQISTDLEQKKKEYKEFRE------K-A
A0A518IH18      NDVSDENTKDIIKQLNEA-------------NQQILSDLEQKKKEYKEFRE------K-A
A0A5C5XLF4      KDDAQKNHSELQTLLEQI-------------NNDLSPRLAAKTKEYHEFRR------S-A
A0A2D5NDU9      RKMQRNSATELYRILDMD-------------RKRYEVEYDTALRALDEYCK------K-H
A0A1P8WP26      NDVNRGSSDKNIERLEAQ-------------FAEVTKELQELQAYRDELTK------R-S
A0A3L7V1F3      DDTHNGSSEESIRKLKQQ-------------LKDDNERLTLAEAERLRLRN------S-A
D5SZ21          NKNHQGTSQEILQILSKE-------------KVELEQKLATREAELIELRG------R-S
A0A286RGB6      VDTEQRERRQRLSELDQL-------------YSEKEADVRKLENDLKSLSQ------Q-L
A0A518CHE5      EETHQNGTQNLLKLLTED-------------QTKMENQYQENANQLIELQR------R-S
A0A1V5N3W2      GSRSMEGGNKNLEVLESE-------------RKAIQDKIQRQQETIRKMGE------E-Y
A0A3E0MY27      VRRERNDLLAKLSELERQ-------------HQELEADIGRRRKRYNDMVA------E-V
A0A7C4Z5R7      KKQDLERRQARFNQLQTS-------------YQTHEAELRIKQEQLRALEK------K-I
A0A2E0X9P6      GQQERQRTQLVIDLLEQE-------------RHARSSRLEQLRRRVVELSR------E-V
A0A286RLF2      RSTTQGTTAEIIRILTTE-------------KDDIAARLSEKEQALQQLSQ------Q-I
A0A517NSK8      KEHFSSNSSQAIDLLSQL-------------ANDTADEVREAEQNLT-------------
A0A5C5Z0D6      KEHFEGTSTQAVDLLTEL-------------SDKTAQDVKDAEEAFA-------------
M5UE94          DDHFAGTSTQAVELLTQL-------------SEETAQEVRDAERKLA-------------
A0A2E8FLY0      RGIHKNNAGNDIQFMTAE-------------KKKLDEETNQINAELLNLKR------Q-M
A0A3D2U1E1      REIHKSTASEDVEFLTKK-------------REKLDEETNAINAELLVLKR------Q-M
E8R3W3          NVLEMDRKMDEFSQLRDS-------------YVKFNESLNTKRKELQKLAE------Q--
A0A5C5ZM48      SKQESETKRRVIALLQQQ-------------KEKYFEDIKRLRGNLVTVAD------Q-A
A0A5B9WF77      QPDDTQLVPPAITGLRKDTAQAEVAALEEYRKKEIDSKIKMKKDALLKLAK------N-G
A0A518BBX8      DETYKNITDETATLMTQA-------------RDVLRKELRDKEEGYREFRL------E-S
A0A1P8WN28      DEYQKDLSVELMKQLERK-------------GETVLKGLLAKENELLEARQ------N-C
A0A3B9CTT0      EDYQTSLTVTLMNRLQED-------------RRGVETKLIEKNKELLEERR------D-C
A0A518ALT3      NDETDKRTNMVINTLREE-------------LKDREGHIEQLRTRVVDLAK------D-V
A0A3M1QRP3      REDEQEDSESLAAERRRQ-------------EELLRKQIEIKEEEVDALRK------M-L
A0A517TMV0      SESHRGAAADFLDKLIVQ-------------REKFETELANKQVQLLQIRE------R-I
A0A3E0MY88      KSTHGRTAEDVMEVLQQE-------------KIQLKGEIDRKKERLLEAQR------R-F
A0A5B9QF68      QEKDRGTAVDALHSLLQK-------------GAELEAKLTEKQNELQSFSQ------A-V
A0A5B9QGF0      QEKHQGTAGDALHSLLQK-------------GAELEAKLTEKQNELQSFSQ------E-V
A0A5C6CK24      QDKHQGTAGDALHSLLQK-------------GAELEAKLTEKQNELQDFSQ------Q-V
A0A2E3RCU8      DQTHQGTATKIIQVMTRE-------------KDNLARQLSAEEVKLADARL------A-A
A0A1C3E6N1      NKNHQGTSQEILQILSKE-------------KVELEQKLATREAELIELRG------R-S
A0A518GJT2      NKNHQGTSQEILQILSKE-------------KVELEQKLTTREAELIELRG------R-S
A0A2E8B0L9      KENHTDVSVEIVSILEKE-------------RVAKEQELQAKQQEMLSLKR------A-V
A0A5Q4GFE7      ERSHKDVSTEIVQILDRE-------------RLEIEGRLSTKQEEILDVQR------R-L
A0A257WS34      QATHRHSSRETLDVLTRE-------------KRDLESQLTQKEQQLHGLKS------Q-V
A0A7C4LP10      AETNRNSSQETLLLLTRK-------------RDEYAQILDEKESRLHQLKS------Q-S
A0A517MLW3      QQHHQDTSVTVLELLKGE-------------REKIEETLHLEQQRLIKLRD------E-A
A0A5B9QVD0      QQHHQDTSIQVLELLQAE-------------RTKVEKRLGEQQEKLVELRD------E-T
A0A3A0DET7      AEQRKTNTVEVLTILRNE-------------KHKRDAELAECRKALDDFRQ---------
A0A3B8PNV4      QGIHKNNAGNDIQFMTAE-------------KKKLDEETNRINSELLDLKR------Q-M
A0A3D1DR40      QGIHKNNAGNDIQFMTAE-------------KKKLDEETNRINSELLDLKR------Q-M
A0A2E7RYU8      RGIHKNNAGNDIQFMTAE-------------KKKLDEETNRINSELLDLKR------Q-M
A0A3B8LXG8      QGIHKNNAGNDIQFMTAE-------------KKKLDEETNRINSELLDLKR------Q-M
A0A286RD13      GDVSRNYALERKKLLEAN-------------YAQTLELVKKRDQRYRELAN------A-V
A0A2E3GWX1      QDMHQNSSREMLKLLTAE-------------RKKVEQQMTDKQNELLRLRA------E-S
F0SG60          QDMHQNSSREMLKLLTAE-------------RKKVEQQMTDKQNELLRLRA------E-S
A0A2E9VST2      HEMHESSSGELLETLTTE-------------RDNIQKQIFEKQAELLNLQR------D-S
A0A356A6X2      HEMHESSSGQMLDTLTKE-------------RDNIQNQILVKQSELLDLQR------E-S
A0A5C5XLM3      HEMHESSSGQMLDTLTKE-------------RDNIQNQILVKQSELLDLQR------E-S
A0A7C5FXU1      VGVELAERRQRLDELDQL-------------YSEKEAELRKRRNDLMQLAE------Q-L
A0A3M1VCL4      ERTHKKGAHDNLEVLTRK-------------QRQLEEEIRSKESQLAALRS------A-S
A0A5C5V7Z9      EETHRSTAADVLDVLTVE-------------RDQLQEELLQKQRLLQACRE------R-C
A0A5C5YT05      EETHRSTAAEVLDVLTIE-------------RDQLQSELLRKQKLLQEARE------R-C
A0A518D7F9      DRTHRGAALDIHEMLTTK-------------HAQLVEELDAKQRELQQVRN------E-V
A0A5C5ZIP0      EETHRGTAADVLNVLTVE-------------RDQIEQDLIVKQQLLQEFRQ------R-I
A0A518KBK3      GETHRGTAAEVLDVLTIE-------------RDQLEQSLAAKQLELQQSRE------R-V
A0A5C6AKF9      AETHRGTAAEVQDVLTTE-------------GTKLKQELSAKQLELQQTRE------Q-V
A0A6M5Z0K7      IEVEVDEKFKHLELLKTI-------------ALNYQIEIDKQRSSLK-------------
A0A350CI62      NETNRGLSEQGLKTLATR-------------LEAIEQEVKELQSRRLHLKA------S-A
A0A4P5WQK6      NETNRGLSEQGLKTLATR-------------LEAIEQEVKELQSRRLHLKA------S-A
A0A3C1X4W5      NETNQGLSEQGLKTLGTR-------------LEVIEQEVKSLQARRLQLKA------S-A
A0A3D3W3A7      NETNQGLSEQGLKTLGTR-------------LEVIEQEVKSLQARRLQLKA------S-A
A0A518DRX3      DKNHKDVSLEIVTILDQE-------------RKQVEETLAEKQDQMLDLQH------R-V
A0A518DZF9      DKNHKDVSLEIVTILDQE-------------RKQVEETLAEKQDQMLDLQH------R-V
A0A518AKT8      DQTHKGSAGDTIEMLDGR-------------LKQVQTDIQDKQRQLIELRD------R-V
A0A5C5ZR72      SDEEYQRAQRVIDLLERE-------------RARRQFEVERLRKHVIDLAK------D-L
A0A7C5R0U3      DEHHRGMAVEVADLLERE-------------RHDVQSRIEQKQQQLRRVQR------A-L
A0A517TY85      REKETDRSKLVISELEKE-------------SADRSMRVELLRKEVIALAR------K-L
A0A5B9QEI7      NREERQRSQMVIEVLEKE-------------RLERGTKVDQLRKRVVELAK------D-L
F0SI78          DESQRTASNRTVDLIKEA-------------KDDLTESLTKKETAYQQFRE------D-S
A0A517MDV3      AATLQDANSEATGLIQQA-------------RDDLTLEIDQLEQSYREFRR------G-T
A0A518IQ30      DTSHKDVSVEIATILKDE-------------LREKERDLKAKQEEWVQVSR------D-A
A0A517LWP4      DTSHKDVSVEIATILKDE-------------LREKERNLKAKQEEWVTVSR------D-A
A0A518JNW8      DTSHKDVSVEIATILKDE-------------LREKERDLKAKQEEWVTVSR------E-A
A0A2E7ENQ5      DLNQKNVATEIVRILDKG-------------RSDVASQLDAKEQELLVAQR------E-T
A0A7C2KUQ9      DEQQRMKSDLRWQELDQR-------------KRDLETEIAHHKEMVLKYRT------D-L
A0A7C5BZF0      EETYQGAAKEIVTLLTSE-------------KSQLEERLAEKEAQLLALRQ------E-A
A0A1G3AQE9      DSTLKGQAGEVFDVLSQE-------------KNTLGVELSHKEQERLALRQ------Q-C
A0A3L7UQT9      NRTYGNQTQDAVAKLTEE-------------KKETSRKLTEKNQEFLELQS------Q-T
A0A4P5YBU2      NRTYGNQTQDAVAKLTEE-------------KKETSRKLTEKNQEFLELQS------Q-T
A0A7C7V5U8      EQTQKGTASRVLEVFELQ-------------LDQGRAQMVAVETALRQARE------E-V
                                                                            

A0A5S9IPR9      -------------------------YNLEKEGRAISRVEA--AKSDLYELERSMYDVKLR
A0A533Q9U4      ------------------EAVGSENLTSEKQNVVLQKLME--LNTAVTYARTERIKLEVL
A0A1U9NNE1      ---------------------FGTTSLTGRQEMMLEQVMK--LQNELTTLETKRIALEAN
A0A2G2JCA2      ----------------------YVVTSSSERAGTYSPVSE--LQSRLVSAKVEKLVLEVE
A0A533Q6B7      ---------------EPVGSGESGRIEDPQHNVVFQKLEE--INAAITKAKIERLRLETL
A0A5S9IJB5      ---------------------NKLINVESRQNIIFQRLND--INEKLTEIELKRISAYTS
A0A1G2XVR0      ---------------QNIVGLGE------TAGIIEQKLEG--LKSNLTETKIEKVKLKAL
A0A1G3B0P0      ---------------QNIVGLGE------TAGIIEQKLEG--LKSNLTETKIEKVKLKAL
A0A1E3X4X0      ---------------EDLITLDNLGTVEQRQNIVLEKLSE--LSTELTRAKTQRIGVETL
A0A286U4B3      ---------------NDIVAMDA------SQSIILKELTT--ISDELTRAEAERIGKEIR
A0A5C6DDS2      ---------------NDIVAMDA------SQNIFMKELIT--ISEELTKAEAVRIAKEVR
A0A2E3GW02      LWT------------------SDEGN-----NLHQARLAQ--IEGQRSELLIKSSQVRAE
A0A5B9QNZ7      LTL------------------GPDSL-----NKNQIRLAA--LHSELIRLQLRESELESR
A0A1Z8N7H5      SIS------------------AESNIV----HPVVQSVIT--LNEAFLDAKKDSLIQQSL
A0A1G2YPI3      VLE------------------DSRG------NILIEQLQR--WSTLLTEAKLKTIERNSA
A0A1U7CZ81      GESKPKESTKTQGSDP-----APQTKDASIEKFSIEQYRN--FKADILKKKLELNELEFA
A0A142YNY8      TPNQASQANTAGPAAPADGTVQDSSKARNLGDVSIEQYRK--WKDRLLETQVDLFQAKAL
A0A1U7GLS6      AQREPAPDR------------QGEDPATTLQDVSMEELRT--IKAQLLDVQIELMTAKSR
A0A532UIN2      AFE------------------GSRG------NIVITRLER--LSQELTEAQLATIESKSA
A0A0S8KNX5      TVA------------------LGSRT-----DMMLQRVGS--LLSTLTEVEAERIKLEAQ
A0A3D3UVZ8      TVA------------------LEGRQ-----DMMLQRVAS--LLDTLTSVEAKRIELEAQ
A0A517NFU9      LIE------------------GSTVQ-----DVHKDRLEN--LEAELNIVTTSLAESRSR
A0A5C5YWH4      LIE------------------GDSVQ-----DIHKERLAN--LEKELHLVTNSLAESRSR
A0A3D2TNK4      AVS------------------TEDGVI----DPKIQRVMK--LNEVLLTAQEKRLSLQAN
A0A7C1Y4F0      SFD------------------DKGG------NIVFEMLRT--LSTELSQAEMAAMTAKTD
A0A6I0ENW6      ----------------------GSASLEDVQTLHNSERLK--LQGELRSLETTIKMYDWE
A0A6L3A0B7      ----------------------GSASLEDVQTLHNSERLK--LQGELRSLETTIKMYDWE
A0A0J1B4A0      LIS------------------SNINGRDSLEDVHRLRLNN--IEQQLGGIRESLSHAKSR
A0A142WSB9      PVV------------------TVNGVATPQMSPQAQALDR--VIREQESIQTQRANVQGK
M5SZR3          LTT------------------DEGGS-----NPVYSRIAA--IQRQQSELLLRRTELESL
M5TW92          LTT------------------DEGGS-----NPVYSRIAA--IQRQQSELLLRRTELESL
A0A2S8FKY2      TLS------------------LAQQGSVQHYGLVRNELAQ--VRFELMRAEGELDFLLSS
A0A517N8P6      EWN------------------GKGEAI----NPYRDDAIR--LEDNLYNLQSQARQLDSK
A0A432MJP4      LAT------------------DQSGR-----SFITRRVDG--WDSVINQTLVRAVELRTQ
M5UQ35          LVD------------------TNQDGEASLQDVHRIRLAQ--IESELSETRKKLAQVRAR
A0A0S8FY64      ELG------------------TPNEQ-----SPVLTRRRA--LNDEFTRVQLKRIELGVV
A0A1N6KFT7      FAI------------------GSNGQ-----TLTMRKLEQ--WSQGINNTTDLMIQLKTQ
L0DFG4          LAI------------------GANGQ-----TLMMRKLEQ--WSQGINNTTDLMIQLKTQ
A0A5C5XXG1      LFQ------------------GEGSS-----NVYQDKYRR--LQDELIDLQIQESTIKTR
A0A7C7YUM8      TIS------------------LPDAA-----KAVIDRLSA--LELQRTQLDLARTVLRQA
A0A7C2AHI6      TID------------------VSAAS-----QAWIDRVSD--LELRRTQAELARTALGEA
A0A518BJJ1      AID------------------SVATA-----ESLIRNLSD--LEVQRMRLDLQASSLSES
A0A518D182      LID------------------LTTSA-----GRIVEQLSG--FEVERLRLDLARHALEEA
A0A5C5WTY6      LFD------------------GSNTT-----NVYEERYRS--LQSELVSADLEVSKLRSR
A0A5C5Y033      FFQ------------------GEGSS-----NVYQDRYRR--LSEELLELDIQQSTMRTR
A0A5C6G1Y2      FFQ------------------GEGSS-----NVYQDRYRR--LSEELLELDIQQSTMRTR
A0A354PDV6      LFQ------------------GEGSS-----NVYQDKYRR--VEEELLNVDIEESSLKTR
A0A5C6FZ02      LFQ------------------GEGSS-----NVYQDKYRR--LQDELIDLQIQESTIKTR
M5TIT3          FFQ------------------GEGSS-----NVYQDRYRR--LQEELLDVDIKESTVRTR
A0A5M6CY44      FFQ------------------GEGSS-----NVYQDRFRR--LQDEMLDLDIQESTLRTR
F2AXG2          SFQ------------------GEGSS-----NIYQDRYRR--LQDELLDLDIQESTVKTR
M2BB46          FFQ------------------GEGSS-----NIYQDRYRR--LQDELLDLDIQESTVKTR
L7CLQ6          FFQ------------------GEGSS-----NIYQDRYRR--LQDELLDLDIQESTVKTR
A0A0J1B719      FFQ------------------GEGSS-----NIYQDRYRR--LQDELLDLDIQESTVKTR
Q7UF18          FFQ------------------GEGSS-----NIYQDRYRR--LQDELLDLDIQESTVKTR
A0A2G1W1E0      FFQ------------------GEGSS-----NIYQDRYRR--LQDELLDLDIQESTVKTR
K5E235          FFQ------------------GEGSS-----NIYQDRYRR--LQDELLDLDIQESTVKTR
A0A5C6FFI9      LLE------------------GERVR-----DVHKTRLEQ--LESELNTVRTSLAEAKSR
A0A5C5WDJ1      LLE------------------GDKVR-----DIHKERLAD--IEKELNDVRSGLAESKSR
A0A5C5X547      SLT------------------LNQQSTLSEREILEKQRHE--LRFKRMELEAQLFALLET
A0A353FIP5      -FQ------------------EEEKA-----SVLSDTAQA--IVGRMSEIDLEQAKLVMM
A0A5B1CIK7      FFQ------------------GEGSS-----NIYQDRFRS--LQEQLLDIDIQESSIKTR
A0A5C5WHS2      FFQ------------------GEGSS-----NIYQDRYRR--LQEQLLDIDIQESTIRTR
A0A5C6B6G8      FFQ------------------GTGSS-----NVYQDRYRR--LQEELLDLDIKESTLRTR
A0A5C5ZZN3      FFQ------------------GEGSS-----NVYQERYRR--LQEELLDIDIQESTVRTR
A0A5C5XS91      FFQ------------------GEGSS-----NVYQDRYRR--IQEELLDLDIKESTVRTR
A0A5C6C4E6      FFQ------------------GEGSS-----NVYQDRYRR--IQEELLDLDIKESTVRTR
A0A2E1VVJ1      -YQ------------------EANET-----PVLPEVAKA--IVEQQSSLTLELARLRLT
A0A3M2AEL0      -YQ------------------EAEGA-----VALSEEASL--LVQRLSELDLRDADLDLR
A0A2A2W9R6      LLN------------------VSGSGVGSLEDIHRTRLKS--IEVELATVRAALASARSR
A0A518HKC1      LLN------------------VSGSGVGNLEDIHRTRLKS--IEGELASVRTALASARSR
A0A518L3P0      LLN------------------VSGSGVGNLEDIHRTRLKS--IESELANVRTALASARSR
A0A255R1S0      LVL------------------SGG-------NIQRDRLTA--IEAELNTIRRTIAEIETR
A0A5B9MKP1      LVN------------------VSGSGVGTLEDVHRARLKS--IEEELASVRRVLAETRSR
A0A0S8J591      E----------------------IYALPEIRSVVLTNERW--LQEAAAQANVEMIAAQSL
A0A351FYP6      GI---------------------SDAAGEDSYSIVEPEIVRRYESELITAKGLYTQQATL
A0A532UT69      EALAL------------------EGE---RGNVVTERLAR--LSSVLTEAQLATVEARHT
A0A2D5AWU0      -----------------------------ENNITQGGETL--IQARLTQTRELWTDAHFD
A0A1G2YQB7      GTIVL------------------DN----RQQMMMNHISR--MQEKLTELELERIVLQTK
A0A353P687      GSVIL------------------DN----RQQMMMNHLAK--LQEKVTELELERIVLQTK
A0A356EME5      FATTL------------------HAG---SGANWPHPLAG--LQTRLTEVEVEREVLEAE
M5RT57          VGMDP------------------------YTGMPQKNGGQ--AGAGPLERLRERLTAAEV
A0A356KTN1      PLLEE------------------------HEKLLVERIRI--NNNALSDIQRQRIQLNAQ
A0A518HFS8      GASDQ------------------------KGSAL--RQQM--VAEHLGQSRRELVQLQSE
L0DC26          TLASI------------------HQHELDRLGRAEDELSR--IQSELRSLRVE-AEVLEE
A0A3L7P4E4      SLIYN------------------GEN---VTSLSESRMAG--IEIERSKVMIAQTEIQSQ
A0A3L7PEB5      SLIYN------------------GES---VTSVSESRMAG--IEAERSKVLIAQTEVQSQ
A0A1U9NL64      EGLAF------------------ENN---GNNIILDRLAN--LSQAVTDAQLALIEAKSE
A0A2N1UCJ3      GVISF------------------EKS---GGNEVFQRLKA--LGDSLTIAQLDTIKAKAT
A0A7C4EK84      GALSF------------------ESD---RGNIITQKLAR--LSEALTTAQLQTVEAQAA
A0A7C3F0T2      DLLAF------------------QGS---DGSFMSKRMES--YSSALIAVQNELLDALAD
A0A2E0X4J3      PELAV------------------QVR---SSDIVSDRFSA--LTNELNETEIELLEAKAL
A0A5C5YU10      PELAV------------------LVD---NQDVASDRFSR--LMSELNQTELEQLTAKAE
A0A517MPZ6      AALAV------------------QVG---EENVITKRFAA--LASELDRVELALLDSKAR
A0A5C6CNV7      AALAV------------------QVG---EENVITKRFSS--LAQELDRVELELLDAKAR
A0A518K5H4      VTLAV------------------QSKEGREGNVVTELFAA--LSRELNATQIELLEAKTR
A0A5C6AA28      VSLAI------------------QSK---EGNVVNELFSA--LSQELNATQIQLLESKTR
A0A2E7ESJ6      PL---------------------MYNGQESINVHAQRQAD--YENERVSLQKQMTELGAQ
A0A2E9VK20      PLVWKAPAGA-------------DKGPNNVTNIHHQRVDA--IATERVKVELLYEEISSR
A0A3D4PJK1      PLVWKAPAGA-------------DKGPNNVTNIHHQRVDA--IATERVKVELLYEEISSR
A0A355AI52      ---------------GDLG----IKEGGKTMHPLVERAIQ--LNSTLIETQKKRLLLEAS
A0A354PCQ3      L--------------GYAPGSKTSILENQGAIALLTRLRS--QIAELTVELSVRDAQSAM
A0A0S8GZ23      G----------------------ADSLEGLQRVALGDITS--LREQLRNLELVISDTLTQ
A0A1I3DDV4      PI---------------------IYVGNESSNVYLDTFRR--LQDELVTVDIERSAVATR
A0A2E0SMM6      DLL--------------------LNNGTETVSLVGQRIIA--LQNSYMEAQNQMIKMQTL
A0A3L7SI46      GIL--------------------LHGNDKNSHVIIEQTVK--LNDALIEAQKKTLESRAL
A0A5B9PJZ8      EM---------------------LIVDGRVQNPYQLQQAR--LHEELHQLRRERTRLEAR
A0A2S8G191      ---------------GTGD----TASLSLVQQNALQQFAA--LRSELTRVQLDLLRAKGK
A0A2E7EGG1      V--------------ANDPSLTSTSLIGSDVVISESPLKS--MQENLAKAQIEHKVLAAQ
A0A2E2N5A9      G----------------------LVDLQGISTIAATELTL--TSDRLINARRQRAESESQ
A0A7C8AGA2      G----------------------STELTSRQEMMLQQVTS--LQNELININIRRISLETQ
A0A7C2FXP7      G----------------------DTALGTRHEMKMERVAR--LLSELTELEAERIHLEAK
A0A2E3GWC6      P---------LLWKAPPGA----DAAPGDVTNIHHQRVDA--IAAERVKVELKYQEITSR
F0SLB0          P---------LLWKAPPGA----DAAPGDVTNIHHQRVDA--IAAERVKVELKYQEITSR
A0A3L7NDH9      ---------------GDLG----IKSDGKVMHPLVERAIQ--LNAALIEAQKKRLSLQAS
A0A1N6DAJ8      ---------------GSDD----KKTIANIHQHELDRLGR--AEDELARVQSELRSLRIE
A0A532UD06      GV---------------------VSFNDNGGNIVLERLTR--LSNALTETQLAALNAKAD
A0A660URN1      GI---------------------VSFDDKNGPIVFQRLAK--LSTALTDAQLATINAKAD
A0A517ZCB5      ---------------QLLF----ASDEDRMISVLNQRVIK--LNESLVKAQHEAIDARSF
A0A225EH48      ---------------QAPG----EQASVLKMKLLTDEVSK--FNSTVSSLSLEIVSHETN
A0A518INW8      VG---------------------MFDGDQLQSVSHNRLQS--IEQELANVRSQLTYAKSK
A0A518JPH9      VG---------------------MLDGEQLHSVSHDRLQT--LEQEIAEVRSQLVYAKSK
A0A5C5VEK8      PE---------------------LSVQVDNQDVASDRFSR--LMNELNQTELEQLTAKAE
A0A532UTJ0      ---------------GDIV-------LEGRQEMMRERVIA--LLDRLTAVQLDKISLEAQ
A0A432MFP3      EDPRRMLGNLAAMDGGVAPAASGEEGQRAAFQVDVDEYER--LSQALLELEYEEIEARAD
A0A2E2CCW9      P---------LYWESTPGS----EAAVAGSTNVHQERVKA--IDNERRLNLLKLTELKSK
A0A3C0AGX3      P---------LYWESTPGS----EAAVAGSTNVHQERVKA--IDNERRLNLLKLTELKSK
A0A518AAQ5      P---------LYWESTPGS----EAAVAGSTNMHQERVKA--IDNERRQNLLKLTELKSK
A0A517QBG9      P---------LYWESTPGS----EAAVAGSTNMHQERVKA--IDNERRQNLLKLTELKSK
A0A518FTU3      P---------LYWESTPGS----EAAVAGSTNMHQERVKA--IDNERRQNLLKLTELKSK
A0A517WHH5      P---------LYWESTPGS----EAAVAGSTNMHQERVKT--IDNERRQNLLKLTELKSK
A0A5A8BGT3      P---------LYWESTPGS----EAAVAGSTNMHQERVKT--IDNERRQNLLKLTELKSK
A0A2E7K7A9      P---------LYWENTPGS----EAAVAGSTNMHQERVKT--IDNERRQNLLKLTELKSK
A0A517PTS5      P---------LYWENTPGS----EAAVAGSTNMHQERVKT--IDNERRQNLLKLTELKSK
A0A6I6AH34      P---------LYWENTPGS----EAAVAGSTNMHQERVKT--IDNERRQNLLKLTELKSK
A0A517VTK3      P---------LYWENTPGS----DAAVAGSTNVHQERVKA--IDNERRLNLLKLTELKSK
A0A517WQT4      P---------LYWENTPGS----DAAVAGSTNVHQERVKA--IDNERRLNLLKLTELKSK
A0A517VID8      P---------LYWESTPGS----EAAVAGSTNVHQERVKA--IDNERRLNLLKLTELKSK
A0A517RK10      P---------LYWENTPGS----EAAVAGSTNVHQERVKA--IDNERRLNLLKLTELKSK
A0A518IH18      P---------LYWEHTPGS----EAAVAGSTNVHQERVKA--IDNERRLNLLKLTELKSK
A0A5C5XLF4      P---------LVWKAPAGA----DKGPNNVTNIHHQRVDA--IATERVKVELLYEEISSR
A0A2D5NDU9      P---------A------------MRLDMQGARASVEEHGR--VRKLIHDVDQRLLTARTE
A0A1P8WP26      ---------------PDFVG---VGDGESVVNLSVANMKH--LLARLSEAQQEAANAQAT
A0A3L7V1F3      ---------------PELVE---TGDKNSGLSIVSETIRL--LNIDYSAARRISEQSRTQ
D5SZ21          ---------------LTFV----SNGTDNATNVAVARVVR--LNEEFMKAKEETLRATAQ
A0A286RGB6      ---------------ETGD----SQALSLKQQITLQQFST--YRNELINVQLRMLRLQGE
A0A518CHE5      ----------------DLL----LNSGSETVSLVGQRILS--LQTAYTEAQNQMIKLESL
A0A1V5N3W2      ---------------GTIA----LTGRQDM------------MLARVSDLRQQLTQIESK
A0A3E0MY27      ---------------DVFD----GGQADANRELLMAEQKS--LREEIGLIRIDILRQQLQ
A0A7C4Z5R7      ---------------GVVDPQAMVLSQQTAQAAVTAAELK--LQEAQVATKRAQLEVSNL
A0A2E0X9P6      T---------GTDPFGQGA----VFNLDRALSPVDTLYQS--LNEIDVNQEVLKAELQAL
A0A286RLF2      ---------------GALD----VGVNSQTVHPLVERAKA--FNQALVEVQKERVQLAAS
A0A517NSK8      ---------------KHLASSKVMWDGSKTTNIYKKRLES--IEIDLLELTENEAHIESR
A0A5C5Z0D6      ---------------SHVASSTLMWDGQKARNIHKDRLMK--IEESLLELTEQEAEVESR
M5UE94          ---------------EHLAGSQIMWDGEKTRNIHKERLEK--IEDDLHELTEREAESSSR
A0A2E8FLY0      ----------------QII----SGPDNQNINPAAERVAA--LNKELIVAQNRTRENRAT
A0A3D2U1E1      ----------------QII----SGPDNQNINPAAERLQE--LNKHLIDAMNRTREARAT
E8R3W3          -----------------------YGSGDPIILEMRYQFHQ--NKVARLEQLLEEVNQRIR
A0A5C5ZM48      T---------KNDPYGGLM------SGGGGVSPLVEDSVR-----RLIEIDLARVSLTAE
A0A5B9WF77      G---------VQFKKDANAKGEPVDTPQATSDDLLEQFRS--TNELLMQTDFQLIEAEAK
A0A518BBX8      -----------------PL----LGRSSEGVDTNLESLAS--IQREISQLKLERAEVESD
A0A1P8WN28      ---------------GDIA----LSKESEDSHPLVQRVSH--LNENLTTVQSRRLQLEAT
A0A3B9CTT0      ---------------GDIV----INKNSTQSHPLVERVGQ--INQRFTELRSQRMELEAA
A0A518ALT3      T---------GRDPFGQGA----I-VGVTAFSPSTSVYQE--LTETEVSLEVAKAELQAL
A0A3M1QRP3      ------------------------------------RVHT--ADDLVNTQRLYLDKLESR
A0A517TMV0      ---------------GHLA----LPDRENVVDPIVARAIH--LNESLLEAQRERIEIEAS
A0A3E0MY88      ---------------GDFT----NGGETDHVHPLVERALA--LHTELTVAETERIKHQAA
A0A5B9QF68      ---------------GHLA----VSQDDSAVEPTIQRALR--LNDALMDEQQRRLELQAT
A0A5B9QGF0      ---------------GHLA----MSQDDSAVEPTIQRALR--LNDALMDVQQRRLELQAT
A0A5C6CK24      ---------------GHLA----VGQDDSAVEPIIQRALR--LNDALMDVQQRRLELQAT
A0A2E3RCU8      ---------------GDFS----IDPESDVIHPVVQTVVT--LNEAFLDAKKDRLVQQSL
A0A1C3E6N1      ---------------LTFV----SNGTDNATNVAVARVVR--LNEEFMKAKEETLRATAQ
A0A518GJT2      ---------------LTFV----SNGTDNATNVAVARVVR--LNEEFMKAKEETLRATAQ
A0A2E8B0L9      ---------------GALG----TEGSTTVVHPMVQRVIT--LNNALVEVQQERMQLEAS
A0A5Q4GFE7      ---------------RDLG----LSGNQNVVHPAVQRVIR--LNETLLKVQQDRLQLEAS
A0A257WS34      ---------------GLLL----SGNGTSESGTHIAADRARQLNLTLTTAVEQTAEARAF
A0A7C4LP10      ---------------GILL----SGTNEHERESHILAERAKKLNLALTDAVQKTADAKAF
A0A517MLW3      ---------------HVVG----FDNDSLKSHPALQRVNS--LNESLTQAQKTRIELQAI
A0A5B9QVD0      ---------------RVVA----FDDQSLASHPAVQRVNS--LNASLTDAQKTRIELQAI
A0A3A0DET7      ---------------QHME----LAVQLEQGNVVTQRFSS--LAEELNSTEIELLQAKAL
A0A3B8PNV4      ----------------QII----SGPDNQSINPAAERVAA--LNKELIVAQNRTRESRAT
A0A3D1DR40      ----------------QII----SGPDNQSINPAAERVAA--LNKELIVAQNRTRESRAT
A0A2E7RYU8      ----------------QII----SGPDNQSINPAAERVAA--LNKELIVAQNRTREARAT
A0A3B8LXG8      ----------------QII----SGPDNQSINPAAERVAA--LNKELIVAQNRTREARAT
A0A286RD13      ---------------GSAD----SEVARKKALTALETLAD--HRKHVNELRQQISGLERR
A0A2E3GWX1      ---------------DSL-----LGTGDSVVSVVNERVVE--LNRSLAAAQKETIESRSF
F0SG60          ---------------DSL-----LGTGDSVVSVVNERVVE--LNRSLAAAQKETIESRSF
A0A2E9VST2      ---------------DSL-----IGTGDNVMSVVNERVIE--LNRALAKAQQDSIQAQSH
A0A356A6X2      ---------------DSL-----IGTGDNVMSVVNERVIE--LNHALAKAQQESIQARSY
A0A5C5XLM3      ---------------DSL-----IGTGDNVMSVVNERVIE--LNHALAKAQQESIQARSY
A0A7C5FXU1      ---------------Q------------------TGDAEA--LNLKERSALQRFSMFRQE
A0A3M1VCL4      ---------------EEIV----TADGRQ-ISLIAEQIAR--LNQALLEAKKETINARVF
A0A5C5V7Z9      ---------------GHLA----IDQKDSVVDPLIGRAIH--LNDSLMQAQQQRLDLQAS
A0A5C5YT05      ---------------GHLA----IDQKDGVVDPMIGRAIH--LNDALMEAQQRRLDLQGS
A0A518D7F9      ---------------GRLV----AAGDSDAVDPMVARALK--LNDALMDAQAKRLEVEAS
A0A5C5ZIP0      ---------------GHLA----LPKDNEVVDPIIGRALQ--LNTALMEAQQERIGMQAS
A0A518KBK3      ---------------GHLS----LPDRDDVVDPIISRAIQ--YNDALLEAQRRRLDLQSS
A0A5C6AKF9      ---------------GHLS----LPDHENVVDPIVGRAIQ--YNDALMGAQRRRLDLTAS
A0A6M5Z0K7      ---------------SAMT----LNVGATSSDPKIVAYLQSNLMEQHSDAKRRERAIESQ
A0A350CI62      P---------ELVDTGERN----QNSLNTISKNIEM------LTQEYTNSRRRTEEARTT
A0A4P5WQK6      P---------ELVDTGERN----QNSLNTISKNIEM------LTQEYTNSRRRTEEARTT
A0A3C1X4W5      P---------ELVDTGERN----QNSLNTISKNIEL------LTQEYINARRRTEEARTT
A0A3D3W3A7      P---------ELVDTGERN----QNSLNTISKNIEL------LTQEYINARRRTEEARTT
A0A518DRX3      ---------------GDLG----MREGSTVVHPAVQRVVE--LNRTLIEAQKNRVHLEAL
A0A518DZF9      ---------------GDLG----MREGSTVVHPAVQRVVE--LNRTLIEAQKNRVHLEAL
A0A518AKT8      ---------------GHLA----LGDEKEAIDPIVQRALS--LNESWIEAQQQRVDLEAR
A0A5C5ZR72      T---------GMDPFGHRT----MTNADRAFSPLSGYHRQ--LAEIEVKKEVLRAELESI
A0A7C5R0U3      S--------------TAGM----LDHPD-AMHPLVARVMQ--LNEALMEARSRRVELESQ
A0A517TY85      T---------GTDPFQPGL----VTDVG-AITAAGSFHQG--IVEAEVGAEIARAELEAI
A0A5B9QEI7      T---------GKDPFGQGV----VTDAV-AFSPAGSLYQS--LTETDVEFEVLKAELQAI
F0SI78          ---------------ALLW----TSDEGNNLHQARLAQIEGQRSELLIKSSQVRAELEAI
A0A517MDV3      ---------------PLLT----LGPDSLTKNQIRLAMLH--NELIRLQLRESELQSRAS
A0A518IQ30      ---------------GDLG----LRSGSNVVHPLVQRAVK--MNDILVAAREKRLKLQAS
A0A517LWP4      ---------------GDLG----LRSGSTVVHPLVQRAVK--MNDILVAAREKRLKLQAS
A0A518JNW8      ---------------GDLG----LRSGSSVVHPLVQRAVK--MNDILVAAREKRLKLQAS
A0A2E7ENQ5      ---------------GDLG----LRNGSTITHPLVHNVVR--INEALIDVRKERMRLDAS
A0A7C2KUQ9      ---------------G----------------------VT--TADELVTQQRTRTDAEQA
A0A7C5BZF0      ---------------ADLG----YQTEGRMTHPLVQRAID--LNSKLMEARTRRISLEVA
A0A1G3AQE9      ---------------GVLR----VGPEGEVQHPLVQAAIA--LSEQLIESQSRRAKLEAS
A0A3L7UQT9      ---------------GNIY-----DGEGKSTNLLSLRVVE--LNKLLIEAQRVTLDAWSF
A0A4P5YBU2      ---------------GNIY-----DGEGKSTNLLSLRVVE--LNKLLIEAQRVTLDAWSF
A0A7C7V5U8      ---------------GAFA----EDGQAGVTHPVLKTAME--FTQELITLQKRRGDLEAT
                                                                            

A0A5S9IPR9      YGKCQEVKK----------------------------KKSLEAILSSDLFVQNAMIDDLQ
A0A533Q9U4      YNKLKDFKSIQYKDD----------------------IIQSIPAVVQSPLIQNLKADYA-
A0A1U9NNE1      VQMKVNGDKVLL-------------------------APTDRMKLKYEFINADLTIKALT
A0A2G2JCA2      HQALKEIHEKET-------------------------FIVPETGLNQAVEQHPDVLTLRA
A0A533Q6B7      YNKLAILKNAQN-------------------------QAEIIQSIAPVVQNDLIQ-----
A0A5S9IJB5      YRETIDNYNKAK-------------------------------IISTPEILKSRTIQELK
A0A1G2XVR0      SDQIKQYSKDPT-------------------------LTKLIPEIVKDGSINTLKAKYA-
A0A1G3B0P0      SDQIKQYSKDPT-------------------------LTKLIPEIVKDGSINNLKAKYA-
A0A1E3X4X0      YNEIQKLSERPE-------------------------MIEAITPVIENRLIQDLKADYA-
A0A286U4B3      FLAVQNSDD-----------------------------LSSLPGIADNKLINELKLEYT-
A0A5C6DDS2      FLAVQNSDD-----------------------------LSSLPGITDNVLINELKLEYT-
A0A2E3GW02      LEAIQNALNRGTSR-----------------------QALLM------------------
A0A5B9QNZ7      AIILKNTAGQESLR-----------------------E---FSDLERLGLIDARDVERLA
A0A1Z8N7H5      VEGIQRAIVRG-------------------------------EDLKQYAMAVEETIGKEL
A0A1G2YPI3      YESTKEMVSDPVKL-----------------------QQ---------------------
A0A1U7CZ81      LQKRVADSQ---EQ-----------------------DSEVAETTGFQKSQLEARINETF
A0A142YNY8      LEQRTADYQNGAEI-----------------------EQLESGLRP-SEEELTERIQAAF
A0A1U7GLS6      LQSRTQDYQDLGQI-----------------------EPTAAETATLPEEEVARRIEAEF
A0A532UIN2      YESVGEMVSDPVKL-----------------------KQ---------------------
A0A0S8KNX5      VQLLELTKTQPIA-----------------------------------------------
A0A3D3UVZ8      VLLLERTREQPIS-----------------------------------------------
A0A517NFU9      LEVIKSYLATRDSS-----------------------K---INSMDHLALLSQKEVERLK
A0A5C5YWH4      LEVIATYLADRNGQ-----------------------E---INNIDHLALLSHNEVERLK
A0A3D2TNK4      LATVETAYNRG-------------------------------EDLNQHLMHLEAPLGQQV
A0A7C1Y4F0      FDAIMGIEDDPFKI-----------------------KQFAA------------------
A0A6I0ENW6      RDYLRQIVEGATPE-----------------------EADAAADGTSASASASVGVEEGG
A0A6L3A0B7      RDYLRQIVEGATPE-----------------------EADAAADGTSASASASVGVEEGG
A0A0J1B4A0      RVVIREFVKGKDPD-----------------------S---LSDVHVMSLLDADEIDRVN
A0A142WSB9      IATLKKMIAANESP-----------------------DEIQFWVMHALSAGTGGGAEGGG
M5SZR3          IQSLENAIESGLEP-----------------------K--------HLAMLISNAGVQLA
M5TW92          IQSLENAIESGLEP-----------------------K--------HLAMLISNAGVQLA
A0A2S8FKY2      NKAQIESVSRSGGD-----------------------GGLTTENAPGVGDDATPRVPVSD
A0A517N8P6      LRLIREAVKGGRHP-----------------------Y----AVFQEVQYLLDD------
A0A432MJP4      LELGKS--------------------------------------------LREKGVGLAG
M5UQ35          RQTIRDFVGGRSRD-----------------------E---ITDAEVLAILTEEELSRLK
A0A0S8FY64      VQANLG-------T-----------------------GEEPQDLEELLSISIVRS-----
A0A1N6KFT7      LELIKK-------------------------------MESSGSQGNAISLALSQFPTMTP
L0DFG4          LELIKK-------------------------------MESSGSQGNAIALALNQFPTVSS
A0A5C5XXG1      LARVENELEDLDGK-----------------------TLSMTESMDKLALIDSESLERLG
A0A7C7YUM8      LEHLDG--GDFEAL-----------------------ARLGKETPNLLVLGYIKELATLE
A0A7C2AHI6      IALLRE--GKREAI-----------------------ARLAKEVPDLESLVLIQEVGRLS
A0A518BJJ1      LALLRG--GDFDAL-----------------------GRIAQELDDPLAKSLLEQLSVLH
A0A518D182      LELTQA--GDDRGL-----------------------SQLSSELADPLSKGLVERLETLG
A0A5C5WTY6      LEQVNSTIEQIAAS-----------------------DRKS-DHIDKLALIDVESLQRMG
A0A5C5Y033      LERVRESLKHIGGG-----------------------SDLS-DHLDKLALIDSDSLERLG
A0A5C6G1Y2      LDRVRESLKHIGGG-----------------------SDLS-DHLDKLALIDSDSLERLG
A0A354PDV6      LERVRETLGDMDLD-----------------------GPLS-EHLDKLALIDSESMQRLG
A0A5C6FZ02      LARVENELEDLDGK-----------------------TLSMTESMDKLALIDSESLERLG
M5TIT3          LQRVADTLNEMDDS-----------------------GDAF-DHLDKLALIDSESLERLG
A0A5M6CY44      LDRVQAVLAELEES-----------------------NDPV-DNLDKLSLIDSESLERLG
F2AXG2          LARVDETLKEMDGS-----------------------VDPI-DQLDKLALIDSESLERLG
M2BB46          LTRVDETLKEMDES-----------------------VDPI-DQLDKLALIDSESLERLG
L7CLQ6          LTRVDETLKEMDES-----------------------VDPI-DQLDKLALIDSESLERLG
A0A0J1B719      LTRVDQTLKEMDES-----------------------TDPI-DQLDKLALIDSDSLERLG
Q7UF18          LTRVDETLKEMDES-----------------------TDPI-DQLDKLALIDSESLERLG
A0A2G1W1E0      LTRVDETLKEMDES-----------------------TDPI-DQLDKLALIDSDSLERLG
K5E235          LTRVDETLKEMDES-----------------------TDPI-DQLDKLALIDSDSLERLG
A0A5C6FFI9      LKVIEAFTDENETS---------------------------VNDFDKLALLSQKDVTRLK
A0A5C5WDJ1      LEVIESTLERNGGT-----------------------T----GDMGHLALLSQKEVERLK
A0A5C5X547      QKHRQAVGETAPNE-----------------------DGQPVVSEEPVDPSLRAPLPPLP
A0A353FIP5      AERQNQLAESLRKG-------------------------SPVEEVGAAVELDPQ------
A0A5B1CIK7      LKRVEVTLNEIDET-----------------------NTSAVDQLDKLALIDSESLERLG
A0A5C5WHS2      LERVEETLSEMDEE-----------------------KSTAADQLDKLALIDSESLERLG
A0A5C6B6G8      MERVQATLEDMDTS-----------------------T-DPVDHLDKLALIDSESLERLG
A0A5C5ZZN3      LTRVEDTLKEMDDS-----------------------G-DAFDHLDKLALIDSESLERLG
A0A5C5XS91      LQRVDATLKEMDGS-----------------------D-NPVDHLDKLALIDSESLERLG
A0A5C6C4E6      LQRVDATLKEMDGS-----------------------D-DPADHLDKLALIDSESLERLG
A0A2E1VVJ1      IRAHELVAERLQDP-----------------------E-ASLMSLAGAIELDPL------
A0A3M2AEL0      IRTVKNLIETVRTS-----------------------D-SGLERLVSVPDLDPV------
A0A2A2W9R6      RLVIADAVKGKRAD-----------------------E---LTDAGVMALLTEEDIARLE
A0A518HKC1      RLVIADAVKGKRPE-----------------------D---LTDAEVMTLLTEDDMARLQ
A0A518L3P0      RLVIADAVKGKTPE-----------------------D---LTDAAVMTLLTEEDIARLQ
A0A255R1S0      RQKISSSVKGQRPE-----------------------E---LTDAQLATLLSKEDISRLQ
A0A5B9MKP1      RSVIAEAVDGKAPE-----------------------E---ITDADVMTLLSDTEVTRLQ
A0A0S8J591      YDAVNKAVEEGT------------------------------------------YENTRD
A0A351FYP6      LQGLQEQSLEEL-------------------------RESIMTANPDAQLDALIREYQTG
A0A532UT69      YESMKAMVSDPA-------------------------KLSQFIEAQRATGPYGTNGEKAA
A0A2D5AWU0      MLRERATFELFS-------------------------RAEADAEKFLDLGRNRRSTKQNP
A0A1G2YQB7      IDLHSSKEEKTI-------------------------TPEMMAKLRHDFINSDLMVQTTA
A0A353P687      IDLHSSQKEKTI-------------------------TPEVMAKLRHDFINSDLMVQTTT
A0A356EME5      WKALNEM-PNPL-------------------------AQQVDEALAGNVTSAVETNPQVQ
M5RT57          DRKMLEMEITAI-------------------------REAMAKEDLRIAEVDVEMAVGES
A0A356KTN1      L-------------------------------------ESIQRVLEQGRPLESASPIATN
A0A518HFS8      IRKARAEVTVLA-------------------------EDAATPAAAAHRDLGFEGLIGRD
L0DC26          QATLNETMVTPA-------------------------MIEDAISRDRSIELYKEKEGLAQ
A0A3L7P4E4      IDAIQKALERGG-------------------------SREAITLMLESFNDKKKSGDGLE
A0A3L7PEB5      IDAIKKALDRGG-------------------------SREAITLMLESFNDKNNSGEAVE
A0A1U9NL64      YDTVKAMVSDPK-------------------------KVKQFVEAKRVSGLYVSSGTENT
A0A2N1UCJ3      LEAVKKF-DSPQ-------------------------KVRQYAMAQPGISSNLFARDMET
A0A7C4EK84      YDAAQAI-KDPT-------------------------QLRQLVQMQQSRQTGVGPERGGG
A0A7C3F0T2      VQATRETVEDPT-------------------------RFRRFVELRRLGGREGLAAPEEG
A0A2E0X4J3      HNRVQRMYESPT-------------------------LRPLLADMAMDGKPVDT---LEE
A0A5C5YU10      YERVKEMAASPT-------------------------LRPMLLDMALDSVGKAN------
A0A517MPZ6      HNRTQQMLESPS-------------------------LRPFLLELASGQQSVAQDISLEN
A0A5C6CNV7      YNRTKSMYETPS-------------------------QRPFLLELASSQQQVANEIRSES
A0A518K5H4      YARAQKMLENPD-------------------------QIPFLMELARTAQAGSR------
A0A5C6AA28      YARAKKMLENPD-------------------------QAPFLMELARSAHSNSR------
A0A2E7ESJ6      IKSVEEALERDD---------------------------NLESILLLAEKDGHQGLKEKF
A0A2E9VK20      LSTLKSAIERGE-------------------------SHEALMLLVKTFLQKDQTSNSQT
A0A3D4PJK1      LSTLKSAIERGE-------------------------SHEALMLLVKTFLQKDQTSNSQT
A0A355AI52      YQSLTEAIKAGQ-----NIRQS---------------LIAIEETLGKEAFLDSMGLGDRD
A0A354PCQ3      QNNLMQAESDGAGEVLQVAAEALVPDPVFQPRRKHPSESEIEQLVDRDPKVAEAKTRISR
A0A0S8GZ23      IELLSDPNHPID--------------------------------IPPDMLKNRSDSINND
A0A1I3DDV4      LQNVLTSLDQIKQNKGNSLEML---------------ALIDSESLTRLGTFGSFSSAQTQ
A0A2E0SMM6      IDALTEAIENGS-----NVQQYAE-------------EILGAGPVGNELLGQELGLQDRV
A0A3L7SI46      LISVQHALAEGN-----DIQPY---------------LQQAAGDISREFLLQELGVGAND
A0A5B9PJZ8      VTSIQQAKAMGK-----NPESL---------------------VIGVLQEFSETNMGAYT
A0A2S8G191      LAGIQSSVAANLTEPVVAKKPVVEEEENAPDAKQDVPLEEDSDVELQNILASDEVIAALK
A0A2E7EGG1      VQALEDSVQTGP-----AVPD----------------VLIEREIAGREEVQRVLVALNQK
A0A2E2N5A9      FRQVEAMKASRLDE-----------------------LASVPAVLSDPVIQQFKATKAQA
A0A7C8AGA2      IQVQENGIGDVA---------------------------------TPGSLIERQNAVINS
A0A7C2FXP7      IPVLEQTQGNYS--------------------------------ITSDELMQIRQQYINS
A0A2E3GWC6      IQTLRNAVQRGE-------------------------SSEALLLLVRTFLQRDQQSNTQT
F0SLB0          IQTLRNAVQRGE-------------------------SSEALLLLVRTFLQRDQQSNTQT
A0A3L7NDH9      QASFQTAIQNKQ-----NIRQS---------------LMAIEESLGKEAFLDSVGLSSRD
A0A1N6DAJ8      HEVSQEKVTQTA-----SMIT----------------PVMIEDAISRDRSIELLKARESA
A0A532UD06      FEATKKMANEPA-----KIRQF-------------------------AGAAAGAGAQVSG
A0A660URN1      FEAILSMVDEPE-----KIKQF-------------------------AMAQPNAGVRVFV
A0A517ZCB5      LLAIEEAIRQGE-----DIQQF---------------ASRMSEGLATELLKRHAGIASGD
A0A225EH48      LITLQHKQ-----------------------------SVIDMQEVSLDELEKAVAKNEKV
A0A518INW8      LETIAEIQAEDVEHQRTDIERL---------------ALLNPRDTERLRFFMDVASGDPS
A0A518JPH9      LESIAEIEASGSDQEQMDIERL---------------ALLNARDADRLKFFMDIANGDVG
A0A5C5VEK8      YERVKQMAASPS-----------------------------LRPMLLDTALDAFGSKSDL
A0A532UTJ0      VQLLERSTERAI--------------------------------APEELLRMRQEYINQD
A0A432MFP3      LEAVRRQAAATD-------------------------PRVWVDRRIEQVFLSDERVNALR
A0A2E2CCW9      IDSLKAAIASGE-------------------------SKETLELLAQQYLMGQTR-GQAA
A0A3C0AGX3      IDSLKAAIASGE-------------------------SKETLELLAQQYLMGQTR-GQAA
A0A518AAQ5      INTLKAAIASGE-------------------------SKETLELLAQQFLMGQAR-GQAG
A0A517QBG9      INTLKAAIASGE-------------------------SKETLELLAQQFLMGQAR-GQAG
A0A518FTU3      INTLKAAIASGE-------------------------SKETLELLAQQFLMGQAR-GQTG
A0A517WHH5      INTLKSAIASGE-------------------------SKETLELLAQQFLMGQAR-GQAG
A0A5A8BGT3      INTLKSAIASGE-------------------------SKETLELLAQQFLMGQAR-GQAG
A0A2E7K7A9      INTLKSAIASGE-------------------------SKETLELLAQQFLMGQAR-GQSG
A0A517PTS5      INTLKSAIASGE-------------------------SKETLELLAQQFLMGQAR-GQSG
A0A6I6AH34      INTLKSAIASGE-------------------------SKETLELLAQQFLMGQAR-GQSG
A0A517VTK3      ISSLKAAIASGE-------------------------SKETLELLAQQFLMGQTRGGQPG
A0A517WQT4      ISSLKAAIASGE-------------------------SKETLELLAQQFLMGQTRGGQPG
A0A517VID8      IDSLKAAIASGE-------------------------SKETLELLAQQFLMGQTR-GQAA
A0A517RK10      IDSLKAAIASGE-------------------------SKETLELLAQQFLMGQTR-GQAG
A0A518IH18      IDSLKAAIASGE-------------------------SKETLELLAQQFLMGQTR-GQAG
A0A5C5XLF4      LSTLKAAIERGE-------------------------SHEALMLLVKTFLQKDQTSNSQT
A0A2D5NDU9      AATAADFVDNPKLLAQLNLGAT---------------------ETGKPLISPPEELSTP-
A0A1P8WP26      LETLRQAVANGE-----DVLQY---------------ASEL----GEQVLAEVMGVSGQS
A0A3L7V1F3      FDGLQRAIASRE-----DILQF---------------ANKTLDTAGRQLIEQSMGLGSQD
D5SZ21          LAALEQAISRGE-----DVLQF---------------AMASLDVVGKQFMMGELGLDSQE
A0A286RGB6      LSIKKAIRDKAA-----QIPVT---------------DREIEAAARTDPVILQLQLRESE
A0A518CHE5      IKVLKQAIEKGS-----NAQQYAE-------------EILGPGPVGNELLSQEMGLQDRL
A0A1V5N3W2      KLALQSLVQLSE-------------------------QTKDKTIVPEKLLERRYDFINSD
A0A3E0MY27      ISQLQRLEANDP------------------------------EQVRQRLISNTLAADQQY
A0A7C4Z5R7      RARLTQKPR----------------------------VKVSEEAINEALAKDAVAE----
A0A2E0X9P6      NDAPIVYGDETA-----SSGLF---------------ALEISNREDIRELESRLAAQRDR
A0A286RLF2      LQALENAVQQGA-----DIRQY---------------LFAADDTLGQQILLGVLGFSREE
A0A517NSK8      LAVISDFVENADPEKVSDFDRL---------------ALLSEKEVNRLKVLFDVTRGDTM
A0A5C5Z0D6      LAVITDFLQNTDPNSITDFNRL---------------ALLSEKEVNRLKLLYEITRGDVA
M5UE94          LTVISDFLASKDASEITDVDRF---------------SLLSEKEVNRLKLMIEMTRGDVA
A0A2E8FLY0      LEAIENAAAQGQ-----SIEQF---------------AMQQIEVVGKEFLLRRMGLDSQD
A0A3D2U1E1      MQAIREAAARGE-----DIHQF---------------ALQQIEVVGKEVFLRQMGLNPQD
E8R3W3          LAEIRRQILLEE-------------------------QRTNRTGTGLTPRRDAEGKSDSN
A0A5C5ZM48      RENLKQDTPNHAA----DYAAA---------------EAAVVELIGRDEQLRAW------
A0A5B9WF77      LTARQAQAAG-------DVASQ---------------SQAPDSNVPNEQIREEFTRDPEV
A0A518BBX8      LLTLQRAIQEKE-------------------------PFDALLVMATEIAQKSKQTDTKD
A0A1P8WN28      LVSARELVATNS-----DLTSA---------------LKKLEEIVGEDVLERIPGAGATD
A0A3B9CTT0      MKSARRLVATQA-----DLTPA---------------VQALQRIVGPEVMQQVPGRPGLD
A0A518ALT3      KTSDIISADNAI-----ATGHF---------------ELEISNRADVRRLEDQI------
A0A3M1QRP3      REDLLLAISNREA----RLKR----------------LELLAASGDGAASAPAPDRRFSE
A0A517TMV0      QATIQSAIDNGS-----DLSRH---------------LALVEESLGEQAVLAAMGMGPND
A0A3E0MY88      LESIRAAIHSGA-----DLNQF---------------LMSAEQSVGRSVLMTALGINDRD
A0A5B9QF68      LLSVEGALDRGE-----NIHQY---------------LVAMEESVGRQMMLSSLGLSSED
A0A5B9QGF0      LASIDGALERGE-----DINQY---------------LVAMEESVGRQLMLSSLGLSSED
A0A5C6CK24      LVSVEGALERGE-----DINQY---------------LVAMEESVGRQMMLSSLGLSSED
A0A2E3RCU8      VEGIQRAIVRGE-----DLKQY---------------AMAIEETLGRELLAKGLGFSTDT
A0A1C3E6N1      LAALEQAISRGE-----DVLQF---------------AMASLDVVGKQFMMGELGLDSQE
A0A518GJT2      LAALEQAISRGE-----DVLQF---------------AMASLDVVGKQFMMGELGLDTQE
A0A2E8B0L9      LGAVRMAVRNGS-----DLRQH---------------MIDLEPLVGRQLVMSGLGLSPEA
A0A5Q4GFE7      LWAIRTAIRDGN-----DLRQH---------------LTAIEPLIGRELTMSVMGLNSKD
A0A257WS34      YEAVAYAVRSGG-----DIQQF---------------ITQVADVVGSQVLLRELGMGSQD
A0A7C4LP10      YEAVAFAVNSGG-----DIQQF---------------VMQLADVVGREVLLKELGLGTQD
A0A517MLW3      SAVVSDAIREGR-----DPRPH---------------MHAVDPDAARSLTAAVLGVAPEQ
A0A5B9QVD0      AGVVEQSIREGR-----DPRPH---------------MHAVDPEAARSLTAAVLGVAPEQ
A0A3A0DET7      FHRVKSMYDTPK----------------------------------QRPFLLDMAGDDQQ
A0A3B8PNV4      LEAIVDAAARGQ-----NIEQF---------------AMQHLEVVGKEFLLRRMGLDSQD
A0A3D1DR40      LEAIVDAAARGQ-----NIEQF---------------AMQHLEVVGKEFLLRRMGLDSQD
A0A2E7RYU8      LEAIVDAAARGQ-----NIEQF---------------AMQHLEVVGKEFLLRRMGLDSQD
A0A3B8LXG8      LEAIVDAAARGQ-----NIEQF---------------AMQHLEVVGKEFLLRRMGLDSQD
A0A286RD13      IAILQSRLRYMEE----HRPQT---------------SEEERRQRDEAVIQQIVENALRA
A0A2E3GWX1      YTAVEQAIRNGE-----NLQQL---------------MAQTNSSVASELMKIGIGVDSRD
F0SG60          YTAVEQAIRNGE-----NLQQL---------------MAQTNSSVASELMKIGIGVDSRD
A0A2E9VST2      YTAVEQAIRNGE-----SLQQL---------------MNQSNQTLANELMKLSAGVDSRD
A0A356A6X2      YTAVEQAVRNGE-----SLQQL---------------MNQSNQTLANELMKLSAGVDSRD
A0A5C5XLM3      YTAVEQAVRNGE-----SLQQL---------------MNQSNQTLANELMKLSAGVDSRD
A0A7C5FXU1      LGNIQMAILRAQA----EMRIR---------------EAWANESL-------KIPISEED
A0A3M1VCL4      LNAVENALATGQ-----DVFQL---------------MQGELEPVGRQMLESELGFSQQD
A0A5C5V7Z9      LASVSAALARGE-----DMRNY---------------LSVVEEAVGEQMMLASLGLSHQD
A0A5C5YT05      LASVAMAMARGD-----DMRNY---------------LSVVEEAVGEQMMLAALGLSHQD
A0A518D7F9      LATVREALASGQ-----DLRRY---------------VALVEEAVGQQMLMSAMGVAPDD
A0A5C5ZIP0      LATVRRAMSQGE-----DLRQY---------------LSLVQEAVGEQMLLSALGMGEND
A0A518KBK3      LTTIQMAIDRGD-----DLSQH---------------LGLVEQSIGEAAMLAAMGMGPND
A0A5C6AKF9      LATIQVAIARGE-----DLSQH---------------MGLVEESIGQAAMLAAMGMAPND
A0A6M5Z0K7      KQELQLKIDAAR-----ARLER---------------PAPKEAGAPNDRVDPLLERELDL
A0A350CI62      SQELQRAIASGE-----DILQF---------------AMETLDSAGRQLVEQSMGLGTQD
A0A4P5WQK6      SQELQRAIASGE-----DILQF---------------AMETLDSAGRQLVEQSMGLGTQD
A0A3C1X4W5      SQELQRAIAGGE-----DILQF---------------AMEALDSAGRQLVEQSMGLGTQD
A0A3D3W3A7      SQELQRAIAGGE-----DILQF---------------AMEALDSAGRQLVEQSMGLGTQD
A0A518DRX3      QTAVGDAVREGR-----DLRQH---------------LLTFSPEIGRELLVSSMGLGPEF
A0A518DZF9      QTAVGDAVREGR-----DLRQH---------------LLTFSPEIGRELLVSSMGLGPEF
A0A518AKT8      LAAVNSSIARGD-----DMRQH---------------LMSLEETLGQQVLISSLGMSSDD
A0A5C5ZR72      QEAEVVNTDFRE-----RSGAI---------------DLEVDMNGEVQQR----------
A0A7C5R0U3      QAALEEAIRQGR-----DLGPL---------------LLKIEPLVGRELMLVALGLDAES
A0A517TY85      KR-PIASDDQGS-----VSGIL---------------TLEVANRPDVRRL----------
A0A5B9QEI7      NNSPMLGEDRAV-----ASGLL---------------ELEISNRADVRRL----------
F0SI78          QNALNRGTSRQ--------------------------ALLMMADQARQRAGQSSAEGVQN
A0A517MDV3      ILARTQNDESLQ-----DFSDLERLGLIDNRDVERLALLVNVERGDANSDESFVAQQPMR
A0A518IQ30      EVAVKHAVETGG-----DLRQY---------------LVELEPTIGRELMLNELGMSPRF
A0A517LWP4      EVAVKHAIQTGG-----DLRQY---------------LVELEPTIGRELMLNGLGMSPRF
A0A518JNW8      EVAVKHAVQTGG-----DLRQY---------------LVELEPTIGRELMLNGLGMSPRF
A0A2E7ENQ5      LAAVRRAISQGQ-----DVRQF---------------MLSMEDAGGREMALGMLGMSTKD
A0A7C2KUQ9      QLASLRQEIKLI-----EFQLE---------------MARPVQEKGAPGDHAPVQPEYAL
A0A7C5BZF0      AQQLQLAIQTGA-----DLHQH---------------LLGISELVGQDLIRQRLGLNAPD
A0A1G3AQE9      LAAIEAAVHDGE-----DLEKC---------------ILLAAEVVGWEVLRNHLGSSADD
A0A3L7UQT9      LQTVEQAARTGQ-----DLQQL---------------MFQAVETLGASILSKQMGLGEQD
A0A4P5YBU2      LQTVEQAARTGQ-----DLQQL---------------MFQAVETLGASILSKQMGLGEQD
A0A7C7V5U8      LIEVRQAVGRGE-----NPLQY---------------LFDVQEVVGKEMMLAGLGLSELD
                                                                            

A0A5S9IPR9      KKKFL-----------------------YENQLRD-------------------------
A0A533Q9U4      ---------------------------RVENDFSL-------------------------
A0A1U9NNE1      EDMA-----------------------KLERDVLG-------------------------
A0A2G2JCA2      RIATN-------------------GSTALEYEKTA-------------------------
A0A533Q6B7      ---------------------------NLKGESIR-------------------------
A0A5S9IJB5      VQSLV-------------------------------------------------------
A0A1G2XVR0      ---------------------------DLQANKTM-------------------------
A0A1G3B0P0      ---------------------------DLQANKTM-------------------------
A0A1E3X4X0      ---------------------------RLEAQVSN-------------------------
A0A286U4B3      ---------------------------RLNAKYAS-------------------------
A0A5C6DDS2      ---------------------------KLQAKYAG-------------------------
A0A2E3GW02      --------------MADQARQRAGQSSAEGVQNAS-------------------------
A0A5B9QNZ7      LLVTVERGD-----ATTDESFVAQQPQRTTTATTE-------------------------
A0A1Z8N7H5      LIKGLGF-------NTENIQVRNQLEQGLLADISS-------------------------
A0A1G2YPI3      --------------FIEAQRARGMYIPQDSEKAKI-------------------------
A0A1U7CZ81      RRDPSVASLIQQILETDEELAHTVGVARKGYDPAR-------------------------
A0A142YNY8      LADPAIADLRDEILTVRDRLSHVVSNARKGNDPSK-------------------------
A0A1U7GLS6      RSDPMIADLYGQKQEVERRRDHVQKGARKVADPSR-------------------------
A0A532UIN2      --------------FIEAQRARGIYVSTDSAKASL-------------------------
A0A0S8KNX5      --------------PGELLSMRQSYINEDPAVVAF-------------------------
A0A3D3UVZ8      --------------PEELLKMRQDYINQDPAVVAF-------------------------
A0A517NFU9      LFLDVTRG------ETQSEAFQAEQPIRQEVAKAQ-------------------------
A0A5C5YWH4      LFLDMTRG------ETQSEAFQAEQPIRQEVAKAQ-------------------------
A0A3D2TNK4      LLSSVGVS-----------------PQDMQVLGDQ-------------------------
A0A7C1Y4F0      --------------ASTGSGVRMPVADREMQLRSE-------------------------
A0A6I0ENW6      E-AGVRGDERPRRLFWSDREWSRLYQDRESKRAAL-------------------------
A0A6L3A0B7      E-AGVRGDERPRRLFWSDREWSRLYQDRESKRAAL-------------------------
A0A0J1B4A0      AFLAISANR-----DDQTNDEMLSRAVMQESTRTE-------------------------
A0A142WSB9      GGGGGGGG------VLQGPSGKAELDGRLLAARLV-------------------------
M5SZR3          AMDDDAEPMGLDRLRMDQKFHSLELEDERDLAEGL-------------------------
M5TW92          AMDDDAEPMGLDRLRMDQKFHSLELEDERDLAEGL-------------------------
A0A2S8FKY2      ADDSVDEVAENGDGDSNDGEVADLKLSDVEMDEAI-------------------------
A0A517N8P6      --------------VRDIEQMHQAIVEAPNDNLEL-------------------------
A0A432MJP4      IAYALGQF------RGDPGESLAISSSAGRSQALA-------------------------
M5UQ35          TLVTLN--------RGDQDDLESVMLSRYLSQQSAKLE----------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      GGSNGQIP------QSSGTA------GSYEQLQKELAEVKLKRSITQRMVDNLKAGRPNS
L0DFG4          NGAGHLTQ------GMTGAAIGTSGTGSYEQLQKELADVKLKRAMTQRLVENLKGARPNA
A0A5C5XXG1      LFAGLQIS------ASNTAEFKATMPVRAEEARTR-------------------------
A0A7C7YUM8      A-ESLRLE------RTDVLGYKQLLQAEELRLRVAIEESHLTIQAFELALAAIEAGDESA
A0A7C2AHI6      A-EALLLD------RRDSGEFRLMLEQELNRERHGADETRLVASSVRAAREGLLRGDAGA
A0A518BJJ1      M-RLLLKG------RSDGDPYALLLAQRSELLEERAGELAMQIVAVRETIQAIDDGVPGA
A0A518D182      L-ERFAAA------RADGGPYRTLLQQRAVELDERADEARVELAALRAVLTAAEADEQGA
A0A5C5WTY6      VFTDMQRD------AASSTEARAELPGEVERARIE-------------------------
A0A5C5Y033      AFAGLQVS------ASNSAEFKAAMPAKMEEARAQ-------------------------
A0A5C6G1Y2      AFAGLQVS------ASNSAEFKAAMPAKMEEARAQ-------------------------
A0A354PDV6      LYASLQVN------AASTADFQATQPARIAEAQTQ-------------------------
A0A5C6FZ02      LFAGLQIS------ASNTAEFKATMPVRAEEARTR-------------------------
M5TIT3          VFAGLQMN------AADSPEFKAAMPAKAEEARTQ-------------------------
A0A5M6CY44      LFTGLQMN------SSNTAEFKAAMPAKIEEARTQ-------------------------
F2AXG2          VFAGLQMN------SANTAEFKAAMPAKAEEARTQ-------------------------
M2BB46          VFAGLQMN------SANTAEFKAAMPAKMEEARTQ-------------------------
L7CLQ6          VFAGLQMN------SANTAEFKAAMPAKAEEARTQ-------------------------
A0A0J1B719      VFAGLQMN------SANTAEFKAAMPAKAEEARTQ-------------------------
Q7UF18          VFAGLQMN------SANTAEFKAAMPAKMEEARTQ-------------------------
A0A2G1W1E0      VFAGLQMN------SANTAEFKAAMPAKMEEARTQ-------------------------
K5E235          VFAGLQMN------SANTAEFKAAMPAKMEEARTQ-------------------------
A0A5C6FFI9      LFLDMTRG------ESQSETFQAEQPARAEAARAQ-------------------------
A0A5C5WDJ1      FFLDMARG------GAQSEAFQAAQPMRAEVAKAQ-------------------------
A0A5C5X547      VGQSTNQWVLTEEILEEEYAFDPEIRRLNDEKEAL-------------------------
A0A353FIP5      -------------------------------TSSM-------------------------
A0A5B1CIK7      VFAGLQMS------ASNTAEFKSAMPAKMEGARAE-------------------------
A0A5C5WHS2      VFAGLQMN------SANTAEFRAAMPAQTEKARAE-------------------------
A0A5C6B6G8      LFAGLQMN------SSNTAEFKAAMPAKMEEARTQ-------------------------
A0A5C5ZZN3      VFAGLQSN------AADTAEFKAAMPAKMEEARTQ-------------------------
A0A5C5XS91      VFAGLQMN------ASNTAEFKAAMPAKVEEAHTQ-------------------------
A0A5C6C4E6      VFAGLQMN------ASNTAEFKASMPAKAEEAHTQ-------------------------
A0A2E1VVJ1      -------------------------------LQSL-------------------------
A0A3M2AEL0      -------------------------------TRTM-------------------------
A0A2A2W9R6      TLVSIAKER-----KGGDSGMDIARIVANTSSTSK-------------------------
A0A518HKC1      TLVSIAKER-----KAKDDGLDIARIVANTSSTSK-------------------------
A0A518L3P0      TLISIAKER-----KAGDDSLDIARIVANTSSTSK-------------------------
A0A255R1S0      MFMDFAEGRSKVEEKALTEEERMALALERQAQQEE-------------------------
A0A5B9MKP1      ALISIKKQR-----QPGSAGESESQAIARSSRQSA-------------------------
A0A0S8J591      TDLLQ----------------------RLRERLYA-------------------------
A0A351FYP6      QTTLA-------------------------------------------------------
A0A532UT69      LE---------------------TRLEQLQLRLSD-------------------------
A0A2D5AWU0      NLEPE-------------LQEIEKDLLEKELQLQ--------------------------
A0A1G2YQB7      -----------------------SNVANLEQVLIT-------------------------
A0A353P687      -----------------------SNVANLEQVLIT-------------------------
A0A356EME5      ALVQQ-------------IWMAETTLREMAA-----------------------------
M5RT57          QEVLD-------------LR---ALIADRKSMMHR-------------------------
A0A356KTN1      HIVLN-------------LR---NRLSEAELDLAG-------------------------
A0A518HFS8      PVVAK-------------LR---ADLAEYSGRLEQ-------------------------
L0DC26          RAIDR-------------VY----------------------------------------
A0A3L7P4E4      TSLTP-------------TQKFTREIFQLELEEAL-------------------------
A0A3L7PEB5      KALTP-------------MQKFTREIFQLELEEEL-------------------------
A0A1U9NL64      RLKAE-------------LD-------RLELRLAD-------------------------
A0A2N1UCJ3      KLRDE-------------LQ-------SLETELEN-------------------------
A0A7C4EK84      ALAVE-------------LG-------RLELQLDL-------------------------
A0A7C3F0T2      VLRAD-------------VA-------RLELQLRE-------------------------
A0A2E0X4J3      RSVLA-------------LQ---EQVQAIEMQIVA-------------------------
A0A5C5YU10      -LNDD-------------LEALLNQQQELELLLMA-------------------------
A0A517MPZ6      RLQVD-------------LE---KQIQDIQLQIDA-------------------------
A0A5C6CNV7      QLSLD-------------LE---NKIRDLDLQIAS-------------------------
A0A518K5H4      --SGD-------------LD---GQIQMMEQNLIA-------------------------
A0A5C6AA28      --GSD-------------LE---GQIQSVEQSLVS-------------------------
A0A2E7ESJ6      SSRLA----------------------LMQDRYMA-------------------------
A0A2E9VK20      VVSGA------------------TERQQLDSQLIP-------------------------
A0A3D4PJK1      VVSGA------------------TERQQLDSQLIP-------------------------
A0A355AI52      KQTRI----------------------SVEKQLLE-------------------------
A0A354PCQ3      YKSIM-------------INMEDSDLVRVRREYYE-------------------------
A0A0S8GZ23      PYVRE-----------------------TTAILVQ-------------------------
A0A1I3DDV4      DFQEN-------------QATRLKEAETKFGKLIE-------------------------
A0A2E0SMM6      VVS------------------------RLQDQLKA-------------------------
A0A3L7SI46      AYTVA----------------------KHQDELLQ-------------------------
A0A5B9PJZ8      STHNK----------------------YVELKMLE-------------------------
A0A2S8G191      SQIMQ-----------------------LEAEILN-------------------------
A0A2E7EGG1      KALRD-------------------------------------------------------
A0A2E2N5A9      AARVD-------------------------------------------------------
A0A7C8AGA2      DPIIQ----------------------ALTSSIMQ-------------------------
A0A7C2FXP7      DPMIR----------------------VLTTNIVE-------------------------
A0A2E3GWC6      VMTGT------------------SERQQLDSQLLP-------------------------
F0SLB0          VMTGT------------------SERQQLDSQLLP-------------------------
A0A3L7NDH9      KDTRT----------------------SLEKQLFE-------------------------
A0A1N6DAJ8      AIKAI-------------------------------------------------------
A0A532UD06      SDRET----------------------QLRAELRR-------------------------
A0A660URN1      NDVQS----------------------QLQSELKD-------------------------
A0A517ZCB5      VYTQS----------------------RMQQELLS-------------------------
A0A225EH48      APKVE-----------------------ARNIAIA-------------------------
A0A518INW8      GSGAL-----------------RDDPQRTAALNLE-------------------------
A0A518JPH9      STGAS-----------------REDPLRAAAINLE-------------------------
A0A5C5VEK8      DRDLE----------------------RLRNQAQD-------------------------
A0A532UTJ0      PTVVA-----------------------FTNHITQ-------------------------
A0A432MFP3      GAIRD-----------------------VEARIAE-------------------------
A0A2E2CCW9      NGNAS---E-GHHLATPGTSQLDRARTALETHLMP-------------------------
A0A3C0AGX3      NGNAS---E-GHHLATPGTSQLDRARTALETHLMP-------------------------
A0A518AAQ5      AAAGG---V-ETQALAPGNTQVERARAALETHLMP-------------------------
A0A517QBG9      AAAGG---V-ETQALAPGNTQVERARAALETHLMP-------------------------
A0A518FTU3      TAAGG---V-ETQALAPGNTQVERARAALETHLMP-------------------------
A0A517WHH5      AVTGG---V-ESQAIAPGNTQVERARLALETHLMP-------------------------
A0A5A8BGT3      AATGG---V-ESQAIAPGNTQVERARLALETHLMP-------------------------
A0A2E7K7A9      ATTGG---V-ESQAITPGNTQVERARLALETHLMP-------------------------
A0A517PTS5      ATTGG---V-ESQAITPGNTQVERARLALETHLMP-------------------------
A0A6I6AH34      ATTGG---V-ENQAITPGNTQVERARLALETHLMP-------------------------
A0A517VTK3      STSSA-----GASISAPGTSNLDRARTALETHLMP-------------------------
A0A517WQT4      STSSA-----GASISAPGTSNLERARTALETHLMP-------------------------
A0A517VID8      NKNTS-----EGRIATPATSQLDRARTALETHLMP-------------------------
A0A517RK10      NANAN-----QGQIATPNTTQVDRARAALETHLMP-------------------------
A0A518IH18      SANGN---TSQGQIATPNTTQVDRARTALETHLMP-------------------------
A0A5C5XLF4      VVSGA----------------------TERQQLDS-------------------------
A0A2D5NDU9      ---------------------------SAEAAILA-------------------------
A0A1P8WP26      VFQTT----------------------QITQDLFD-------------------------
A0A3L7V1F3      AFLIQ----------------------RINQELLD-------------------------
D5SZ21          GMAIS----------------------RMTEQLLQ-------------------------
A0A286RGB6      LKNLV----------------------AQTRDVLR-------------------------
A0A518CHE5      IVS------------------------RLQDQLKV-------------------------
A0A1V5N3W2      PTLQM-----------------------LTQRVAQ-------------------------
A0A3E0MY27      GQLRG-----------------------VVERLRD-------------------------
A0A7C4Z5R7      ---------------------------RTRAQLSE-------------------------
A0A2E0X9P6      LTRIR----------------------KGTQKYAE-------------------------
A0A286RLF2      TAARL----------------------EVERKVVE-------------------------
A0A517NSK8      SEAFV-----------------QDNPIRQETAKAE-------------------------
A0A5C5Z0D6      SEAFQ-----------------AEQPIRQETARAE-------------------------
M5UE94          SEAFQ-----------------ADQPIRQATAQAE-------------------------
A0A2E8FLY0      SWMVM----------------------RVRQQLIN-------------------------
A0A3D2U1E1      SYLDG----------------------RTRQQLIN-------------------------
E8R3W3          AASRSPAATSPGRLDSREIDDLVEEYLQRDRNLLT-------------------------
A0A5C5ZM48      ---------------------------REQQMLME-------------------------
A0A5B9WF77      IELVD----------------------RIKQVKNE-------------------------
A0A518BBX8      DSRLN----------------------LDNQLFPL-------------------------
A0A1P8WN28      PKAIE----------------------ELRAKVAL-------------------------
A0A3B9CTT0      VKAIE----------------------TLEDKLND-------------------------
A0A518ALT3      ----R----------------------DIEQQITE-------------------------
A0A3M1QRP3      DSVWR----------------------TLSAELKK-------------------------
A0A517TMV0      LEVLA----------------------VQQSRLLD-------------------------
A0A3E0MY88      VVGHT----------------------NLERTLLQ-------------------------
A0A5B9QF68      LNVIE----------------------EQQKQILA-------------------------
A0A5B9QGF0      LSVIE----------------------EQQKQILT-------------------------
A0A5C6CK24      LSVIE----------------------EQQKQVLA-------------------------
A0A2E3RCU8      IHTRS----------------------QLEQGLIE-------------------------
A0A1C3E6N1      GMAIS----------------------RMTEQLLQ-------------------------
A0A518GJT2      DMAIS----------------------RMTEQLLQ-------------------------
A0A2E8B0L9      TDLVN----------------------SVERKLLA-------------------------
A0A5Q4GFE7      METRA----------------------QIERRLME-------------------------
A0A257WS34      GFILA----------------------RFEQQLQE-------------------------
A0A7C4LP10      SYTLA----------------------KIEQELIA-------------------------
A0A517MLW3      MRSIH----------------------VLEQKLLS-------------------------
A0A5B9QVD0      MRSVH----------------------ALEQKLLN-------------------------
A0A3A0DET7      ALRDI----------------------ELERQVQE-------------------------
A0A3B8PNV4      TWMVM----------------------RIRQQLIN-------------------------
A0A3D1DR40      TWMVM----------------------RIRQQLIN-------------------------
A0A2E7RYU8      SWMVM----------------------RVRQQLIN-------------------------
A0A3B8LXG8      SWMVM----------------------RVRQQLIN-------------------------
A0A286RD13      DPWIA----------------------AAQARLSY-------------------------
A0A2E3GWX1      QYVYA----------------------RLQQQMIE-------------------------
F0SG60          QYVYA----------------------RLQQQMIE-------------------------
A0A2E9VST2      SYAYA----------------------RLQQQLIE-------------------------
A0A356A6X2      SYAYA----------------------RLQQQLIE-------------------------
A0A5C5XLM3      SYAYA----------------------RLQQQLIE-------------------------
A0A7C5FXU1      LEMFA----------------------RTDPTYTR-------------------------
A0A3M1VCL4      ALVLS----------------------RVEQQLRS-------------------------
A0A5C5V7Z9      LEMLS----------------------SQQKRLME-------------------------
A0A5C5YT05      MEMLT----------------------SQQQRLME-------------------------
A0A518D7F9      LALIA----------------------QQRQKLLE-------------------------
A0A5C5ZIP0      VRAMA----------------------DQQTRLFD-------------------------
A0A518KBK3      MEVLA----------------------KQQAKLID-------------------------
A0A5C6AKF9      IEVLA----------------------AQQSKLIG-------------------------
A0A6M5Z0K7      DPRIA----------------------AADKKVSD-------------------------
A0A350CI62      SYHVQ----------------------RIMQEILD-------------------------
A0A4P5WQK6      SYHVQ----------------------RIMQEILD-------------------------
A0A3C1X4W5      SYHVQ----------------------RIMQEILD-------------------------
A0A3D3W3A7      SYHVQ----------------------RIMQEILD-------------------------
A0A518DRX3      ATNLR----------------------QIERQLID-------------------------
A0A518DZF9      ATNLR----------------------QIERQLID-------------------------
A0A518AKT8      LSSIR----------------------ERERERLE-------------------------
A0A5C5ZR72      ERQIS----------------------QLRSGLRE-------------------------
A0A7C5R0U3      TESSR----------------------QVEQDLLA-------------------------
A0A517TY85      EEEIE----------------------QLQDQMSA-------------------------
A0A5B9QEI7      EERGD----------------------FIHQQMAE-------------------------
F0SI78          ASITS----------------------QLIPLMLE-------------------------
A0A517MDV3      TTAAN----------------------TEMDSLLS-------------------------
A0A518IQ30      AEVAD----------------------RMEQRLLA-------------------------
A0A517LWP4      AQVAD----------------------EMEQKLLA-------------------------
A0A518JNW8      AQVAD----------------------EIEQKLLS-------------------------
A0A2E7ENQ5      EDFAK----------------------QLKRELND-------------------------
A0A7C2KUQ9      DPGWQ----------------------ELNVAVYE-------------------------
A0A7C5BZF0      TYLQA----------------------RMYQTLLE-------------------------
A0A1G3AQE9      GLQAA-----------------------LEKNLVD-------------------------
A0A3L7UQT9      AWAVA----------------------KLNEELQK-------------------------
A0A4P5YBU2      AWAVA----------------------KLNEELQK-------------------------
A0A7C7V5U8      ASRQA----------------------MLERELLD-------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      ----------------------IQNEISLYSN----------------------------
A0A5S9IJB5      ----------------------VDQEIQ--------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A2E3GW02      ---------------------ITSQLIPLMLE----------------------------
A0A5B9QNZ7      ----------------------MDSLLTLKVR----------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1G2YPI3      ----------------------KSRLDELQDR----------------------------
A0A1U7CZ81      ----------------------QAAEKRKAQL----------------------------
A0A142YNY8      ----------------------RAHEARLKQL----------------------------
A0A1U7GLS6      ----------------------VAHDARLAEL----------------------------
A0A532UIN2      ----------------------RSKLDQLELR----------------------------
A0A0S8KNX5      ----------------------TANITELEQE----------------------------
A0A3D3UVZ8      ----------------------TGNITQLEQD----------------------------
A0A517NFU9      ----------------------YNRMLDLIQK----------------------------
A0A5C5YWH4      ----------------------YNRLLDLIQK----------------------------
A0A3D2TNK4      ----------------------QKKLFTAQQE----------------------------
A0A7C1Y4F0      -------------------------LRQAETE----------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ----------------------YQQLLTLSSK----------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ----------------------EAMLLPLKQQ----------------------------
M5TW92          ----------------------EAMLLPLKQQ----------------------------
A0A2S8FKY2      -------------ANDPVSVKLQAELDRFEDV----------------------------
A0A517N8P6      ----------------------QTQLMDLRVQ----------------------------
A0A432MJP4      ----------------------SDYVRQLINE----------------------------
M5UQ35          ----------------------YDKMLELSSK----------------------------
A0A0S8FY64      ---------------DPAVAELYGRLTQIDLD----------------------------
A0A1N6KFT7      EATVSEDDVAGSFKLDPNVAELYRDLKRAQLR----------------------------
L0DFG4          EGKVTEDHVAGSFKLDPYVAELYRDLKRAQVR----------------------------
A0A5C5XXG1      ----------------------FAYLLKLNSE----------------------------
A0A7C7YUM8      VARLASAQGPGGGSE---FESYLISLAELDAR----------------------------
A0A7C2AHI6      LARLADPKLV--------SDAQRAALAELDAE----------------------------
A0A518BJJ1      YGFLSANSNAPGITVDPLTTGYLSEIARLEGE----------------------------
A0A518D182      FAGLSSSPSS-GATVDPLTLGYLAELGRLQSQ----------------------------
A0A5C5WTY6      ----------------------ISQVLELSSE----------------------------
A0A5C5Y033      ----------------------VTRLLMLNAE----------------------------
A0A5C6G1Y2      ----------------------VTRLLMLNAE----------------------------
A0A354PDV6      ----------------------YNNVLQLMSE----------------------------
A0A5C6FZ02      ----------------------FAYLLKLNSE----------------------------
M5TIT3          ----------------------ITHLLQLSSE----------------------------
A0A5M6CY44      ----------------------FTHLLQLNSE----------------------------
F2AXG2          ----------------------ITHLLRLTSE----------------------------
M2BB46          ----------------------ITHLLRLNSE----------------------------
L7CLQ6          ----------------------ITHLLRLNSE----------------------------
A0A0J1B719      ----------------------ITHLLKLNSE----------------------------
Q7UF18          ----------------------ITHLLRLNSE----------------------------
A0A2G1W1E0      ----------------------ITHLLQLNSE----------------------------
K5E235          ----------------------ITHLLQLNSE----------------------------
A0A5C6FFI9      ----------------------YSRLLDLLQK----------------------------
A0A5C5WDJ1      ----------------------YNRLLDLIQK----------------------------
A0A5C5X547      ----------------------EEKFQALAKRLQGSGLEKSRQQYESDLAKIDDDLNFRK
A0A353FIP5      ----------------------LQELAGLIAQ----------------------------
A0A5B1CIK7      ----------------------ITHLLQLNSE----------------------------
A0A5C5WHS2      ----------------------ITHLLQLNSE----------------------------
A0A5C6B6G8      ----------------------ITGLLRLNSE----------------------------
A0A5C5ZZN3      ----------------------ITHLLQLNSE----------------------------
A0A5C5XS91      ----------------------ITHLLELNSE----------------------------
A0A5C6C4E6      ----------------------ITHLLELNSE----------------------------
A0A2E1VVJ1      ----------------------FQALQKVDAD----------------------------
A0A3M2AEL0      ----------------------LQELGDLKAK----------------------------
A0A2A2W9R6      ----------------------VNRLMELLSQ----------------------------
A0A518HKC1      ----------------------VNRLMGLLSQ----------------------------
A0A518L3P0      ----------------------VNRLMGLLSQ----------------------------
A0A255R1S0      ----------------------FRRLMALTTR----------------------------
A0A5B9MKP1      ----------------------AQRLLELTSK----------------------------
A0A0S8J591      ----------------------YQEIVELEKE----------------------------
A0A351FYP6      ------------------------------------------------------------
A0A532UT69      ----------------------R-------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
A0A1G2YQB7      ----------------------A-------------------------------------
A0A353P687      ----------------------A-------------------------------------
A0A356EME5      ------------------------------------------------------------
M5RT57          ----------------------VES-----------------------------------
A0A356KTN1      ----------------------LRQRFSDEWH----------------------------
A0A518HFS8      ----------------------VR------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ----------------------A-------------------------------------
A0A3L7PEB5      ----------------------A-------------------------------------
A0A1U9NL64      ----------------------L-------------------------------------
A0A2N1UCJ3      ----------------------A-------------------------------------
A0A7C4EK84      ----------------------A-------------------------------------
A0A7C3F0T2      ----------------------M-------------------------------------
A0A2E0X4J3      ----------------------E-------------------------------------
A0A5C5YU10      ----------------------E-------------------------------------
A0A517MPZ6      ----------------------L-------------------------------------
A0A5C6CNV7      ----------------------L-------------------------------------
A0A518K5H4      ----------------------Q-------------------------------------
A0A5C6AA28      ----------------------Q-------------------------------------
A0A2E7ESJ6      ----------------------LVLQQE--------------------------------
A0A2E9VK20      ----------------------LLLEEQ--------------------------------
A0A3D4PJK1      ----------------------LLLEEQ--------------------------------
A0A355AI52      ----------------------DRAQLD--------------------------------
A0A354PCQ3      ----------------------ENRAKMKDWE----------------------------
A0A0S8GZ23      ----------------------LQMELS--------------------------------
A0A1I3DDV4      ----------------------LQAEMS--------------------------------
A0A2E0SMM6      ----------------------DQAELK--------------------------------
A0A3L7SI46      ----------------------DQAELQ--------------------------------
A0A5B9PJZ8      ----------------------QE------------------------------------
A0A2S8G191      ----------------------VEQTAV--------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ----------------------YEELIV--------------------------------
A0A7C2FXP7      ----------------------LDQALI--------------------------------
A0A2E3GWC6      ----------------------LLLEEQ--------------------------------
F0SLB0          ----------------------LLLEEQ--------------------------------
A0A3L7NDH9      ----------------------ERTQLE--------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A532UD06      ----------------------VEMDLE--------------------------------
A0A660URN1      ----------------------LELQLA--------------------------------
A0A517ZCB5      ----------------------AQTELR--------------------------------
A0A225EH48      ----------------------QFEKLKTAVK----------------------------
A0A518INW8      ----------------------HTKVLGLMLR----------------------------
A0A518JPH9      ----------------------HTKVLGLMLR----------------------------
A0A5C5VEK8      ----------------------LELALM--------------------------------
A0A532UTJ0      ----------------------ADQELI--------------------------------
A0A432MFP3      ----------------------ARTRIR--------------------------------
A0A2E2CCW9      ----------------------LLIQKN--------------------------------
A0A3C0AGX3      ----------------------LLIQKN--------------------------------
A0A518AAQ5      ----------------------LLIQKN--------------------------------
A0A517QBG9      ----------------------LLIQKN--------------------------------
A0A518FTU3      ----------------------LLIQKN--------------------------------
A0A517WHH5      ----------------------LLIQKN--------------------------------
A0A5A8BGT3      ----------------------LLIQKN--------------------------------
A0A2E7K7A9      ----------------------LLIQKN--------------------------------
A0A517PTS5      ----------------------LLIQKN--------------------------------
A0A6I6AH34      ----------------------LLIQKN--------------------------------
A0A517VTK3      ----------------------LLIQKN--------------------------------
A0A517WQT4      ----------------------LLIQKN--------------------------------
A0A517VID8      ----------------------LLIQKN--------------------------------
A0A517RK10      ----------------------LLIQKH--------------------------------
A0A518IH18      ----------------------LLIQKH--------------------------------
A0A5C5XLF4      ----------------------QLIPLLLEEQ----------------------------
A0A2D5NDU9      ----------------------QVEKLGNQRV----------------------------
A0A1P8WP26      ----------------------LEAQLQ--------------------------------
A0A3L7V1F3      ----------------------LESQLS--------------------------------
D5SZ21          ----------------------EQAKMR--------------------------------
A0A286RGB6      ----------------------PE------------------------------------
A0A518CHE5      ----------------------DQAELK--------------------------------
A0A1V5N3W2      ----------------------LEETLV--------------------------------
A0A3E0MY27      ----------------------QEQEMM--------------------------------
A0A7C4Z5R7      ----------------------VQDQIN--------------------------------
A0A2E0X9P6      ----------------------TLADVH--------------------------------
A0A286RLF2      ----------------------DRVELA--------------------------------
A0A517NSK8      ----------------------YNDYLNLVMR----------------------------
A0A5C5Z0D6      ----------------------YDEYLQLVMK----------------------------
M5UE94          ----------------------YDEYLTLVMK----------------------------
A0A2E8FLY0      ----------------------DQVELR--------------------------------
A0A3D2U1E1      ----------------------DQVAYR--------------------------------
E8R3W3          ----------------------AQVRLQTIKD----------------------------
A0A5C5ZM48      ----------------------SRVESY--------------------------------
A0A5B9WF77      ----------------------LDHLESISRK----------------------------
A0A518BBX8      ----------------------LLSERE--------------------------------
A0A1P8WN28      ----------------------LETELN--------------------------------
A0A3B9CTT0      ----------------------EQGELS--------------------------------
A0A518ALT3      ----------------------IKSKPR--------------------------------
A0A3M1QRP3      ----------------------AEFEVE--------------------------------
A0A517TMV0      ----------------------LRMELQ--------------------------------
A0A3E0MY88      ----------------------DRATVQ--------------------------------
A0A5B9QF68      ----------------------SQAELS--------------------------------
A0A5B9QGF0      ----------------------LQAELS--------------------------------
A0A5C6CK24      ----------------------AQAELS--------------------------------
A0A2E3RCU8      ----------------------DIARLK--------------------------------
A0A1C3E6N1      ----------------------EQAKMR--------------------------------
A0A518GJT2      ----------------------EQAKMR--------------------------------
A0A2E8B0L9      ----------------------DRARLD--------------------------------
A0A5Q4GFE7      ----------------------DQTRLE--------------------------------
A0A257WS34      ----------------------YQAQLQ--------------------------------
A0A7C4LP10      ----------------------DQQSLQ--------------------------------
A0A517MLW3      ----------------------DRAEVM--------------------------------
A0A5B9QVD0      ----------------------DRAELQ--------------------------------
A0A3A0DET7      ----------------------VEQALA--------------------------------
A0A3B8PNV4      ----------------------DQVELQ--------------------------------
A0A3D1DR40      ----------------------DQVELQ--------------------------------
A0A2E7RYU8      ----------------------DQVELQ--------------------------------
A0A3B8LXG8      ----------------------DQVELQ--------------------------------
A0A286RD13      ----------------------LETRWF--------------------------------
A0A2E3GWX1      ----------------------DKAKLRD-------------------------------
F0SG60          ----------------------DKAKLRD-------------------------------
A0A2E9VST2      ----------------------DEASLRD-------------------------------
A0A356A6X2      ----------------------DESSLRD-------------------------------
A0A5C5XLM3      ----------------------DEASLRD-------------------------------
A0A7C5FXU1      ----------------------LQAQMDAVQM----------------------------
A0A3M1VCL4      ----------------------DYAELQ--------------------------------
A0A5C5V7Z9      ----------------------TQDELR--------------------------------
A0A5C5YT05      ----------------------TQDELR--------------------------------
A0A518D7F9      ----------------------DEQELR--------------------------------
A0A5C5ZIP0      ----------------------VEAQLS--------------------------------
A0A518KBK3      ----------------------LRDELG--------------------------------
A0A5C6AKF9      ----------------------VRDELR--------------------------------
A0A6M5Z0K7      ----------------------LRERIQ--------------------------------
A0A350CI62      ----------------------RQSALT--------------------------------
A0A4P5WQK6      ----------------------RQSALT--------------------------------
A0A3C1X4W5      ----------------------LQSHLT--------------------------------
A0A3D3W3A7      ----------------------LQSHLT--------------------------------
A0A518DRX3      ----------------------ERGQLN--------------------------------
A0A518DZF9      ----------------------ERGQLN--------------------------------
A0A518AKT8      ----------------------AEREMQ--------------------------------
A0A5C5ZR72      ----------------------LRKTVK--------------------------------
A0A7C5R0U3      ----------------------ARTELQ--------------------------------
A0A517TY85      ----------------------IKVKSR--------------------------------
A0A5B9QEI7      ----------------------IKSQPR--------------------------------
F0SI78          ----------------------ESMLLE--------------------------------
A0A517MDV3      ----------------------LKVRLR--------------------------------
A0A518IQ30      ----------------------DRALLQ--------------------------------
A0A517LWP4      ----------------------DRALLQ--------------------------------
A0A518JNW8      ----------------------DRALLQ--------------------------------
A0A2E7ENQ5      ----------------------DYARLE--------------------------------
A0A7C2KUQ9      ----------------------AEHRLE--------------------------------
A0A7C5BZF0      ----------------------DQARLE--------------------------------
A0A1G3AQE9      ----------------------YRAEWE--------------------------------
A0A3L7UQT9      ----------------------LRNDWN--------------------------------
A0A4P5YBU2      ----------------------LRNDWN--------------------------------
A0A7C7V5U8      ----------------------AQAQMK--------------------------------
                                                                            

A0A5S9IPR9      ------LKT-------------------------------------------------RY
A0A533Q9U4      ------YSQ-------------------------------------------------RY
A0A1U9NNE1      ------DQQ-------------------------------------------------TM
A0A2G2JCA2      ----------------------------------------------------------VN
A0A533Q6B7      ----------------------------------------------------------RY
A0A5S9IJB5      ---SLVTGR-------------------------------------------------NL
A0A1G2XVR0      ------LSE-------------------------------------------------KY
A0A1G3B0P0      ------LSE-------------------------------------------------KY
A0A1E3X4X0      ------LSE-------------------------------------------------KY
A0A286U4B3      ------ELG-------------------------------------------------RV
A0A5C6DDS2      ------ELD-------------------------------------------------RV
A0A2E3GW02      ---ESMLLE-------------------------------------------------KL
A0A5B9QNZ7      ---LREEQS-------------------------------------------------RL
A0A1Z8N7H5      ---LKSLSS-------------------------------------------------DF
A0A1G2YPI3      ---LAGSLR-------------------------------------------------QM
A0A1U7CZ81      ---MAKYNS-------------------------------------------------LW
A0A142YNY8      ---EGQHAD-------------------------------------------------FW
A0A1U7GLS6      ---QAEIEG-------------------------------------------------HW
A0A532UIN2      ---RADRRR-------------------------------------------------QL
A0A0S8KNX5      ---LVVAKQ-------------------------------------------------TL
A0A3D3UVZ8      ---LIIAQQ-------------------------------------------------TL
A0A517NFU9      ---ERGFSD-------------------------------------------------AF
A0A5C5YWH4      ---EQSLAD-------------------------------------------------AF
A0A3D2TNK4      ---LQNLSM-------------------------------------------------HY
A0A7C1Y4F0      ---LKDILY-------------------------------------------------LC
A0A6I0ENW6      ---ETALQS-------------------------------------------------NM
A0A6L3A0B7      ---ETALQS-------------------------------------------------NM
A0A0J1B4A0      ---ERLMAA-------------------------------------------------EF
A0A142WSB9      ---ESRLSQ-------------------------------------------------LV
M5SZR3          ---ERELLT-------------------------------------------------LF
M5TW92          ---EQELLT-------------------------------------------------LF
A0A2S8FKY2      ---RFTLTE---------------------------------------------------
A0A517N8P6      ---AEMLAI-------------------------------------------------QF
A0A432MJP4      ---QQRLAD-------------------------------------------------RF
M5UQ35          ---LSFLRL-------------------------------------------------TL
A0A0S8FY64      ---LQGALR-------------------------------------------------SF
A0A1N6KFT7      ---YDTAKRATRNTNDPSLKYARERKVELESEIEDLWRQRRPLLLRQLTREMANEGDLAL
L0DFG4          ---YNTAKRATRNTNDPSLQYARDRKEEIESEIEDLWRQRRPLLLRQLSREMADEGDQAI
A0A5C5XXG1      ---KQRLQA-------------------------------------------------KF
A0A7C7YUM8      ---LAAARA-------------------------------------------------EM
A0A7C2AHI6      ---LARLSG-------------------------------------------------VA
A0A518BJJ1      ---IASLQH-------------------------------------------------EF
A0A518D182      ---REVLAS-------------------------------------------------TY
A0A5C5WTY6      ---RQRLVS-------------------------------------------------VF
A0A5C5Y033      ---REKLTA-------------------------------------------------VF
A0A5C6G1Y2      ---REKLTA-------------------------------------------------VF
A0A354PDV6      ---KQRLTT-------------------------------------------------VF
A0A5C6FZ02      ---KQRLQA-------------------------------------------------KF
M5TIT3          ---KQRLSS-------------------------------------------------VF
A0A5M6CY44      ---KQRLNA-------------------------------------------------VF
F2AXG2          ---KQRLTS-------------------------------------------------VF
M2BB46          ---KQRLTS-------------------------------------------------VF
L7CLQ6          ---KQRLTS-------------------------------------------------VF
A0A0J1B719      ---KQRLTS-------------------------------------------------VF
Q7UF18          ---KQRLTS-------------------------------------------------VF
A0A2G1W1E0      ---KQRLTS-------------------------------------------------VF
K5E235          ---KQRLTS-------------------------------------------------VF
A0A5C6FFI9      ---ERTLVS-------------------------------------------------VY
A0A5C5WDJ1      ---EKALSD-------------------------------------------------TF
A0A5C5X547      SLIKRSFKK-------------------------------------------------EY
A0A353FIP5      ---ARALEE-------------------------------------------------KH
A0A5B1CIK7      ---KQRLTA-------------------------------------------------VF
A0A5C5WHS2      ---KQRLTA-------------------------------------------------VF
A0A5C6B6G8      ---KQRLTA-------------------------------------------------VF
A0A5C5ZZN3      ---KQRLSS-------------------------------------------------VF
A0A5C5XS91      ---KRRLSS-------------------------------------------------IF
A0A5C6C4E6      ---RQRLAA-------------------------------------------------LF
A0A2E1VVJ1      ---AAELAI-------------------------------------------------EY
A0A3M2AEL0      ---RIRLRA-------------------------------------------------VY
A0A2A2W9R6      ---RQVMRA-------------------------------------------------SY
A0A518HKC1      ---RQVMRA-------------------------------------------------TY
A0A518L3P0      ---RQVMRA-------------------------------------------------TY
A0A255R1S0      ---RDVMRA-------------------------------------------------TF
A0A5B9MKP1      ---RRVLVT-------------------------------------------------AF
A0A0S8J591      ---D--KTR-------------------------------------------------RY
A0A351FYP6      ---N--KSI-------------------------------------------------DL
A0A532UT69      -------LQ-------------------------------------------------WV
A0A2D5AWU0      -------RR-------------------------------------------------ER
A0A1G2YQB7      -------KQ-------------------------------------------------QL
A0A353P687      -------KQ-------------------------------------------------HL
A0A356EME5      -------LA-------------------------------------------------RN
M5RT57          -------TA-------------------------------------------------AG
A0A356KTN1      ---E--VRI-------------------------------------------------AR
A0A518HFS8      -------RI-------------------------------------------------VR
L0DC26          -------RI-------------------------------------------------AR
A0A3L7P4E4      -------LQ-------------------------------------------------DH
A0A3L7PEB5      -------LL-------------------------------------------------DL
A0A1U9NL64      -------KR-------------------------------------------------QV
A0A2N1UCJ3      -------LI-------------------------------------------------QC
A0A7C4EK84      -------RE-------------------------------------------------KL
A0A7C3F0T2      -------KL-------------------------------------------------EC
A0A2E0X4J3      -------QS-------------------------------------------------RW
A0A5C5YU10      -------QA-------------------------------------------------KW
A0A517MPZ6      -------RA-------------------------------------------------TW
A0A5C6CNV7      -------QS-------------------------------------------------TW
A0A518K5H4      -------QA-------------------------------------------------KW
A0A5C6AA28      -------QT-------------------------------------------------KW
A0A2E7ESJ6      ---E--LEG-------------------------------------------------RY
A0A2E9VK20      ---A--ALK-------------------------------------------------RY
A0A3D4PJK1      ---A--ALK-------------------------------------------------RY
A0A355AI52      ---T--LQE-------------------------------------------------YY
A0A354PCQ3      ---QRLQEA-------------------------------------------------KL
A0A0S8GZ23      ---S--YKQ-------------------------------------------------RL
A0A1I3DDV4      ---R--LNG-------------------------------------------------LF
A0A2E0SMM6      ---S--KLA-------------------------------------------------TL
A0A3L7SI46      ---N--RLM-------------------------------------------------TL
A0A5B9PJZ8      ------LLQ-------------------------------------------------QY
A0A2S8G191      ---PGIQEQ-------------------------------------------------YV
A0A2E7EGG1      ---QALNAS-------------------------------------------------SR
A0A2E2N5A9      ---E--VSQ-------------------------------------------------RY
A0A7C8AGA2      ---I--GQQ-------------------------------------------------TM
A0A7C2FXP7      ---I--ARQ-------------------------------------------------RL
A0A2E3GWC6      ---V--LLQ-------------------------------------------------RY
F0SLB0          ---V--LLQ-------------------------------------------------RY
A0A3L7NDH9      ---T--MLE-------------------------------------------------FY
A0A1N6DAJ8      ---ERVYHI-------------------------------------------------AR
A0A532UD06      ---N--ARY-------------------------------------------------HC
A0A660URN1      ---N--AKL-------------------------------------------------HC
A0A517ZCB5      ---N--KLS-------------------------------------------------FY
A0A225EH48      ---E--DSP-------------------------------------------------LY
A0A518INW8      ---EQALTA-------------------------------------------------DY
A0A518JPH9      ---EQALTA-------------------------------------------------DY
A0A5C5VEK8      ---T--EQS-------------------------------------------------KW
A0A532UTJ0      ---S--MRL-------------------------------------------------IL
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      ---R--LER-------------------------------------------------DF
A0A3C0AGX3      ---R--LER-------------------------------------------------DF
A0A518AAQ5      ---R--LER-------------------------------------------------DF
A0A517QBG9      ---R--LER-------------------------------------------------DF
A0A518FTU3      ---R--LER-------------------------------------------------DF
A0A517WHH5      ---R--LER-------------------------------------------------DY
A0A5A8BGT3      ---R--LER-------------------------------------------------DY
A0A2E7K7A9      ---R--LER-------------------------------------------------DY
A0A517PTS5      ---R--LER-------------------------------------------------DY
A0A6I6AH34      ---R--LER-------------------------------------------------DY
A0A517VTK3      ---R--LER-------------------------------------------------DF
A0A517WQT4      ---R--LER-------------------------------------------------DF
A0A517VID8      ---R--LER-------------------------------------------------DF
A0A517RK10      ---R--LER-------------------------------------------------DY
A0A518IH18      ---R--LER-------------------------------------------------DF
A0A5C5XLF4      ---T--ALK-------------------------------------------------RY
A0A2D5NDU9      ---E--LLV-------------------------------------------------EL
A0A1P8WP26      ---T--AMK-------------------------------------------------SY
A0A3L7V1F3      ---D--ART-------------------------------------------------RY
D5SZ21          ---T--ALE-------------------------------------------------SY
A0A286RGB6      ------IAA-------------------------------------------------RY
A0A518CHE5      ---S--KLT-------------------------------------------------TL
A0A1V5N3W2      ---M--AQQ-------------------------------------------------TL
A0A3E0MY27      ------KLI-------------------------------------------------KN
A0A7C4Z5R7      ---ETLAVA-------------------------------------------------AR
A0A2E0X9P6      ---D--AQS-------------------------------------------------AL
A0A286RLF2      ---R--LLQ-------------------------------------------------EF
A0A517NSK8      ---EKKLTE-------------------------------------------------NF
A0A5C5Z0D6      ---EKKLAE-------------------------------------------------KF
M5UE94          ---EKKLRE-------------------------------------------------KF
A0A2E8FLY0      ---N--KSG-------------------------------------------------EF
A0A3D2U1E1      ---N--DSA-------------------------------------------------EL
E8R3W3          ---S--MKK-------------------------------------------------FR
A0A5C5ZM48      ---R--QTM-------------------------------------------------RR
A0A5B9WF77      ---K--SDP-------------------------------------------------SR
A0A518BBX8      ------LAV-------------------------------------------------DF
A0A1P8WN28      ---G--LRR-------------------------------------------------HF
A0A3B9CTT0      ---V--LRR-------------------------------------------------HY
A0A518ALT3      ---P--RIS-------------------------------------------------DT
A0A3M1QRP3      ---S--ARD-------------------------------------------------QF
A0A517TMV0      ---K--VAP-------------------------------------------------FY
A0A3E0MY88      ---G--LLE-------------------------------------------------NL
A0A5B9QF68      ---S--LSK-------------------------------------------------FY
A0A5B9QGF0      ---S--LSK-------------------------------------------------FY
A0A5C6CK24      ---S--LSN-------------------------------------------------FY
A0A2E3RCU8      ---S--LSS-------------------------------------------------DF
A0A1C3E6N1      ---T--ALE-------------------------------------------------SY
A0A518GJT2      ---T--ALE-------------------------------------------------SY
A0A2E8B0L9      ---T--ARD-------------------------------------------------YL
A0A5Q4GFE7      ---S--LQQ-------------------------------------------------HY
A0A257WS34      ---S--LLA-------------------------------------------------KL
A0A7C4LP10      ---N--LLG-------------------------------------------------KL
A0A517MLW3      ---R--LEK-------------------------------------------------HL
A0A5B9QVD0      ---T--LAA-------------------------------------------------HY
A0A3A0DET7      ---S--ERA-------------------------------------------------RW
A0A3B8PNV4      ---N--KSG-------------------------------------------------EY
A0A3D1DR40      ---N--KSG-------------------------------------------------EY
A0A2E7RYU8      ---N--KSG-------------------------------------------------EY
A0A3B8LXG8      ---N--KSG-------------------------------------------------EY
A0A286RD13      ---EERQRA-------------------------------------------------AQ
A0A2E3GWX1      ---K--LNN-------------------------------------------------KL
F0SG60          ---K--LNN-------------------------------------------------KL
A0A2E9VST2      ---K--LNG-------------------------------------------------KL
A0A356A6X2      ---K--LNG-------------------------------------------------KL
A0A5C5XLM3      ---K--LNG-------------------------------------------------KL
A0A7C5FXU1      ---R--IQE-------------------------------------------------LA
A0A3M1VCL4      ---R--RLA-------------------------------------------------FL
A0A5C5V7Z9      ---R--LTP-------------------------------------------------HY
A0A5C5YT05      ---R--LSP-------------------------------------------------HY
A0A518D7F9      ---R--VAP-------------------------------------------------FL
A0A5C5ZIP0      ---R--LEP-------------------------------------------------FY
A0A518KBK3      ---R--LEP-------------------------------------------------FY
A0A5C6AKF9      ---R--VEP-------------------------------------------------FY
A0A6M5Z0K7      ---E--FEL-------------------------------------------------RA
A0A350CI62      ---E--ARQ-------------------------------------------------KY
A0A4P5WQK6      ---E--ARQ-------------------------------------------------KY
A0A3C1X4W5      ---E--ARQ-------------------------------------------------KY
A0A3D3W3A7      ---E--ARQ-------------------------------------------------KY
A0A518DRX3      ---N--MLA-------------------------------------------------HY
A0A518DZF9      ---N--MLA-------------------------------------------------HY
A0A518AKT8      ---S--LSP-------------------------------------------------YL
A0A5C5ZR72      ---H--P-----------------------------------------------------
A0A7C5R0U3      ---S--VLP-------------------------------------------------YL
A0A517TY85      ---T--KIG-------------------------------------------------DS
A0A5B9QEI7      ---L--KKD-------------------------------------------------VT
F0SI78          ---K-------------------------------------------------------L
A0A517MDV3      ---E--ERS-------------------------------------------------RL
A0A518IQ30      ---S--QAK-------------------------------------------------HF
A0A517LWP4      ---S--QAK-------------------------------------------------HL
A0A518JNW8      ---S--QAK-------------------------------------------------HL
A0A2E7ENQ5      ---S--IQD-------------------------------------------------YY
A0A7C2KUQ9      ---T--EGA-------------------------------------------------RL
A0A7C5BZF0      ---NLVTQR-------------------------------------------------GY
A0A1G3AQE9      ---T--KRK-------------------------------------------------NL
A0A3L7UQT9      ---D--RRN-------------------------------------------------VL
A0A4P5YBU2      ---D--RRN-------------------------------------------------VL
A0A7C7V5U8      ---K--IQA-------------------------------------------------HL
                                                                            

A0A5S9IPR9      KPAHPSIKKTINNI-----------AQVKKQIF---------------------------
A0A533Q9U4      GMKHPKIAGLKAEL-----------DTMRDNIM---------------------------
A0A1U9NNE1      VSGNPRLEQRKEIL-----------TALKTRLD---------------------------
A0A2G2JCA2      FKDNATYQKLQKQI-----------LADKEDLA---------------------------
A0A533Q6B7      GPKHPKVVQLNTEL-----------HTMRNHII---------------------------
A0A5S9IJB5      GINHPQVVALKSKK-----------KVIEERLT---------------------------
A0A1G2XVR0      GEKHPNIANIDLQL-----------KEIENRIK---------------------------
A0A1G3B0P0      GEKHPNIANIDLQL-----------KEIENRIK---------------------------
A0A1E3X4X0      GPRHPQMVRLLTQM-----------EAIKDKID---------------------------
A0A286U4B3      KEDHPLVQRLKTEK-----------SLIEQEIK---------------------------
A0A5C6DDS2      KEDYPLVQRMKAEK-----------DFIEQQIN---------------------------
A0A2E3GW02      GEQHPKVSEVRRRT-----------EVMRTLLS---------------------------
A0A5B9QNZ7      GSEHPRVLELRDTV-----------RDVEQFLE---------------------------
A0A1Z8N7H5      GPAHPRIIEIQNRI-----------QTTKQYIE---------------------------
A0A1G2YPI3      TPGHPVVIAIESDI-----------SRSKAQIA---------------------------
A0A1U7CZ81      DERYGEIRQLVMAE-----------DASFAASA---------------------------
A0A142YNY8      AQRYPEIRAQILAE-----------LEGRPTPT---------------------------
A0A1U7GLS6      RDRYHDIRRRVLAA-----------GDGPMAAS---------------------------
A0A532UIN2      KSSHPAVMALETEI-----------AHVKAQIA---------------------------
A0A0S8KNX5      SPTNPEIELKAELI-----------QTLKAHLE---------------------------
A0A3D3UVZ8      TAENPELIRKNELL-----------KTLKKHLE---------------------------
A0A517NFU9      GAGHPLVEAVRQEI-----------EITRRFIS---------------------------
A0A5C5YWH4      GPGHPLVEAARQEA-----------EITRQFIA---------------------------
A0A3D2TNK4      GPNHPRIIELQQDV-----------RSLDQYIN---------------------------
A0A7C1Y4F0      TEEHPSVQAIKSKI-----------DRINKELE---------------------------
A0A6I0ENW6      GENHPRMREMKAAL-----------ELAEGSLR---------------------------
A0A6L3A0B7      GENHPRMREMKAAL-----------ELAEGSLR---------------------------
A0A0J1B4A0      GENHPSVRALRTEL-----------DNMRRFVD---------------------------
A0A142WSB9      GDNHADLKNVRSEI-----------TTILSAYR---------------------------
M5SZR3          GPGHPTLASVRLRI-----------EEAKNFYKTLEKEYEEHHVAIREYADEAVDVGGYR
M5TW92          GPGHPTLASVRLRI-----------EEAKNFYKTLEKEYEEHHVAIREYADEAVDVGGYR
A0A2S8FKY2      AAYERYRQTNSAEI-----------NAIETSLK---------------------------
A0A517N8P6      AANHPQRLTVEQKL-----------KATEKALR---------------------------
A0A432MJP4      GADYSRVRDIEEQI-----------ARVQQVAA---------------------------
M5UQ35          GGGHPSVREVENEI-----------ESLKQYVA---------------------------
A0A0S8FY64      GLKHPEVVALNDER-----------EHVLSGLR---------------------------
A0A1N6KFT7      QKAEAELTSLAAEE-----------ASLYETLK---------------------------
L0DFG4          QKAEAELTSLEAEE-----------NSLYETLK---------------------------
A0A5C5XXG1      GASHPDVQDIDDEI-----------RLVRKFID---------------------------
A0A7C7YUM8      LASNPALIALEGSR-----------QELVAALV---------------------------
A0A7C2AHI6      TEDNPDVLRLEAAR-----------EDLLARLA---------------------------
A0A518BJJ1      LPGYPPLAQAIAAL-----------DELRAKVR---------------------------
A0A518D182      TVEHPERARIERAI-----------VELRARLT---------------------------
A0A5C5WTY6      GSKHPKVADIEKQI-----------TLTKQFLF---------------------------
A0A5C5Y033      GSGHPKVREINNEI-----------QLVEDFVR---------------------------
A0A5C6G1Y2      GSGHPKVREINNEI-----------QLVEDFVR---------------------------
A0A354PDV6      GPSHPKVKDIQDQI-----------DLVKNFLD---------------------------
A0A5C6FZ02      GASHPDVQDIDDEI-----------RLVRKFID---------------------------
M5TIT3          GAAHPKVQELEGEI-----------ALVKQFLQ---------------------------
A0A5M6CY44      GPGHPKVQEIEGEI-----------ELVKQFLQ---------------------------
F2AXG2          GPGHPKVQELESEI-----------TLVKEFLQ---------------------------
M2BB46          GPGHPKVQELESEI-----------TLVKEFLQ---------------------------
L7CLQ6          GPGHPKVQELESEI-----------TLVKEFLQ---------------------------
A0A0J1B719      GPGHPKVQELESEI-----------TLVKEFLQ---------------------------
Q7UF18          GPGHPKVQELESEI-----------TLVKEFLQ---------------------------
A0A2G1W1E0      GPGHPKVQELESEI-----------TLVKEFLQ---------------------------
K5E235          GPGHPKVQELESEI-----------TLVKEFLQ---------------------------
A0A5C6FFI9      GVSHPLIKSTREEI-----------DVIERFVA---------------------------
A0A5C5WDJ1      GPEHPLVEAAREET-----------MITRQFID---------------------------
A0A5C5X547      ERENRRLQEQFEQD-----------QLAYELDW---------------------------
A0A353FIP5      TEKWPPLIRLRGQI-----------KKLRTNIS---------------------------
A0A5B1CIK7      GPGHPKVQDIQGQI-----------EGVKEFLQ---------------------------
A0A5C5WHS2      GPGHPKVQDIQSEI-----------ESVKAFLQ---------------------------
A0A5C6B6G8      GPGHPKVQELENEI-----------QLVKQFLQ---------------------------
A0A5C5ZZN3      GPAHPKVQELESEI-----------TLVKQFLQ---------------------------
A0A5C5XS91      GAAHPKVLEIQNQI-----------DLVKEFLQ---------------------------
A0A5C6C4E6      GAGHPKVQEIENQI-----------ALVKQFLQ---------------------------
A0A2E1VVJ1      TDEWPALKELRERS-----------VELRGSIR---------------------------
A0A3M2AEL0      TDQWPELVELNQRI-----------EELEGRLL---------------------------
A0A2A2W9R6      GAGHPSVVALDTEI-----------ASIEKFTP---------------------------
A0A518HKC1      GAGHPSVVALDTEI-----------ASIQKFAP---------------------------
A0A518L3P0      GAGHPSVVALDTEI-----------ASIQKFSP---------------------------
A0A255R1S0      GDSHPSVRSLDSEI-----------VNLRKYVD---------------------------
A0A5B9MKP1      GMGHPSVVALDAEI-----------RAFEKIGE---------------------------
A0A0S8J591      RDQDRLSRNMEVRV-----------EQVNQQIA---------------------------
A0A351FYP6      GEGHPTIKSLKAAM-----------ESLNQQID---------------------------
A0A532UT69      TREFPAITALEAEI-----------LRTKSKIA---------------------------
A0A2D5AWU0      DQGDLLLAELRDEV-----------AVLKERKR---------------------------
A0A1G2YQB7      ASTNPELARKESLL-----------SALKQRLE---------------------------
A0A353P687      APTNPELARKESLL-----------NALKQRLE---------------------------
A0A356EME5      PSQDPQCVKLSQDL-----------ERNKKSLE---------------------------
M5RT57          GRNDPSYLRLEAEV-----------EGYEASLK---------------------------
A0A356KTN1      ARRDQIKLQLQSEI-----------EKIRERLR---------------------------
A0A518HFS8      NPGEPSRKRLEQAV-----------ASLAESLR---------------------------
L0DC26          NKNDPAIKKHRDDL-----------EAARAGLA---------------------------
A0A3L7P4E4      GEDHPKVRSIRKRI-----------EMTRKYLS---------------------------
A0A3L7PEB5      GEDHPKVQSIRKRI-----------EMTRKYLS---------------------------
A0A1U9NL64      TEDHPSVIALEEKI-----------ASIETDLE---------------------------
A0A2N1UCJ3      SEGHPTVKALKSRI-----------EAAQNKLA---------------------------
A0A7C4EK84      GPEHPEVRMKELAV-----------QALRQRLA---------------------------
A0A7C3F0T2      TDTHPGVAALEKKL-----------AEQRQRLA---------------------------
A0A2E0X4J3      GEGHPRVEVLLTSL-----------ETLQLRLA---------------------------
A0A5C5YU10      GDAYPTVKSIQRSL-----------DQSGLRIE---------------------------
A0A517MPZ6      GDGHTRVKLALQSK-----------AAMEERLA---------------------------
A0A5C6CNV7      GDGHPRVRIMLESR-----------EKLQARLD---------------------------
A0A518K5H4      GPGYPAVRLLEESL-----------AKLRERRA---------------------------
A0A5C6AA28      GPGYPSVRLLQDSL-----------DKLRSKQA---------------------------
A0A2E7ESJ6      GKDHPDVLTVRRQL--------------ERYET---------------------------
A0A2E9VK20      GSGHPDVINVRKRI-----------DLVKSYYR---------------------------
A0A3D4PJK1      GSGHPDVINVRKRI-----------DLVKSYYR---------------------------
A0A355AI52      GPNHPKVIERTRKI-----------EQMQGYLA---------------------------
A0A354PCQ3      AARDPAIEKLN--------------RLADEELA---------------------------
A0A0S8GZ23      TLKNPEIERITKSI-----------ETFEKDLE---------------------------
A0A1I3DDV4      GPNHPTVENLRKNI-----------EIVEGLLK---------------------------
A0A2E0SMM6      DYNHPDVVVLTNRI-----------SAAEESLN---------------------------
A0A3L7SI46      GPKHPTIRQLEDRI-----------QQTQTWLS---------------------------
A0A5B9PJZ8      GSNHPELKNVRKQI-----------AMVDSMRM---------------------------
A0A2S8G191      GKYRDTIVELEEHV-----------RLRKDQIV---------------------------
A0A2E7EGG1      GGTDPRIIKLNQDI-----------ESLESTLE---------------------------
A0A2E2N5A9      GPGHPELIAAKADL-----------DAATASLK---------------------------
A0A7C8AGA2      TPENPELKQRKEVL-----------ETLKERLT---------------------------
A0A7C2FXP7      TATNPELRLKENLL-----------ATLQSKLD---------------------------
A0A2E3GWC6      NDGHPDVINIRKRI-----------DIILSYYR---------------------------
F0SLB0          NDGHPDVINIRKRI-----------DIILSYYR---------------------------
A0A3L7NDH9      GPQHPKVIERTNKI-----------RKIEQYLD---------------------------
A0A1N6DAJ8      NRSDPSLKKYRDEL-----------EAARAELV---------------------------
A0A532UD06      TEDHPSVKAIQSEI-----------HRINKELN---------------------------
A0A660URN1      TEDHPSIEAIRGRI-----------KYIKQLLG---------------------------
A0A517ZCB5      GPKHPEILELQDKI-----------RITQQYLT---------------------------
A0A225EH48      AREKDHLAKLEEDL--------------RTTLE---------------------------
A0A518INW8      GDDHPLVQRVRDEL-----------ASVRQYIR---------------------------
A0A518JPH9      GDEHPLVQRVRDEL-----------TSVRNYIN---------------------------
A0A5C5VEK8      GDEYPTVKSIQRSL-----------DQAEQRIV---------------------------
A0A532UTJ0      QPENPDLKRKAELL-----------ETLKNHLK---------------------------
A0A432MFP3      NPGDPALSRLMSQR-----------QILMEQYE---------------------------
A0A2E2CCW9      QKNHPDLDAVNRSI------ETIINLYRRQGLD---------------------------
A0A3C0AGX3      QKNHPDLDAVNRSI------ETIINLYRRQGLD---------------------------
A0A518AAQ5      KKNHPDLDAVNRSI------ETIVNLYRRQGLE---------------------------
A0A517QBG9      KKNHPDLDAVNRSI------ETIVNLYRRQGLE---------------------------
A0A518FTU3      KKNHPDLDAVNRSI------ETIVNLYRRQGLE---------------------------
A0A517WHH5      KKNHPDLDAVNRSI------DTIINLYRRQGIE---------------------------
A0A5A8BGT3      KKNHPDLDAVNRSI------DTIINLYRRQGIE---------------------------
A0A2E7K7A9      KKNHPDLDAVNRSI------DTIINLYRRQGIE---------------------------
A0A517PTS5      KKNHPDLDAVNRSI------DTIINLYRRQGIE---------------------------
A0A6I6AH34      KKNHPDLDAVNRSI------DTIINLYRRQGIE---------------------------
A0A517VTK3      GENHPDLDAVNRSI------KTIVNLYRKQGIE---------------------------
A0A517WQT4      GENHPDLDAVNRSI------KTIVNLYRKQGIE---------------------------
A0A517VID8      QKNHPDLDAVNRSI------ETIINLYRRQGLD---------------------------
A0A517RK10      QKNHPDLDAVNRSI------ETVINLYRRQGLD---------------------------
A0A518IH18      QKNHPDLDAVNRSI------ETVINLYRRQGLD---------------------------
A0A5C5XLF4      GSGHPDVINVRKRI-----------DLVKSYYR---------------------------
A0A2D5NDU9      QPEHWRVAALDRDI-----------AALNSQLS---------------------------
A0A1P8WP26      GAKHPTIIDLQNQI-----------ATKRNFMT---------------------------
A0A3L7V1F3      GENHSKIKALTENI-----------QLKKKYLE---------------------------
D5SZ21          GPNHPKVMELRDAI-----------QAKEQWMA---------------------------
A0A286RGB6      GNRYVQEL-----------------ADVQSRIK---------------------------
A0A518CHE5      DYNHPDVMVLTNRI-----------QSAEDALQ---------------------------
A0A1V5N3W2      APTNPEIEQQTKTL-----------EAFKERTQ---------------------------
A0A3E0MY27      PDRSEVMKRLREQI-----------AEAEKDLA---------------------------
A0A7C4Z5R7      GLKEPTLQPLIKQR-----------EALEAVLE---------------------------
A0A2E0X9P6      NERKREVQEELSSA-----------RRAERQLQ---------------------------
A0A286RLF2      GNNHPRVQALQQRI-----------AANEAFLL---------------------------
A0A517NSK8      GDDHPTVVSIREQI-----------TMMRKFID---------------------------
A0A5C5Z0D6      SEGHPQVVSIREQI-----------DLMRQFID---------------------------
M5UE94          SDGHPQIVSLREQI-----------EMMRKFID---------------------------
A0A2E8FLY0      GPNHPAIQRLVARI-----------RDRQKWLA---------------------------
A0A3D2U1E1      GPNHPRMQMLSARI-----------KARQQWLS---------------------------
E8R3W3          NTQDPSYKKLETELRYREIDFLRLQNEAREAIR---------------------------
A0A5C5ZM48      PEQSREYRDLNAGL-----------QDIVSAMA---------------------------
A0A5B9WF77      KAAQTQLSKLEKQY--YDLWETKKGQIRERLLV---------------------------
A0A518BBX8      GPDHPKLKMLRDRI-----------QLARNFFA---------------------------
A0A1P8WN28      GSGHSDIIRREQQL-----------VGQKQRLA---------------------------
A0A3B9CTT0      GSGHPEIISRTSKI-----------QLFEQRVK---------------------------
A0A518ALT3      WEKDPDYLRVNALL-----------IETRRSLT---------------------------
A0A3M1QRP3      GESHPTMVRLRRQV-----------DFYKQQLA---------------------------
A0A517TMV0      GPAHPQVATLQQQV-----------AGVEQYLA---------------------------
A0A3E0MY88      GPNHPRVKEMTEKI-----------RMTERHLA---------------------------
A0A5B9QF68      GPNHPRILDLQNRI-----------ANSQQYVR---------------------------
A0A5B9QGF0      GPNHPRILDLQTSI-----------ANSERYVR---------------------------
A0A5C6CK24      GPNHPRILDLQKSI-----------ANSERYVR---------------------------
A0A2E3RCU8      GPSHPKIIEIQNRI-----------QTTKQYIE---------------------------
A0A1C3E6N1      GPNHPKVIELRDAI-----------QAKEQWMA---------------------------
A0A518GJT2      GPNHPKVMELRDAI-----------QSKEQWMA---------------------------
A0A2E8B0L9      GPTHPEVQELVRNI-----------RNAEQHIQ---------------------------
A0A5Q4GFE7      GRAHPKVIELMQQI-----------QAGRQYLM---------------------------
A0A257WS34      GPAHPEVQALEERI-----------AATQNYIV---------------------------
A0A7C4LP10      GPAHPDVVQLESKI-----------AATQRYLS---------------------------
A0A517MLW3      GPTHPSMVALQGEI-----------SNAETYLS---------------------------
A0A5B9QVD0      GPTHPEIQQLNAEI-----------ANGQNYLE---------------------------
A0A3A0DET7      GEGHPRVKLLRQSL-----------AELRDKLT---------------------------
A0A3B8PNV4      GPNHPLIQKLTARI-----------RDRQKWLT---------------------------
A0A3D1DR40      GPNHPLIQKLTARI-----------RDRQKWLT---------------------------
A0A2E7RYU8      GPNHPLIQKLTTRI-----------RDRQKWLA---------------------------
A0A3B8LXG8      GPNHPLIQKLTTRI-----------RDRQKWLA---------------------------
A0A286RD13      GEKAPSAQRIQEEM-----------ETLRKGLE---------------------------
A0A2E3GWX1      GPNHPEVQELQQRI-----------DGTNEWLE---------------------------
F0SG60          GPNHPEVQELQQRI-----------DGTNEWLE---------------------------
A0A2E9VST2      GPNHPEILELKERV-----------KAARDWMN---------------------------
A0A356A6X2      GPNHPEVLELQERV-----------KAARDWMN---------------------------
A0A5C5XLM3      GPNHPEVLELQERV-----------KAARDWMN---------------------------
A0A7C5FXU1      RTAQPEIA--------------------QQFAA---------------------------
A0A3M1VCL4      GPNHPRILSLRDRI-----------RANEQYVT---------------------------
A0A5C5V7Z9      GPNHPRVVSLTEQA-----------AALQQYLS---------------------------
A0A5C5YT05      GPNHPQIKELTEQV-----------AALQQYLS---------------------------
A0A518D7F9      AENNPTVTALNERI-----------AATKQYLA---------------------------
A0A5C5ZIP0      GPAHPEVVALSTQA-----------QAIKKYLA---------------------------
A0A518KBK3      GPSHPQVATLKSQI-----------DSTQQFLA---------------------------
A0A5C6AKF9      GPSHPQVVTLRSQI-----------EATEQYLA---------------------------
A0A6M5Z0K7      APTTTARGMFQQPL-----------AEAEKAAA---------------------------
A0A350CI62      GAKHARIRALETEL-----------AVKEKYLR---------------------------
A0A4P5WQK6      GAKHARIRALETEL-----------AVKEKYLR---------------------------
A0A3C1X4W5      GARHARIRALEAEL-----------QVKEKYLA---------------------------
A0A3D3W3A7      GARHARIRALEAEL-----------QVKEKYLA---------------------------
A0A518DRX3      GEAHPKVIALRNSI-----------VSGEQYMA---------------------------
A0A518DZF9      GEAHPKVIALRNSI-----------VSGEQYMA---------------------------
A0A518AKT8      GPNNPRMLELKARI-----------DGIDQYLT---------------------------
A0A5C5ZR72      -QSNRDYMALSERV-----------RQEEQSLS---------------------------
A0A7C5R0U3      GPAHPRVRQLQEQI-----------ARQEAFLS---------------------------
A0A517TY85      WSSDPEYLSLEAAA-----------KEANAALE---------------------------
A0A5B9QEI7      WEEDPQYIQLQEQA-----------KNVEAELK---------------------------
F0SI78          GEQHPKVSEVRRRT-----------EVMRTLLS---------------------------
A0A517MDV3      GDAHPKVQDLQDAV-----------QDVEQFLT---------------------------
A0A518IQ30      GPVHPKIQMLQQKI-----------ADSERYLA---------------------------
A0A517LWP4      GPVHPTIQMLQQKI-----------ADSERYLL---------------------------
A0A518JNW8      GPVHPKIQMLQQKI-----------ADSERYLL---------------------------
A0A2E7ENQ5      GSNHPTFIEVRQSI-----------LKKEEYLA---------------------------
A0A7C2KUQ9      GDANQRMAELRAEVEHRKRLRAMRERDLHNLWK---------------------------
A0A7C5BZF0      GWAHPEVLALQEKI-----------RRTQEFLQ---------------------------
A0A1G3AQE9      GDNHPELIALEDKI-----------RVTEQSLL---------------------------
A0A3L7UQT9      GDNNPDLLELAQRI-----------RAHEDLVN---------------------------
A0A4P5YBU2      GDNNPDLLELAQRI-----------RAQEDLVN---------------------------
A0A7C7V5U8      GPSHPDYQATRERI-----------RELEGYLD---------------------------
                                                                            

A0A5S9IPR9      -------------------------HYAKRIIMQ--------------------------
A0A533Q9U4      -------------------------KEVEQICDS--------------------------
A0A1U9NNE1      -------------------------QRREDIG-------------------------KKF
A0A2G2JCA2      -------------------------KLKIDLK----------------------------
A0A533Q6B7      -------------------------KEVERLCNH--------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A1G2XVR0      -------------------------LETLSLITK--------------------------
A0A1G3B0P0      -------------------------LETLSLITK--------------------------
A0A1E3X4X0      -------------------------FEVKKIISS--------------------------
A0A286U4B3      -------------------------DEQGWLGKA--------------------------
A0A5C6DDS2      -------------------------SEQGWVAKA--------------------------
A0A2E3GW02      -------------------------QEAGERTST--------------------------
A0A5B9QNZ7      -------------------------AKNQALQPQ--------------------------
A0A1Z8N7H5      -------------------------YHDAELKTQ--------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      -------------------------ERRQEASKAFDDLVEKEAAEAGTKQLVA-------
A0A3D3UVZ8      -------------------------DRKQEASNAFDNLVAKESAVAGNKQLVA-------
A0A517NFU9      -------------------------SNQPAETKV--------------------------
A0A5C5YWH4      -------------------------KNAPTNAKV--------------------------
A0A3D2TNK4      -------------------------NYHSGAGDR--------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      -------------------------QREEALLAGGEPAVAAGAVSDGSLDPAMRLKELDY
A0A6L3A0B7      -------------------------QREEALLAGGEPAVAAGAVSDGSLDPAMRLKELDY
A0A0J1B4A0      -------------------------ESRENRPEE--------------------------
A0A142WSB9      ----------------SQGIVAPTIEKEDLAAVA---------------------QGAAA
M5SZR3          KWKDASGTMEVSARLISEEESKVTLEREDNGKRVTLATASLSGDDQRLLAKIRADRIRKH
M5TW92          KWKDASGTMEVSARLISEEENKVTLERENNGKRVTLATASLSSDDQRLLAKIRADRIRKH
A0A2S8FKY2      -------------------------ERRAHLEKLVIERIAQQQAEGDVRKNSMMTTSLKL
A0A517N8P6      -------------------------ELQQTRNNV-------------------SPEKIDV
A0A432MJP4      -------------------------DSRR-------------------------------
M5UQ35          -------------------------KQQQDKPEV-------------------------A
A0A0S8FY64      -------------------------EAMARAVDSIHSEY---------------------
A0A1N6KFT7      -------------------------ESKEKSIEGLKTRHETLVKTLGADAPESIEAKSQV
L0DFG4          -------------------------ESKEKAIASLREKHENLTKTLGPNSPETIQAKADV
A0A5C5XXG1      -------------------------ESNEDTVAE------------------------AP
A0A7C7YUM8      -------------------------EQVAGALAGARVTQRGLEALRADYTASIKTWPITE
A0A7C2AHI6      -------------------------SELESAETALTELAADRDALADSYAETLGELPLEE
A0A518BJJ1      -------------------------DSLRGRLTGLQRLFEDRSELAKTAALAATDLPDAN
A0A518D182      -------------------------QNLAQRAEALAALADDRDELAATARDAAMAQSGRD
A0A5C5WTY6      -------------------------DQAKREEDS---------------SQA--------
A0A5C5Y033      -------------------------KSKEQTSPE---------------MTF--------
A0A5C6G1Y2      -------------------------KSKEQTSPE---------------MAF--------
A0A354PDV6      -------------------------EKKDGTSVG---------------A----------
A0A5C6FZ02      -------------------------ESNEDTVAE---------------APF--------
M5TIT3          -------------------------DKQDLMNPA---------------SAF--------
A0A5M6CY44      -------------------------DNEELTNPD---------------GLM--------
F2AXG2          -------------------------DQKDLTSPA---------------EMF--------
M2BB46          -------------------------DQKDLTSPA---------------EMF--------
L7CLQ6          -------------------------DQKDLTSPA---------------EMF--------
A0A0J1B719      -------------------------DQKDLTSPA---------------EMF--------
Q7UF18          -------------------------DQKDLTSPA---------------EMF--------
A0A2G1W1E0      -------------------------DQKELTSPA---------------EMF--------
K5E235          -------------------------DQKELTSPA---------------EMF--------
A0A5C6FFI9      -------------------------ANAPAALEE---------------EKS--------
A0A5C5WDJ1      -------------------------ANRPENTAR---------------EQK--------
A0A5C5X547      -------------------------RRIEAERLR---------------ALKAQGGGTLI
A0A353FIP5      -------------------------NA---------------------------------
A0A5B1CIK7      -------------------------SNENLAESA---------------SMF--------
A0A5C5WHS2      -------------------------ENDELAEPA---------------AMF--------
A0A5C6B6G8      -------------------------DNEELTNVS---------------TGF--------
A0A5C5ZZN3      -------------------------DNQDLTSPT---------------SAF--------
A0A5C5XS91      -------------------------DKQELTNPA---------------MAF--------
A0A5C6C4E6      -------------------------EKRELTTPS---------------LSF--------
A0A2E1VVJ1      -------------------------DN---------------------------------
A0A3M2AEL0      -------------------------LA---------------------------------
A0A2A2W9R6      -------------------------QEGDESSEK---------------KES--------
A0A518HKC1      -------------------------QEGDEPSEE---------------KES--------
A0A518L3P0      -------------------------QDGDEQPDS---------------AKS--------
A0A255R1S0      -------------------------NFRAGSEKD---------------AGEEIVETVEA
A0A5B9MKP1      -------------------------LSDAEQAGG---------------AGE--------
A0A0S8J591      -------------------------VENDRMRRA-----------------AQSDAAQKL
A0A351FYP6      -------------------------NRIKGILAG--------------------------
A0A532UT69      -------------------------EQDT-------------------------------
A0A2D5AWU0      -------------------------DILL-------------------------------
A0A1G2YQB7      -------------------------ELKEQAS-------------------KNFDEMATM
A0A353P687      -------------------------ELRQQAD-------------------KNFDEMAEK
A0A356EME5      -------------------------QMRRELA-------------------TQYQVQYRT
M5RT57          -------------------------RAVASSR-------------------PKITDQLKS
A0A356KTN1      ---------------------------------------------------------SER
A0A518HFS8      -------------------------MRYEELR-------------------GFHGAQQSG
L0DC26          -------------------------AQHRKLY-------------------PIVARQLQD
A0A3L7P4E4      -------------------------NELSD---------------------QIAPPAKKM
A0A3L7PEB5      -------------------------NELDETS-------------------STTGPAKKI
A0A1U9NL64      -------------------------ES-------------------------------DQ
A0A2N1UCJ3      -------------------------AQ-------------------------------IE
A0A7C4EK84      -------------------------EQDQLT--------------------AAASSERDG
A0A7C3F0T2      -------------------------DL-------------------------------EK
A0A2E0X4J3      -------------------------EK------------------------QAEIAENRA
A0A5C5YU10      -------------------------AK------------------------RESIEAEKE
A0A517MPZ6      -------------------------KQ------------------------LEATEERKK
A0A5C6CNV7      -------------------------KQ------------------------QADIEKNKE
A0A518K5H4      -------------------------EQ-------------------------------QQ
A0A5C6AA28      -------------------------EQ-------------------------------QQ
A0A2E7ESJ6      -------------------------TYPELVN----------------------------
A0A2E9VK20      -------------------------QMGIDLPTM-----------------TTKVNPATG
A0A3D4PJK1      -------------------------QMGIDLPTM-----------------TTKVNPATG
A0A355AI52      -------------------------QF----------------------------DVIGS
A0A354PCQ3      -------------------------RRTAQAEFD-----------------RRLAEVQRQ
A0A0S8GZ23      -------------------------IYRAKAG----------------------------
A0A1I3DDV4      -------------------------ESQAKTQNN-----------------P---LFEKL
A0A2E0SMM6      -------------------------QRLQSTN-------------------N---EYHQQ
A0A3L7SI46      -------------------------ERRHVVS-------------------S---AMKDV
A0A5B9PJZ8      -------------------------QELSSLRGE-----------------ENELQGK--
A0A2S8G191      -------------------------KGRAQWQAA-----------------N--------
A0A2E7EGG1      -------------------------SLRDTNR-------------------------PRI
A0A2E2N5A9      -------------------------TQVSQVVSG--------------------------
A0A7C8AGA2      -------------------------QRQEEVA-------------------GQFEKNLEA
A0A7C2FXP7      -------------------------EQIAKTG-------------------KMCDDMLAE
A0A2E3GWC6      -------------------------KRGIELPVN-----------------PANGKAIVG
F0SLB0          -------------------------KRGIELPVN-----------------PANGKAIVG
A0A3L7NDH9      -------------------------QFDGVAA----------------------------
A0A1N6DAJ8      -------------------------AQRRKLY-P-----------------IIQQQLQDM
A0A532UD06      -------------------------EQA--------------------------------
A0A660URN1      -------------------------EKA--------------------------------
A0A517ZCB5      -------------------------DQPRMTS-------------------E---SVKRA
A0A225EH48      -------------------------EFRSKVE----------------------------
A0A518INW8      -------------------------EKAPEGIEE-----------------L---VASNL
A0A518JPH9      -------------------------EKAPTGLEE-----------------I---VSSGM
A0A5C5VEK8      -------------------------QKEADIAKS-----------------KEMALKAYA
A0A532UTJ0      -------------------------QREQEAS-------------------------QAF
A0A432MFP3      -------------------------QLWSDLE----------------------------
A0A2E2CCW9      -------------------------ISADNLE-------------------SGEFQVAET
A0A3C0AGX3      -------------------------ISADNLE-------------------SGEFQVAET
A0A518AAQ5      -------------------------ISAENLE-------------------SGEFQVSKM
A0A517QBG9      -------------------------ISADNLE-------------------SGEFQVSKM
A0A518FTU3      -------------------------ISAENLE-------------------SGEFQVSKM
A0A517WHH5      -------------------------ISADNLE-------------------SGEFQVSKM
A0A5A8BGT3      -------------------------ISADNLE-------------------SGEFQVSKM
A0A2E7K7A9      -------------------------ISADNLE-------------------SGEFQVSKV
A0A517PTS5      -------------------------ISADNLE-------------------SGEFQVSKV
A0A6I6AH34      -------------------------ISADNLE-------------------SGDFQVSKV
A0A517VTK3      -------------------------ISADNLN-------------------SGDFKLSNV
A0A517WQT4      -------------------------ISADNLN-------------------SGDFKLSNV
A0A517VID8      -------------------------ISAENLE-------------------SGEFQVAKT
A0A517RK10      -------------------------ISAENLE-------------------SGDFKIAKV
A0A518IH18      -------------------------ISAENLE-------------------SGDFKIAKV
A0A5C5XLF4      -------------------------QMGIDLP-------------------TMTTKVNPV
A0A2D5NDU9      -------------------------KMRSVDAEN-----------------L--------
A0A1P8WP26      -------------------------QNPAMRM-------------------Q---AAEEN
A0A3L7V1F3      -------------------------EYPRQQQ-------------------Q---EMKRL
D5SZ21          -------------------------SRRQVTI-------------------D---RLKQL
A0A286RGB6      -------------------------ARREEIR----------------------------
A0A518CHE5      -------------------------QRLQSNQ-------------------S---SYHVQ
A0A1V5N3W2      -------------------------KQREDLE-------------------KTFDEMVAK
A0A3E0MY27      -------------------------KREADVTLE-----------------I---EEQEI
A0A7C4Z5R7      -------------------------SRRKEWE-------------------G---RLE--
A0A2E0X9P6      -------------------------RDRDIVE----------------------------
A0A286RLF2      -------------------------AYQDRLR-------------------A---RLDNL
A0A517NSK8      -------------------------DKAAEVGDG-----------------A---VIEKM
A0A5C5Z0D6      -------------------------ENSAKITAS-----------------E---IRERM
M5UE94          -------------------------NNSSKIQAR-----------------D---AQERI
A0A2E8FLY0      -------------------------DRPKNLI-------------------K---QMQQL
A0A3D2U1E1      -------------------------KRPTDIS-------------------A---QMSSL
E8R3W3          -------------------------RDLEASRLG-----------------N---RLSSS
A0A5C5ZM48      -------------------------GRVEMLRSQ-----------------VMSESIGSM
A0A5B9WF77      -------------------------TTSGVASNG-----------------E---RGESI
A0A518BBX8      -------------------------RPTAAFAAF-----------------SGDHESAET
A0A1P8WN28      -------------------------NMQLQLG-------------------EN--VNVGV
A0A3B9CTT0      -------------------------AARADLD-------------------RR--LQIGI
A0A518ALT3      -------------------------ALREHAR-------------------TELAQQQLE
A0A3M1QRP3      -------------------------ERERELE-------------------LAPPATVGV
A0A517TMV0      -------------------------SYRSDTT-------------------G---RPGGL
A0A3E0MY88      -------------------------EYGERIR-------------------A---QVGTL
A0A5B9QF68      -------------------------DYRANLG-------------------N---PSNGM
A0A5B9QGF0      -------------------------EYRANLG-------------------N---QSNGM
A0A5C6CK24      -------------------------EYRANLG-------------------K---QQNGM
A0A2E3RCU8      -------------------------YHDAQLK-------------------T---QVDNL
A0A1C3E6N1      -------------------------SRRQVTI-------------------D---RLKQL
A0A518GJT2      -------------------------SRRQVTI-------------------E---RLKQL
A0A2E8B0L9      -------------------------EFQANVN-------------------R---RLDGV
A0A5Q4GFE7      -------------------------NYQEMVN-------------------Q---RLAGL
A0A257WS34      -------------------------NRNVIVT-------------------E---RLKEM
A0A7C4LP10      -------------------------NRNIAVA-------------------E---SIKQL
A0A517MLW3      -------------------------DFQARVN-------------------G---RSSNQ
A0A5B9QVD0      -------------------------NFQERVN-------------------G---QVSQT
A0A3A0DET7      -------------------------KMQEIVI----------------------------
A0A3B8PNV4      -------------------------ERPKSVV-------------------D---QMQKL
A0A3D1DR40      -------------------------ERPKSVV-------------------D---QMQKL
A0A2E7RYU8      -------------------------ERPKSVV-------------------D---QMQKL
A0A3B8LXG8      -------------------------ERPKSVV-------------------D---QMQKL
A0A286RD13      -------------------------QRRAELT-------------------P---QLVEF
A0A2E3GWX1      -------------------------NRSAQVA-------------------E---GSDKI
F0SG60          -------------------------NRSAQVA-------------------E---GSDKI
A0A2E9VST2      -------------------------GRGQQAS-------------------Q---DSKQL
A0A356A6X2      -------------------------GRGQQAS-------------------Q---DSKQL
A0A5C5XLM3      -------------------------GRGQQAT-------------------Q---DSKQL
A0A7C5FXU1      -------------------------RYQEDLK-------------------R---ISEQL
A0A3M1VCL4      -------------------------QYRAGMA-------------------Q---QLRAA
A0A5C5V7Z9      -------------------------NYHAASG-------------------S---RYASI
A0A5C5YT05      -------------------------SYHAASG-------------------S---RYASI
A0A518D7F9      -------------------------GRHVGAG-------------------E---ALGGI
A0A5C5ZIP0      -------------------------EYRNGAS-------------------G---RADFL
A0A518KBK3      -------------------------SYRSDAS-------------------G---RPTGL
A0A5C6AKF9      -------------------------SYRSDAS-------------------G---RPTGL
A0A6M5Z0K7      -------------------------AIRAERR-------------------K---ELVAR
A0A350CI62      -------------------------EFPELQR-------------------T---RTDTM
A0A4P5WQK6      -------------------------EFPELQR-------------------T---RTDTM
A0A3C1X4W5      -------------------------DFPEMQR-------------------T---RTDTM
A0A3D3W3A7      -------------------------DFPEMQR-------------------T---RTDTM
A0A518DRX3      -------------------------DIRFKAE-------------------T---QQNSI
A0A518DZF9      -------------------------DIRFKAE-------------------T---QQNSI
A0A518AKT8      -------------------------NYRTAAG-------------------Q---RIAGM
A0A5C5ZR72      -------------------------EFKDKLR-------------------QSLLLSARM
A0A7C5R0U3      -------------------------RTRQLPR-----------------------LLATQ
A0A517TY85      -------------------------QLKATAR-------------------AESLAARRA
A0A5B9QEI7      -------------------------ELKELVK-------------------RELIALRRE
F0SI78          -------------------------QEAGERT-------------------S---TKPAS
A0A517MDV3      -------------------------AKRDAIKPL-----------------A---DSPEV
A0A518IQ30      -------------------------EYRAKMQ-------------------A---ANGPG
A0A517LWP4      -------------------------EYRAKIN-------------------A---ANGPQ
A0A518JNW8      -------------------------EYRAKMN-------------------A---ANGPQ
A0A2E7ENQ5      -------------------------EH-GTEG-------------------A---EIDGF
A0A7C2KUQ9      -------------------------TNPGRAL-------------------A---DATT-
A0A7C5BZF0      -------------------------NYPQWIK-------------------S---RTEAI
A0A1G3AQE9      -------------------------EYPGRIR-------------------Q---RM---
A0A3L7UQT9      -------------------------NYFQRAK-------------------M---NLTA-
A0A4P5YBU2      -------------------------NYFQRAK-------------------M---NLTA-
A0A7C7V5U8      -------------------------NFHTRVV-------------------E---RLAQI
                                                                            

A0A5S9IPR9      ----------------------------EEEKYEN-------FKSRRAYY----------
A0A533Q9U4      ----------------------------IATEYEV-------AINRETTL----------
A0A1U9NNE1      EELIEEQINRSSEFQVAE----------LKAELAK-------VRENERRI----------
A0A2G2JCA2      ----TIGKEDLEARYLAS----------KEEELSHVEIRLNGLNISVTKI----------
A0A533Q6B7      ----------------------------ITIEYEI-------AKSNEATL----------
A0A5S9IJB5      --------AEVLGIMQS-----------LKDQYYR-------YKKEEDRL----------
A0A1G2XVR0      ----------------------------VETDYNV-------LLASEESY----------
A0A1G3B0P0      ----------------------------VETDYNV-------LLASEESY----------
A0A1E3X4X0      ----------------------------IETKYKV-------ARAKEDSI----------
A0A286U4B3      ----------------------------IKAEYQE-------AVGKEKGL----------
A0A5C6DDS2      ----------------------------IKAEYQE-------AVGKERGL----------
A0A2E3GW02      --KPASARPDLLTLYMQS----------LQEELRT-------NQEKLKEL----------
A0A5B9QNZ7      QDSPEIRSGTLVKAYAKV----------IDKDLED-------IRKQIEFT----------
A0A1Z8N7H5      --LDELESNQLGPLLLQM----------AQQGLDK-------ARQKESIL----------
A0A1G2YPI3      -----NLDDEFSQAQLAV----------SKQESLA-------AKETEDQI----------
A0A1U7CZ81      -AAAGSGTVATNALTIEA----------LRARVEL-------SRHQLDTL----------
A0A142YNY8      -NPVRDESIK----SIPE----------LRADVEA-------LERERKAI----------
A0A1U7GLS6      -GP-GEPRQK----TVQE----------LKDEVSE-------LESRQASL----------
A0A532UIN2      -----DLDAEFARAQLAV----------AEQQYVS-------AKKKEGQI----------
A0A0S8KNX5      ----------------------------KRSELEQ-------TRQYEKGL----------
A0A3D3UVZ8      ----------------------------KRSELEQ-------TREYEKRL----------
A0A517NFU9      -QSRKFDAAEMLSTYTSL----------LSNDIAE-------LEKRKEFL----------
A0A5C5YWH4      -ATKKLDPAEMLKTYTSL----------LQNDISE-------LEKRKEIL----------
A0A3D2TNK4      ---LEAMGKSIPKEVVVNL---------LRQSTQQ-------AIEKEKQI----------
A0A7C1Y4F0      -----EEAEDFAEAYVEV----------MRLRWVT-------AKQREDDV----------
A0A6I0ENW6      LAKRGEEQAKLLRDMITT----------LEKQITD-------IAGAASEL----------
A0A6L3A0B7      LAKRGEEQAKLLRDMITT----------LEKQITD-------IAGAASEL----------
A0A0J1B4A0      DKRVEAKPADILASYYQV----------LQSDISE-------MEKREEQL----------
A0A142WSB9      KSGNKKAGVDLPHVYLYI----------LESQLEE-------FKIREDLL----------
M5SZR3          EELSEMVEMGLTQ---------------LRQELDR-------TVRTQELL----------
M5TW92          EELSEMVEMGLTQ---------------LRQELDR-------TVRTQELL----------
A0A2S8FKY2      PEVDNTIPE-------------------LKVRIGV-------LRQQQREL----------
A0A517N8P6      VKRQDEAAQALLTTYVSS----------LRKKQDL-------INEDVADT----------
A0A432MJP4      -SVESVEVDDLILS--------------IEQAVAS-------VEALQQEY----------
M5UQ35          DDEVVVSTVDMLGHYFNV----------LKSDVRE-------YEARERDL----------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      DRATEQLGGLGKDGLQSE----------LHDRMAS-------IEHSLKSIGSMREEYETK
L0DFG4          DQATEQLGGLGKDVLQSE----------LRDRMTS-------IEHSLKSIGTMREEYEIK
A0A5C5XXG1      FGENSVNPESLLKAYVGF----------LNHDMAT-------IAERKSEL----------
A0A7C7YUM8      RGTIRESVGTLRERVRAS----------LAAQVRG-------LSDHIVAV----------
A0A7C2AHI6      RGKVDAAVRLLEQRILGN----------LESRLAG-------INDDIRSI----------
A0A518BJJ1      ARVDRAALEDLRERVERQ----------LASRLDA-------VALENDEL----------
A0A518D182      LESIDAALAATRARIADH----------LASRREA-------LGRQYTEL----------
A0A5C5WTY6      -SSPTLDPEAMLKAYVGF----------LRNDLAS-------HLERKTEL----------
A0A5C5Y033      -GSQAIKPDALLRAYIGF----------IEHDIAA-------IGERRKEL----------
A0A5C6G1Y2      -GSQAIKPDALLRAYIGF----------IEHDIAA-------IGERRKEL----------
A0A354PDV6      -GAGMLSPEALLKAYVGF----------LEHDLAT-------LTQRKREL----------
A0A5C6FZ02      -GENSVNPESLLKAYVGF----------LNHDMAT-------IAERKSEL----------
M5TIT3          -GSSTLSPEGLLKAYVGF----------LQHDLAT-------LSERRKEL----------
A0A5M6CY44      -ADTMLTPEGLLNAYTGF----------LQNDLAA-------LAERRKEL----------
F2AXG2          -GDSALTPEGLLKAYVGF----------LQHDLAA-------LSERRKEL----------
M2BB46          -GDSALTPEGLLKAYVGF----------LNHDLAA-------LSERRKEL----------
L7CLQ6          -GDSALTPEGLLKAYVGF----------LNHDLAA-------LSERRKEL----------
A0A0J1B719      -GDSALTPEGLLKAYVGF----------LQHDLAA-------LSERRKEL----------
Q7UF18          -GDSALTPEGLLKAYVGF----------LNHDLAA-------LSERRKEL----------
A0A2G1W1E0      -GDSALTPEGLLKAYVGF----------LNHDLAA-------LSERRKEL----------
K5E235          -GDSALTPEGLLKAYVGF----------LNHDLAA-------LSERRKEL----------
A0A5C6FFI9      ----TMNPRTMLTTFTRL----------LKNDIAE-------YEMREAIL----------
A0A5C5WDJ1      ----DMDPAEMVMTYVML----------LKNDISE-------FEMRKAVL----------
A0A5C5X547      VGDTGENQDQLMAQFNEVD---------LRSRIKK-------IIEQEAEL----------
A0A353FIP5      ----------------------------VEARGVA-------LKKQIVSL----------
A0A5B1CIK7      -GESTLTATGLLKAYVGF----------LNHDLAT-------LGEQRKEL----------
A0A5C5WHS2      -ADSTLTPTGLLRAYVGF----------LNHDMSA-------LNEQRKEL----------
A0A5C6B6G8      -SDTMLTPESLLKAYIGF----------VNHDIAA-------LGERRKEL----------
A0A5C5ZZN3      -GESALTPEGLLKAYVGF----------LQHDLAA-------LAERRKEL----------
A0A5C5XS91      -TDTALNPEGLLKAYVGF----------LNHDLAT-------LTERRKEL----------
A0A5C6C4E6      -NESSLSPEGLLKAYVGF----------LNHDLAT-------LTERRKEL----------
A0A2E1VVJ1      ----------------------------LASRLEG-------LRSQESTL----------
A0A3M2AEL0      ----------------------------VQDTLAA-------LEAQQVSL----------
A0A2A2W9R6      --EFDVPPAEILATYYTV----------LKSDISE-------FAKRESEL----------
A0A518HKC1      --DFDVPPAEILAAYYAV----------LKSDINE-------FAKRETEL----------
A0A518L3P0      --EFDVPPAEILATYYAV----------LKSDINE-------FARRESEL----------
A0A255R1S0      GRVFDVPPSEILKTYYSV----------LKGDIAG-------LKKREEEL----------
A0A5B9MKP1      -KAFDVPPSEILGTYYAV----------LKSDLNE-------FARREAEL----------
A0A0S8J591      AT----------------------------------------AQANYEFL----------
A0A351FYP6      ----------------------------LELRVNS-------SLAQVREL----------
A0A532UT69      ---------KFAQTQLAV----------AEQQYLN-------AREKENEI----------
A0A2D5AWU0      ---------QYARNYKID----------AEIAYNE-------AKNRETSL----------
A0A1G2YQB7      EF------KESDLLEMQS----------YNDKLNQ-------LSKHEQQL----------
A0A353P687      EF------KESDMLEIQE----------YKYKLEQ-------ISLHQQQL----------
A0A356EME5      AI------SAKREADLAS----------KKFEIES-------RRRMEEAL----------
M5RT57          LA------ELDRRDTLHE----------LEARLET-------QLVLENLL----------
A0A356KTN1      DE------KVAVEQGLLE----------RDR-----------------------------
A0A518HFS8      DR------PAARDPGLEQ----------AGRYLEI-------LEEQERIL----------
L0DC26          AG------RESSGSKTTL----------LQHRISI-------LSKLEGAM----------
A0A3L7P4E4      ---------DFLQVYIES----------LHQQKKA-------GEERLLQL----------
A0A3L7PEB5      ---------DFLEVYVES----------LQQQKKA-------GEERLLHL----------
A0A1U9NL64      ---------EFASAQLAV----------ARERHMA-------AKKQLDEV----------
A0A2N1UCJ3      ---------EFAKNYIEL----------LEIEYDA-------AKQKEAEL----------
A0A7C4EK84      ---------EFAEAYRAA----------VLHALQT-------ARARQQQI----------
A0A7C3F0T2      ---------RLAEAQLLA----------ASRRLEA-------LKEKEAQI----------
A0A2E0X4J3      ---------TMIAAYVDS----------VKSAYEL-------LEHKYAEL----------
A0A5C5YU10      ---------AALRAYAFN----------VKERFEF-------HTNKLNGL----------
A0A517MPZ6      ---------AIVSAYVET----------VSQEHQL-------LEQKREEL----------
A0A5C6CNV7      ---------AIVSAYVET----------MSQEYQL-------LEQKRAEL----------
A0A518K5H4      ---------ATLNAYVDG----------LRQNYEL-------LAQRRDEL----------
A0A5C6AA28      ---------AILNAYVDG----------LRQDYEL-------LTQRRDEL----------
A0A2E7ESJ6      --------GTIKPSRQELFDYVTRYLASLKQKQIQ-------LKGQYESL----------
A0A2E9VK20      ESELVTGNDPIATYVVA-----------LEQQQAE-------LKNRIGEL----------
A0A3D4PJK1      ESELVTGNDPIATYVVA-----------LEQQQAE-------LKNRIGEL----------
A0A355AI52      PRSFGGDDTQLANTVANI----------LNQRLES-------AERQEEWL----------
A0A354PCQ3      AE------AEQGEINRKL----------SRDQLVT----------KIAVL----------
A0A0S8GZ23      --------EKFDEAMVRFMEQK------READLTKAKVQLANYQAMESEY----------
A0A1I3DDV4      TP------ELLLNAYTGF----------LRHDLSA-------LDQRKREL----------
A0A2E0SMM6      HN------RKQAERLLRI----------AEQKLSQ-------LKGRYTAL----------
A0A3L7SI46      RE------RELGPKLLEM----------VKQRLYQ-------AGAHEQAI----------
A0A5B9PJZ8      --------PDMVADFVER----------VAGQIAM-------ISAQEKSL----------
A0A2S8G191      ----------------------------FKASVDKARSEVVLLEQMEKQL----------
A0A2E7EGG1      REEMKAMSGLQRQQELAM----------LKTQLET-------QKLIVQSM----------
A0A2E2N5A9      ----------------------------IQRNYQL-------AVANEQSQ----------
A0A7C8AGA2      ET------AKNRKRRVAE----------LKIQLEQ-------TVQYEKRI----------
A0A7C2FXP7      RA------TNSGKKELAA----------ARIQLQQ-------TAAHEKRF----------
A0A2E3GWC6      PNGQVEPGSDMISTYMTA----------LTQQQAE-------MKNRLDEL----------
F0SLB0          PNGQVEPGSDMISTYMTA----------LTQQQAE-------MKNRLDEL----------
A0A3L7NDH9      PREFAGDDEKFAQMISQI----------LDQKVSA-------AVQHETWL----------
A0A1N6DAJ8      GRDDDDSSEALLPHRISI------------------------LAKLETLL----------
A0A532UD06      --------KEFADAYIEV----------MQLRWLA-------AKQREDEL----------
A0A660URN1      --------KNFADAYLEV----------MRLRWTT-------AGQREDEL----------
A0A517ZCB5      ST------EDLGPRLLQM----------ARHRYLM-------AANQEQQL----------
A0A225EH48      --------ADIRAALKRE----------IKSDIEREKQFVTYKTTLTKKL----------
A0A518INW8      SP------TEILDAFSTL----------LKNDVKE-------LTKQLAQL----------
A0A518JPH9      TP------SQILTAFSTL----------LNNDIKD-------LSKRQQHL----------
A0A5C5VEK8      FD--------------------------IKERYEF-------QTNKLNEL----------
A0A532UTJ0      DERVTKEIAEAGHKELVA----------ARSKLDE-------TTVIEESL----------
A0A432MFP3      --------PTLRAQLAAEETHPVQIVLRAEQRLLR-------LERERQLL----------
A0A2E2CCW9      KD------VDFVNVYLKS----------MEQQLKE-------LENRELEL----------
A0A3C0AGX3      KD------VDFVNVYLKS----------MEQQLKE-------LENRELEL----------
A0A518AAQ5      KD------VDFVNIYLKS----------MEQQLKE-------LENRETEL----------
A0A517QBG9      KD------VDFVNIYLKS----------MEQQLKE-------LENRETEL----------
A0A518FTU3      KD------VDFVNIYLKS----------MEQQLKE-------LENRETEL----------
A0A517WHH5      KD------VDFVNIYLKS----------MEQQLKE-------LENRETEL----------
A0A5A8BGT3      KD------VDFVNIYLKS----------MEQQLKE-------LENRETEL----------
A0A2E7K7A9      KD------VDFVNIYLKS----------MEQQLKE-------LENRETAL----------
A0A517PTS5      KD------VDFVNIYLKS----------MEQQLKE-------LENRETAL----------
A0A6I6AH34      KD------VDFVNIYLKS----------MEQQLKE-------LENRETAL----------
A0A517VTK3      KE------ADFVNIYLKS----------MEQQLKE-------LHNREQEL----------
A0A517WQT4      KE------ADFVNIYLKS----------MEQQLKE-------LHNREQEL----------
A0A517VID8      KD------VDFVNVYLKS----------MEQQFKE-------LENRELEL----------
A0A517RK10      KD------VDFVNVYLKS----------MEQQLKE-------LNNRETEL----------
A0A518IH18      KD------VDFVNVYLKS----------MEQQLKE-------LNNRETEL----------
A0A5C5XLF4      TG---------EPELVTGNDPIATYVVALEQQQAE-------LKNRIGEL----------
A0A2D5NDU9      --------ESYAATLLAA----------LDRRVAS-------IQAERQVL----------
A0A1P8WP26      SR------GYLGPKLIEK----------TEQRLRM-------ARQQVAQI----------
A0A3L7V1F3      AE------TELAPRMIQY----------LRQQMES-------NQQNEDAI----------
D5SZ21          RM------EELTPRLLQM----------ARQRVQH-------SQQHEASV----------
A0A286RGB6      --------QELEQRRVRD----------LDEEIENLNFELSILAQQQDQL----------
A0A518CHE5      QN------RRQAQRLLEI----------AEQKLVQ-------YEERYRAL----------
A0A1V5N3W2      EL------TENSQLQLDK----------AKAELEQ-------IIVQENIL----------
A0A3E0MY27      IP------PEVAQLNL------------LQNSLTA-------TQEHLAKL----------
A0A7C4Z5R7      --------AQMQEKALEE----------TQGKLREAEQFLALQEESEKLQ----------
A0A2E0X9P6      ----------------------------KKQELQS-------LATRRVKL----------
A0A286RLF2      NI------PELSQMLLGT----------LRQRVNE-------LWQKEMSL----------
A0A517NSK8      KP------DEMLQTYVGL----------LENDLAG-------LQREREVL----------
A0A5C5Z0D6      EP------AEMLQTYVGL----------LKNDLSG-------IQKRREVL----------
M5UE94          TP------AEMLQTYVGL----------LKNDVMG-------LQRQRQVL----------
A0A2E8FLY0      ST------AQLTPSLIDM----------ARQRLSY-------AQSRETAL----------
A0A3D2U1E1      AK------DRLTPTLIDM----------SAQKLRY-------AELREQAL----------
E8R3W3          PR-SATPNDLFANATLEQ----------IERSLRE-------DYEWAELL----------
A0A5C5ZM48      KPSGPSEESEA-----------------IDLRLAA-------LDLQEDYL----------
A0A5B9WF77      PE--------------------------LMQQIAV-------LKTKKDKL----------
A0A518BBX8      LLSKSGSAAEAVEMHLDY----------LNQKLDY-------LKVAEDRL----------
A0A1P8WN28      RD------PQVGQWLIKQ----------IEAEVQA-------TRQYEQSL----------
A0A3B9CTT0      RG------PEAGQWLMDS----------LQAELNS-------IQQFESSL----------
A0A518ALT3      RN------KQESEQAILS----------KQQEITT-------LAKKLELL----------
A0A3M1QRP3      KR-----DDEFAGMSPRE----------LRWELED-------LRAELTNL----------
A0A517TMV0      AD------AELGPMLMGM----------LDQAWRQ-------AVQREQQI----------
A0A3E0MY88      QS------TTFGPTLTHM----------MEQALAS-------AWHRENQL----------
A0A5B9QF68      AE------SHLGPVVKRM----------LEQSVQQ-------AWQKEQQM----------
A0A5B9QGF0      AQ------NHLGPVVKRM----------LEQSVEQ-------TWQKEQQM----------
A0A5C6CK24      VQ------QHIGPVVKRM----------LEQSVQQ-------TWQKEQQM----------
A0A2E3RCU8      ES------NQLGPVLLRM----------AQQGLNK-------AKQKESIL----------
A0A1C3E6N1      RM------EELTPRLLQM----------ARQRVQH-------SQQHEASV----------
A0A518GJT2      RT------EELTPRLLQM----------ARQRVQH-------SQQHEASV----------
A0A2E8B0L9      QS------EQMAPMLLGM----------VEERLSK-------TWELEADL----------
A0A5Q4GFE7      SD------GRLGPMLLAR----------VEEQLSN-------LREHEERL----------
A0A257WS34      RS------NELAPRLLQM----------AQQRLLQ-------AQARENSL----------
A0A7C4LP10      SA------NELGPRLLKM----------AAQRYQQ-------AAAQEEAL----------
A0A517MLW3      SG------GQFAALLGDL----------VQQKLNE-------STQHEALL----------
A0A5B9QVD0      SG------QQFARLLGDL----------VVQKLDE-------AKQHEALL----------
A0A3A0DET7      ------------EAYVES----------VRQQYEL-------LDQKRSEL----------
A0A3B8PNV4      SK------AQLTPSLIDM----------SRQRLRY-------AESREVAL----------
A0A3D1DR40      SK------AQLTPSLIDM----------SRQRLRY-------AESREVAL----------
A0A2E7RYU8      SE------AQLTPSLIDM----------SRQRLRY-------AESREAAL----------
A0A3B8LXG8      SE------AQLTPSLIDM----------SRQRLRY-------AESRETAL----------
A0A286RD13      AREQLAKGRAVAPPTETE---------QIQAEIAQAELEKAVLEDELKVA----------
A0A2E3GWX1      NA-------ELGPRLLQM----------AKQRYQH-------AMLNEQEI----------
F0SG60          NA-------ELGPRLLQM----------AKQRYQH-------AMLNEQEI----------
A0A2E9VST2      TH-------DMGPQMLEM----------AKQRYQH-------AVTLEQDI----------
A0A356A6X2      TR-------DMGPQMLEM----------AKQRYQH-------AVTHEQDI----------
A0A5C5XLM3      TR-------DMGPQMLEM----------AKQRYQH-------AVTHEQDI----------
A0A7C5FXU1      EKRRGELLEELRRRRRKA----------LDDELAEHKFRMSVLLQQQQEL----------
A0A3M1VCL4      TE------THIKPRLRQM----------AIRRLMV-------ALEEERSL----------
A0A5C5V7Z9      NN------QDLGPMIKRT----------LEQSVAQ-------AIERERVL----------
A0A5C5YT05      NN------GDLGPMIKRT----------LEQSVAQ-------AMEQERIL----------
A0A518D7F9      GD------SELGPLLISM----------LQQSAQQ-------LARLETQL----------
A0A5C5ZIP0      GQ------EELGSMLSTM----------LNQALAQ-------AGERERQL----------
A0A518KBK3      TA------AELGPFLVGM----------LNQAMSQ-------SVERERQL----------
A0A5C6AKF9      SR------EELGPLLIGM----------LNQALAQ-------SNERERQL----------
A0A6M5Z0K7      NQ------KLVGENLKQLVADCEAERNALEQRLRD-------CQDYANGL----------
A0A350CI62      TR------EVLAPRLVQY----------LSQQILK-------LELNEKAV----------
A0A4P5WQK6      TR------EVLAPRLVQY----------LSQQILK-------LELNEKAV----------
A0A3C1X4W5      TR------DVLAPRLVQY----------LNQQILK-------LELNEKAV----------
A0A3D3W3A7      TR------DVLAPRLVQY----------LNQQILK-------LELNEKAV----------
A0A518DRX3      AG------QQLAPLLTSL----------IAQRLAE-------TRANEKQL----------
A0A518DZF9      AG------QQLAPLLTSL----------IAQRLAE-------TRANEKQL----------
A0A518AKT8      TG------NELGPMMQEL----------LRQSIAQ-------TLEQEKQK----------
A0A5C5ZR72      SR------QKSGKTLADT----------KREELEM-------LSALEASV----------
A0A7C5R0U3      DP------RQLGPLLRSL----------VQERLTA-------AQVRESKL----------
A0A517TY85      DQ------EGEQRKLLAA----------KEQELAA-------WIMKRKLL----------
A0A5B9QEI7      ER------KAEQEALVGA----------KQQELGL-------LSKKREML----------
F0SI78          AR------PDLLTLYMQS----------LQEELRT-------NQEKLKEL----------
A0A517MDV3      RS------GTLVNAYAKV----------IEKDLED-------VTQRIVFV----------
A0A518IQ30      QE------QQLGEMLLSM----------IREALAE-------TQANEQQL----------
A0A517LWP4      QE------QQLGEMLLSM----------ISEALTE-------TQANEEQL----------
A0A518JNW8      QE------QQLGEMLLSM----------IGEALAE-------TQANEEQL----------
A0A2E7ENQ5      QN------QQLGEMLLSS----------IQGKLNT-------AIVHEQNL----------
A0A7C2KUQ9      AG------AALGGEVRQL-----------EHRLKL-------LKYQESLK----------
A0A7C5BZF0      SS------SELASTLSDI----------LMQKVNE-------ARSLELSL----------
A0A1G3AQE9      QD------AGLGPMLIGL----------VHHKLAE-------AQWLEATL----------
A0A3L7UQT9      NS------ADLGPQLLGM----------ARQRYQL-------AMSRQHTL----------
A0A4P5YBU2      NS------ADLGPQLLGM----------ARQRYQL-------AMSRQHTL----------
A0A7C7V5U8      QE------HQLGPLLVDM----------LQKKLEL-------TRRRESLL----------
                                                                            

A0A5S9IPR9      --QKKLKELEEQNLAFHQK-ILMYEDINAEV----------AALRDRYNDYREKMKEYDS
A0A533Q9U4      --VTILEQQKNEVFALGDK-AIQYGVLKREA----------DTNRQMYETLLTRMKETNL
A0A1U9NNE1      --REKLEGTNAELITLGKR-HLAIKDHQEQL----------ELTKELYDAINRKIQKIEM
A0A2G2JCA2      --QEMLDKEMKLAKKTSGD-TFELEIKQREL----------EELSDIHRMIESRILKIRT
A0A533Q6B7      --LSLFEQQKNEVFTQGDR-SIQYGVLKREA----------DTNRQMYETLLTRIKETNL
A0A5S9IJB5      --KKLVVAQQREALIFSQK-VTQYQLLKKKY----------NALEETYLSVKQRLGQLEL
A0A1G2XVR0      --EKAYNEQSLVVFDLNRK-ITVYRRLQREA----------DSERAFYDILLKRMKESNI
A0A1G3B0P0      --EKAYNEQSLVVFDLNRK-ITVYRRLQREA----------DSERAFYDILLKRMKESNI
A0A1E3X4X0      --RESLEKQKEEALRLNKK-AIKYGILKREA----------DTNKDLYEILLTRLKEASM
A0A286U4B3      --RQHLEELKRENNRLEGK-SISYKVLKREV----------DANTQLYEGLLQRMKQATV
A0A5C6DDS2      --RQRLEELKRENNELEGK-SIGYKVLKREV----------DANTLLYEGLLQRMKEAAV
A0A2E3GW02      --DNLFLSERTHSSNLTMD-ENRGRVLREDL----------NRTKKLYDVVLEKLQEISL
A0A5B9QNZ7      --QQQIKQDEQESVDLVDD-ELRDQQIRDEL----------YATKQLQLAVIDRLRQLNV
A0A1Z8N7H5      --QASLDEARFXAVAHQRD-TSHITMLAQNV----------SRLRRLHDAIIDQIAGVDL
A0A1G2YPI3      --AKYYEDQRKQAVALNQQ-INKYTLLQSDW----------EQTKKDCDILNDRMKELSV
A0A1U7CZ81      --NQLVLSMEIERKATQSD-TYAAERLKADI----------ETLVEQYKHISEKFENLKF
A0A142YNY8      --TEALAQAELETKESNSE-TYTARYLQAEI----------DSMTHDQQIVHRRLEDLKF
A0A1U7GLS6      --QKVLDEVKLESKESNSA-TYQAQFLQNEI----------RVMVDDERVVNRKLQELEF
A0A532UIN2      --AKYHNEQRKQALDLNEQ-LAQYTILQSDW----------EQTRRLCDILDERIKELNV
A0A0S8KNX5      --RETLSKEDTETIDLGRT-QLTIQELQDGL----------LLAKEMYDTVQRRIQDLEM
A0A3D3UVZ8      --QETLSQQDTQTIGIGRK-QLTIQELQEGL----------ESTKEAYQIVLKRIQDLEL
A0A517NFU9      --LQESTLEMRLAKEVESD-FMKGSSMKSKL----------TRAQSRYDEVILRLQELKL
A0A5C5YWH4      --LADSEVEMRMAKQVEGD-FMKGASLRARH----------SRAQMRYDEVIRRLQELNL
A0A3D2TNK4      --RQAYQQARAEAAAYSGS-LVQFRALERAV----------ARDEAKSDILTDKIANIDF
A0A7C1Y4F0      --RASFESQYNDAKGFGVL-AARYSLLQSEL----------SRAERICEIVDNRIKELNV
A0A6I0ENW6      ------------------------KMQDHEI----------EHITLKYEAVQKRVEEIQS
A0A6L3A0B7      ------------------------KMQDHEI----------EHITLKYEAVQKRVEEIQS
A0A0J1B4A0      --LELSEKESKLAKEVETT-FLLGSSLKANL----------DRAQARYDEVFQRLHEINL
A0A142WSB9      --AARRTEAEGTAKESSLF-DAADQKRKDEI----------AAKQKELESVRMQIADYNQ
M5SZR3          --RGIYDTEYVSAKELTDY-EIAEEEFQSNM----------EHTRQLYDGVVAQLQAASL
M5TW92          --RGIYDTEYVSAKELTDF-EIAEEEFQSNM----------EHTRQLYDGVVAQLQAASL
A0A2S8FKY2      --SKEVADLEKEVRTFGRS-SVEVEMKRSEI----------ASLDEILQQLNTEIERTNI
A0A517N8P6      --TKRLEDVRAKALKLMEF-EGENASFLRRI----------ARYQETLDLYDTQLEKANL
A0A432MJP4      --TDRFREDLEQARQILND-QAEEENIRAQL----------DRQQRLFNTVVDQLKQAQL
M5UQ35          --GSLAEVEAKAAKEVQMA-FMEGNSLKANL----------DRAQARYDEVFQRLQEINL
A0A0S8FY64      --AVLVAREQELVRVLLEE-TRVALEQARKVHVYSRLERDAERQARVFDVIVDRMREVDL
A0A1N6KFT7      LKEDLVAAKQSELGLLEEE-RLH-----GNL----------DRQKALYNTVLDQLKQAQL
L0DFG4          FKDDLVSAKQSELERLEEE-RLH-----GNL----------ERQKALYNTVLDQLKQAQL
A0A5C5XXG1      --TALANQAETDARELIEY-ELTDVVLRKEV----------ERNEALFDGVVQQLRDVDI
A0A7C7YUM8      --EHTITEHDQRLGRLPQS-QLALAQAIRAQ----------ETHSEIVAFLLKSEQEAQI
A0A7C2AHI6      --DARIAGVQAELAQLPEE-QRRLADPLRRV----------AAYGEIVRFLLKSQQEAQL
A0A518BJJ1      --GRYVAVLEERLGNLPEQ-QRRLASPMRRL----------ETHKQIAAFLLTSLQEAEI
A0A518D182      --DRVCADLEAQLGALPEK-ERLLAAPLRRL----------ETHKELTALLLKSLQEAQI
A0A5C5WTY6      --QRLVELAEEQAREFVAF-ERSDRLLQNEI----------DRQRALFDGVMERVVNMNS
A0A5C5Y033      --IALTTDAESKAKELIEF-ELKDLVLQKKI----------ARHEAIFDGIVGQLQELNT
A0A5C6G1Y2      --IALTTDAESKAKELIEY-ELKDLVLQKKI----------ARHEAIFDGIVGQLQELNT
A0A354PDV6      --TILAGNAESQAKTLIDY-ELQDMVLRKKI----------ERQEKLFDGVVQQLRELDT
A0A5C6FZ02      --TALANQAETDARELIEY-ELTDVVLRKEV----------ERNEALFDGVVQQLRDVDI
M5TIT3          --TFLAADAETKAKELIEY-ELTEMVLQKKI----------LRQEALFDGVIQQLRDLDT
A0A5M6CY44      --GFLTADAEKKAKELIEY-ELRDLVLQKNI----------ERQEALFDGIVTQLRELDT
F2AXG2          --EYLADEAGKEAQTLITY-ELNDMMLRKAI----------ARQEALFDGVVKQLHDLDT
M2BB46          --TYLADDAGTKAKELIEY-ELRDMMLRKAI----------ERQEALFDGVVQQLQNLDT
L7CLQ6          --TYLAADAESKAKELIEY-ELNDMILQKKI----------AREEALFDGVVQQLRELDT
A0A0J1B719      --TYLAADAETKAKELIEY-ELTDMILQKKI----------GRQEALFEGVVQQLRALDT
Q7UF18          --TYLAADAETKAKELIEY-ELTDMILQKKI----------GRQEDLFEGVVQQLRELDT
A0A2G1W1E0      --TYLAADAETKAKELIEY-ELTDMILQKKI----------GRQEDLFEGVVQQLRELDT
K5E235          --TYLAADAETKAKELIEY-ELTDMILQKKI----------GRQEDLFEGVVQQLRELDT
A0A5C6FFI9      --VETSSEELQLAKDVENA-FLEGNAKKAKV----------TRAQIRYDEVIRRLQELNL
A0A5C5WDJ1      --LSESQKEMLLAKEVEAD-FMKAGALRAIR----------SRAQSRYDQVIERLQELEL
A0A5C5X547      --EAMSSSLRDNFKLLGKT-SADVEMLRGDI----------ASLEQVVSNLAAELERTRV
A0A353FIP5      --DRAISRWQGQLDALPAV-ERKLAKFQRKA----------NAYEQIYTYLLGKEQEARI
A0A5B1CIK7      --NFLAADAETKAKDLIEY-ELNDMVLRKKI----------ERQEALFDGVVQQLRDLDT
A0A5C5WHS2      --TFLAADAEEKAKALIEY-ELKDLVLQKKI----------SRQEALFDGVVQQLRDLDT
A0A5C6B6G8      --IFLSEDAETKAKELIDY-ELQDMVMLKKI----------DRQEALFEGVVSQLRDLDT
A0A5C5ZZN3      --TFLASDAETKAKDLIEY-ELTDMILQKKI----------ARQEALFDGIVQQLRELDT
A0A5C5XS91      --TFLAADAERKAKELIEY-ELTDMVLQKKI----------TRQEALFEGIVQQLRDLDT
A0A5C6C4E6      --TYLSADAERKAKELIEF-ELTDMVLQKKI----------TRQEALFDSIVQQLRDLDT
A0A2E1VVJ1      --LTALDEYDVRLDGLPRA-QRELIRLQREA----------SSHEAVYLILMQRLQEAKI
A0A3M2AEL0      --QDTISRLRENLEELPAT-ERQLARFSRRA----------AAFEQIYTLLLTRLQEAQI
A0A2A2W9R6      --LALSEQESKLAKEVELS-FLKGTAFKANL----------DRAQARYDEVFKRLQELNL
A0A518HKC1      --LALSEQESKLAKEVELS-FLKGTALKANL----------DRAQARYDEVFKRLQELNL
A0A518L3P0      --LALSQQESKLAKEVELS-FLKGTALKANL----------DRAQARYDEVFKRLQELNL
A0A255R1S0      --VAQSEQEAKVAKEVELS-MLEGTSLKANL----------ERAQARYDEVFKRLQELNL
A0A5B9MKP1      --LALSDQETKLAKQVELD-FLKGASLKANL----------DRAQNRYDEVFKRLQELNL
A0A0S8J591      --SDMLLTNRQRLTQISRD-MLQLEGLRKQQ----------ENIEEMRAVLDKAAETVKT
A0A351FYP6      --QKSVDDAKAKEAKVQEE-GREYFDAKRKL----------SNTTRMRDTILFRIMQEEV
A0A532UT69      --ARYYDEQRQQALSLNEQ-VAEYTMLQSDW----------EQTKKLCDILNERIKELDV
A0A2D5AWU0      --DLDVTSLQEELGKTNRA-LQQIDNYESEF----------DSIRDFSEHLKSRLNELDV
A0A1G2YQB7      --RDMLKSEDSKTIELGRK-QLAMQDVKEQL----------DSSKQMLETIQKRVGELEM
A0A353P687      --RDMLVHEDSKTIELGRK-QLAMQDVKEQL----------DNSKDMYSTIQKRIGELEM
A0A356EME5      --RERYEKELKKVAPGVAD-MVSIEFEQAEL----------TRATDVLNLIEQRVVELRT
M5RT57          --GLRYKEMLGTAGESGNK-LLELEFARAEL----------EREERVFDLIAERSMALTT
A0A356KTN1      -------NLREESRVFARR-SRLYESLKNEV----------DANRTFYEEFASRLKDL--
A0A518HFS8      --REEIASLEQEMGTLGIQ-SLDLHWVEDEI----------DLSTEVARAVGSEVRAVTV
L0DC26          --EDDVKRLNGRTRSITQN-SVDLFSIQEEI----------ANADEVARTIGKEVEALTV
A0A3L7P4E4      --NSLFEEEQRIAKEQLDL-QIKDKRYRNDI----------ARSELTFNAIVSQFKDADL
A0A3L7PEB5      --NQLFEEEKRIAKEQLDL-QIQDKRYRNDI----------ARSELAFNTIMTQLKDTDL
A0A1U9NL64      --STFFEEQRAAAMDLNDQ-LAQYTILESEY----------QQSKKLNDILDERIKELNI
A0A2N1UCJ3      --SASYEQYKQESQSLNIK-ATEYAIIETKL----------EQSKRFCEILDDRIKELNV
A0A7C4EK84      --QQAFEQQQKEAMELNSK-AAVFATLEAEV----------RRIEKLCDILDTRIKELNL
A0A7C3F0T2      --RKSFESQRQEMVDLNAQ-VAQFTRLRSEW----------EQAKRACEAIDDRIRQINV
A0A2E0X4J3      --QRSYDRQFSEAKQVSAL-ALKLASLQEAI----------ERSESENELVDEQIKEVNL
A0A5C5YU10      --RSKYQDQFEAAKESSAN-SLKLFSLEETY----------ARAISDSDEVEERIKELDL
A0A517MPZ6      --QRSYDKQFKLAMQVNSQ-AAKLTTLENSL----------ARTVRDVDRVDEQIKGINL
A0A5C6CNV7      --QRNYDSQFKLALQVNSQ-AAKLALLEESL----------ARTARLTDILDERIKEVNL
A0A518K5H4      --QKAYDKQFALATEVSQQ-AAKLADLQEAY----------EQTSEYCDTLNKQIREVNL
A0A5C6AA28      --QRAYDKQFALATAVSQQ-AAKLDALQEAH----------DRTARMCDILDERIKEVNL
A0A2E7ESJ6      --TGLFNQEEDAAKELQIL-QAKDEQFQNEI----------ARTQQLFEVVVKSLEEISL
A0A2E9VK20      --QKLFDRSADQAKDFAQY-EEREQTLSDEL----------KRIKSLHDIVANRVEVLSL
A0A3D4PJK1      --QKLFDRSADQAKDFAQY-EEREQTLSDEL----------KRIKSLHDIVANRVEVLSL
A0A355AI52      --QKSFERAKEESIGLTSD-ISQLDIVETDL----------NWLRQLRNTLLNQIASVDI
A0A354PCQ3      --REQYDEELTRMEQFGGT-SAELQFAQEEL----------AVSNSVLMKLRDRVAAIRT
A0A0S8GZ23      --SRRLVEELEQNKDMGNV-QFEIRTRQAEM----------ARDQSEYNLVLERIDDIEI
A0A1I3DDV4      --LTLAAEAEKNSKSLIEF-ELKDKMIQAEM----------TRKQTLYDSIVEQLREMDT
A0A2E0SMM6      --KKSYDEEEEAGRESTLV-MSMIKQKETDQ----------ERILHQHDTLLQKIREVDL
A0A3L7SI46      --REDFEIIRSQALSLNGQ-MAQIDIMEMDL----------KRMRLYYDLILEQMKKIDI
A0A5B9PJZ8      --EESILDEQRKAAQTSVN-IERLLALQRER----------DRLELYSDNTIDKLGEVEV
A0A2S8G191      --VDSVTTFEKEAKQFGRS-SIDVEMMRTEI----------DSLEGILSRLGHEIENTKI
A0A2E7EGG1      --RSNYDAMVEDISQSGGQ-TLDLKFKQAEL----------NRKQQVFDSISERAAQIAT
A0A2E2N5A9      --QALFDSNKYQIQNLSSK-EFKVRELALEV----------EANRALYDTFLVRLKETAA
A0A7C8AGA2      --REKLAKQDKDTIGLGRK-QFAIDDQKAQL----------ARSQEMYDAVNKRIDEIQL
A0A7C2FXP7      --DEILSKEDTETIELGRK-QLAIQEMQEQL----------ALTKETYGAIRRRIQELNM
A0A2E3GWC6      --QKLYDESTKQAKSFARF-ESQDQSYKEDL----------QRIRSLHDVVTRRIEELSL
F0SLB0          --QKLYDQSTKQAKSFARF-ESQDQSYKEDL----------QRIRSLHDVVTRRIEELSL
A0A3L7NDH9      --TQSFEQAKQDSIGLASE-MARLDIADHDL----------RWLRELRNTILNQIASVDL
A0A1N6DAJ8      --ASDVKRLSERSASITQN-SVDLFSVQEEI----------ANADEIARTIGKEVEALTV
A0A532UD06      --MTSFESQHQAARELSVK-AAQYAVLQSEL----------NRAERICEILDNRIKELNV
A0A660URN1      --LASFDAERKAAQDLGVK-AAEYSVLQSEL----------KRTERLCDILDNRIKELNV
A0A517ZCB5      --LAEFERERDNALQLNQQ-LAEIQIAELEI----------QRMRTYDDVLLDAITNIDL
A0A225EH48      --GEEIKRLEKELELARGA-NVQGIIDLGDL----------GPLKEQRAAMEKERLDLDL
A0A518INW8      --TEEAKAVRVAAKEVESE-YLEGTALKAKM----------TRAQQRYDVVMERLQELEL
A0A518JPH9      --MEEAATVRVAAKAAESE-FLEGTALKAKM----------TRAQQRYDVIMGRLQELEL
A0A5C5VEK8      --RSRYQEQFEEAKESSAN-SLKLMSLQEAY----------ERAVSQADVVEQRIKELDL
A0A532UTJ0      --RQAISEEDTETITVGRK-QLTIQELQETL----------EFNKETYASVVRRIQDLEL
A0A432MFP3      --QQKLDLIELADRSESVE-QLEISFAMTKL----------KQYQAMEQQVQRRLEVLRF
A0A2E2CCW9      --TKLFTQESELAKKVGNF-QVIDQSYNEEI----------AQLKSQRDNIFKQLLVERV
A0A3C0AGX3      --TKLFTQESELAKKVGNF-QVIDQSYNEEI----------AQLKSQRDNIFKQLLVERV
A0A518AAQ5      --TRLFNQETELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESIFKQLLLEKV
A0A517QBG9      --TRLFNQETELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESIFKQLLLEKV
A0A518FTU3      --TRLFNQEVELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESIFKQLLLEKV
A0A517WHH5      --TRLFDQETELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESIFKQLLLEKV
A0A5A8BGT3      --TRLFDQETELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESIFKQLLLEKV
A0A2E7K7A9      --TRLFDQETELAKKVGNY-QVVDQAYNEEI----------AQLKTQRESIFKQLLLEKV
A0A517PTS5      --TRLFDQETELAKKVGNY-QVVDQAYNEEI----------AQLKTQRESIFKQLLLEKV
A0A6I6AH34      --ARLFDQETDLAKKVGNY-QVVDQAYNEEI----------AQLKTQRESIFKQLLLEKV
A0A517VTK3      --TKLFDEETELAKKIGNY-QVVDQAYNEEI----------AQLKSQRDNIFKQLLVEKV
A0A517WQT4      --TKLFDEETELAKKIGNY-QVVDQAYNEEI----------AQLKSQRDNIFKQLLVEKV
A0A517VID8      --TKIFDQETELAKKIGNF-QVVDQSYNEEI----------SQLKSQRDNIFKQLLVERV
A0A517RK10      --TKLFDQETALAKNVGNF-QVVDQSYNEEI----------AQLKSQREDIFKQLLLEKV
A0A518IH18      --TKLFEQETALAKKVGNF-QVVDQSYNEEI----------AQLKTQREEIFKQLLVEKV
A0A5C5XLF4      --QKLFDRSADQAKDFAQY-EEREQTLSDEL----------KRIKSLHDIVANRVEVLSL
A0A2D5NDU9      --LPLLADAEREVLAVSEH-ELEYNQLNSRA----------ERTKQTLDNAYAQLQRINI
A0A1P8WP26      --GQDIRAEKTQAMELSMT-LREIQDINREI----------ERRHEYRASLTDKMDLIDL
A0A3L7V1F3      --RAQLDTEKNKAQRLGQI-LADLARNEREN----------LRLSERIQEYQNQVDGIGI
D5SZ21          --SAQFDIERQNALSLNGE-LAKLEILQMDT----------KRLRAFYDLVLERIRGIDL
A0A286RGB6      --QKEVENVRRSAETFGKG-SIEVEFLRAEV----------ELARKTLQTIAEERNRLAI
A0A518CHE5      --KESYLSEEEKGRESTLV-MLKIKQLETHQ----------TRIMAQHDTLLQKIREVDL
A0A1V5N3W2      --RDTLTKENADTIDLGRK-QLAIQEQQDQL----------ALNQELYETIRRRIQELEV
A0A3E0MY27      --QEQSKTLQQRINELTVF-KPELERRKDEL----------ERLESVSNELGLRLQKLQL
A0A7C4Z5R7      --REDVQERKAALARLHEKPSAEWESLRGEV----------ARAETSLQRVGAEMQALKM
A0A2E0X9P6      --AERLEEQLAELKSGGAQ-SAQLEFAKAEL----------AREEKVFELIAARKLALQT
A0A286RLF2      --QAQYELARQEAANLAGG-LAQLEMLKNDI----------TGLRELYGGLVRRITSLDL
A0A517NSK8      --VRRSEAELVSAKKLEEE-EMMAESLKLEL----------VRKQALYEKMSDTLSELNF
A0A5C5Z0D6      --IRRSGAELILAKELEQV-EMQTETMRREV----------LRRQELFKDTQDTLKELNF
M5UE94          --QTRSEQELKLAKQLEQA-EVQAESMRRDL----------ERRQAIFDDTQSTLKELNF
A0A2E8FLY0      --RQDFERENRIVSSYEFQ-MSRIKLLNFDL----------ARKRELAVALIDQINRTDL
A0A3D2U1E1      --RDDFNRESQVVSSFEAL-MGRIRLLNFDL----------ARKRELAIALATRISRTDL
E8R3W3          --QQDLQQQTRLLVTHNSN-SFKIEQIKEEL----------NTADRISELLSNRIEEMRV
A0A5C5ZM48      --RKSLEAEQRKRRDNAGG-LLEVEFMRAEL----------TLAEEMQQEVASRITRMQV
A0A5B9WF77      --TELYKKFEVTQKDSHAD-TVQAAFLNTEL----------ANLTTAGQQIERRLLQLKF
A0A518BBX8      --DELYKEEYDEARKIAAY-DIKDEAFRKEI----------DQTQQLYDSIITRLQDAGL
A0A1P8WN28      --KHEYSVVEADALELSGK-LAGIQVAEREV----------ETLRELHSSLLKRLNSINP
A0A3B9CTT0      --QEEYNEVRAEALNISNK-LASIDFKEREI----------ESLTELRSSLLNRLNSIKI
A0A518ALT3      --EIRRQEHVAELEKGGAR-SAELDIVKSEL----------EREQNVFELISARKLALET
A0A3M1QRP3      --EAHIARKQKEFTSTFES-AGALSKALREL----------QTMREQYEQIRRTRQQQEI
A0A517TMV0      --TESFAAARAEASKQSGD-LVRVEMLQREI----------NRIEEHNKLSYEKMQSIDL
A0A3E0MY88      --RAAFAEAKEDAVRLNRD-LHEIQFLEREI----------GQLSNLYGALADRIASVDL
A0A5B9QF68      --SASFEEARQEAAKHSGD-LVQLRMLEREV----------TRLEAQYDLLFEKISTVNM
A0A5B9QGF0      --SASFEEARKEAARHSGD-LVQLHMLEREV----------TRLEAQYDLLFEKISTVDM
A0A5C6CK24      --SDSFEEARQEAAKHSGD-LVQLRMLEREV----------TRLEAQYDLLFEKISTVDM
A0A2E3RCU8      --HASLEEARFKAVTHQRD-TAHITMLEQNV----------MRLRRLHDAIIDQIASVDL
A0A1C3E6N1      --SAQFDIERQNALSLNGE-LAKLEILQMDT----------KRLRAFYDLVLERIRGIDL
A0A518GJT2      --STQFDIERQNALALNGE-LAKLEILQMDT----------KRLRAFYDLVLERIRGIDL
A0A2E8B0L9      --EREYVAAEASAIRLNDR-HAELSIVESQV----------QRLSNVHDMLLDRIANVDL
A0A5Q4GFE7      --DLQYEQAESEAVMLNDR-MAEMKMIEHDL----------ARMRNLHDTLLNRIANIDI
A0A257WS34      --RLQFDQAHAAALAMNSQ-LAELERIESDV----------KRMRTYYDHVLDRIKDIDL
A0A7C4LP10      --RQQFDQAHAQALALNST-LAELQRLENEV----------SRIRKYYDTILDQMKNVDF
A0A517MLW3      --RKEYDTLEKEVVAMNGS-LSEMLLSQREV----------DRLSRAYDALLEKIHGVDL
A0A5B9QVD0      --AAEYEALEKEVVAMNGN-LSEMLLTQREV----------ERLNRSYDTLLEKIHGVDL
A0A3A0DET7      --QAAYDASFAAATQASSL-LVQLNSLQEAY----------ERTANMCDILDERIKEVNL
A0A3B8PNV4      --RQDFERENRTVSSYEYQ-MSRIKLLNFDL----------ARKRELSVALIDQINRTDL
A0A3D1DR40      --RQDFERENRTVSSYEYQ-MSRIKLLNFDL----------ARKRELSVALIDQINRTDL
A0A2E7RYU8      --RQDFERENRTVSSYEYQ-MSRIKLLNFDL----------ARKRELSVALIDQINRTDL
A0A3B8LXG8      --RQDFERENRTVSSYEYQ-MSRIKLLNFDL----------ARKRELSVALIDQINRTDL
A0A286RD13      --LEQFEKEAAEAEQLGKY-SADLEAERAEV----------ERLKAIAARMGDELERWNI
A0A2E3GWX1      --TTRFNHEKTLAADMNQR-LVLLQMAERDL----------ARLQSDYDMLRERINALDL
F0SG60          --TTRFNHEKTLAADMNQR-LVLLQMAERDL----------ARLQSDYDMLRERINALDL
A0A2E9VST2      --YQRFMQEKQVASQMNQR-LMMLQLAERDL----------SRLQNDYDMMRDRINTIDL
A0A356A6X2      --YQRFMQEKQLASQMNQR-LMLLQLAERDL----------SRLQSDYDMMRDRINTIDL
A0A5C5XLM3      --YQRFMQEKQLASQMNQR-LMLLQLAERDL----------SRLQSDYDMMRDRINTIDL
A0A7C5FXU1      --EKEVEAARREAEQFGVR-SLDVEMMRAEA----------RVLENLLQRIGDERQKLAI
A0A3M1VCL4      --VEQFEQLKKQAIELNNR-HLQMEILSLEL----------NRLRSLNDLFLERIKELDL
A0A5C5V7Z9      --SSSFDEARIEAAKQSGE-LVELDMRSREV----------ERLESLHDVLFEKIAAVDI
A0A5C5YT05      --AESFEDARVNAARQSGD-LVELDMRKREV----------ERLESLHDVLFEKIAAVDI
A0A518D7F9      --TDSFEAARAHALEQSSG-LIRLSMLERDV----------ARLEKLHDVLFEKLETVDT
A0A5C5ZIP0      --DHSFELARDEAARQSGD-FVKLEMLSREV----------ERLEKLHDLLFNKIATVDI
A0A518KBK3      --EEAFQVARADAARQSGD-LVKVDMLDREV----------ERLEKLHDLLFEKIATVDI
A0A5C6AKF9      --AEAFEVARSEASRQSGD-LVKLEMLNRDV----------ARLEKQYDAVCDKISAIDM
A0A6M5Z0K7      --NAQITNLGIDAIEVENK-RNRIARAEQFL----------GMIWEQKERLTLEIQGDKT
A0A350CI62      --GERLAAEQAKAQKLSQT-LTELGDLDRQI----------EHLYDQQKSLQSQSDGIGL
A0A4P5WQK6      --GERLAAEQAKAQKLSQT-LTELGDLDRQI----------EHLYEQQKSLQSQSDGIGL
A0A3C1X4W5      --SERLAAEQSRAQKLSQT-LTELGDLDRQI----------EHLYEQQSSLQSQSDGIGL
A0A3D3W3A7      --SERLAAEQSRAQKLSQT-LTELGDLDRQI----------EHLYEQQSSLQSQSDGIGL
A0A518DRX3      --LVEYQSSEAEAVSLNDR-VAALQLVDNEV----------QRLRRLHETLLNQISKIDI
A0A518DZF9      --LVEYQSSEAEAVSLNDR-VAALQLVDNEV----------QRLRRLHETLLNQISKIDI
A0A518AKT8      --EAAFVAARTEAAKQSSQ-LVELRTCERDL----------VRLENLHDSLIDRLDSADI
A0A5C5ZR72      --REKYEAELAKVQEGGGK-NVELEFAKSEL----------AREAKVFEMIASRKLALQ-
A0A7C5R0U3      --MESYQVAEREAAALQDR-WSEFQLVQHDL----------ELLRKLHDTLVNRLAQLDL
A0A517TY85      --SEKLAAHVKERESGGAQ-SAELEFKKSEL----------EREESVFELIAARKLALQ-
A0A5B9QEI7      --SAKLAEQMNELKSGGAQ-SAELEFAKAEL----------EREESVFELIAARKLALQ-
F0SI78          --DNLFLSERTHSSNLTMD-ENRGRVLREDL----------NRTKKLYDVVLEKLQEISL
A0A517MDV3      --KEEIAKEESDSVDLVDD-ELRDQEIRDEL----------FATKQLQLAVIDRLRQLNV
A0A518IQ30      --EHEYALAEAEAVKLNGR-MTSLQLVENEL----------QRLRNWHDTLLNQIANIDL
A0A517LWP4      --EREYAIAEAEAVKLNGR-MTSLQLVENEL----------QRLRNWHDTLLNQIANIDL
A0A518JNW8      --EREYAIAEAEAVTLNGR-MTSLQLVENEL----------QRLRNWHDTLLNQIANIDL
A0A2E7ENQ5      --EREFQIAQNQAVEVNGK-VARVAIIEHDL----------RMLRELHDTLRNRIANLDI
A0A7C2KUQ9      --VADLEKEQELHRGTLTS-SQALEREMAEV----------SRKQGLYESAVQRLSELDI
A0A7C5BZF0      --SQQYEEAQSEAVALTGT-LARIDILAREV----------EWLRNLRQALLQRITDIDL
A0A1G3AQE9      --QEDFQQAQNRAMEIDGQ-VARLDNLDREV----------ERLRRLHDVLCDRINDLDL
A0A3L7UQT9      --QQQFDREKSEVANHNTL-MANLIIVEMER----------NRLQANDESLLKQIEKLQL
A0A4P5YBU2      --QQQFDREKSEVANHNTL-MANLIIVEMER----------NRLQANDESLLKQIEKLQL
A0A7C7V5U8      --RRQCEDAQRAATHLTSR-LEEIRNLQRQM----------DQLWAQQDWLLQQIEDIRL
                                                                            

A0A5S9IPR9      -QRSYQFD---ILNPIDSAGIPGRPFS--PNRTQNYLVGTFLG-VMLGVIFVFLIEFLDQ
A0A533Q9U4      -TEDLKTS---NIKVLDHAEVPIKPIK--PKKALNILLGIIAG-LGCGVGIAFVMEYMDN
A0A1U9NNE1      ESQRPARV---SVAYYASSVIA-------KDKRQKLAIVAVLGSICCGGFLGVMIDRSDK
A0A2G2JCA2      -EQRAPS----RVALLPEIPVPTVPIE--KLPYKNMLMIFMVG-LAAPFGLAVLKEALTV
A0A533Q6B7      -AEDFKVS---NIRVIDYAEVPLGPYK--PNKSINTLVGIITG-LACGVGIAFLMEYMDK
A0A5S9IJB5      -DKDSQGEEE-NIYIASPPRIPKTPIW--PKTLYILVGAFLFS-CFSGLGLCFALEFLDN
A0A1G2XVR0      -AGDLQTS---NVSILDPAMEPRTPIG--ASRNSQIMKGVMIG-LALGIGLAFFLDYLDN
A0A1G3B0P0      -AGDLQTS---NVSILDPAMEPRTPIG--ASRNSQIMKGVMIG-LALGIGLAFFLDYLDN
A0A1E3X4X0      -TGALKTS---NIRILDAAVVPRHPIK--PRVKLNIILAIIVG-LTLGVGLAFFLDYLDR
A0A286U4B3      -SSQIKTT---NVQIVDRAALPTRPVK--PKKRLNVFLSMVVG-LVMGTGIAFFLEYLDN
A0A5C6DDS2      -SSEIKTT---NIQVVDKAVLPTTPIK--PKKKLNVLLSMIVG-LTLGTGIAFFLEYLDN
A0A2E3GW02      -VDETSVL---TATVVNHP-SDGSEVR--LKVFNYAGMGGMGG-LAIGMLVGLLLEYSDK
A0A5B9QNZ7      -MQSYGGF---VTEILRAP-EFGELAW--PILPLVLAAGLCFG-SLLGGGLALLVDLGDR
A0A1Z8N7H5      -RQGHGEI---QATIIKDATASGQIVS--PKISRIIVCWILGT-LGIGFVLVYVQDTIDD
A0A1G2YPI3      -TEDVGAL---NISILEYARPADKPSK--PEKAKYMAMALVMG-LMLGGGLGLLRDFMDQ
A0A1U7CZ81      -AGTTD-V---DVGLIDAAIAVSEPTN--NKRIKYVVIVPSVI-LCLVLGLFALLEVKAE
A0A142YNY8      -RTDRDMV---RVSLYDRAAVPRVPSS--SKRIKLMAAAPMGI-MALVLGIFSLLEVKAE
A0A1U7GLS6      -STNKDMV---RVEQHDPAVPPKRPSD--DKRLKLMAAVPVGV-LAVLIGLFSLLEIKAE
A0A532UIN2      -TEDVGAL---NISILEVARAADKPSE--PEKAACLAKALIMG-FMLGIGLALLRDWMDH
A0A0S8KNX5      QRKRPARI---SVAYYADI----ARVL--DKRVKYSAALVFTA-LVCGMGLAHLRDKADQ
A0A3D3UVZ8      QRKRPTRI---SVHYNADI----ASIN--DKRVKYSVALVFGS-LVCGMGLAYLRDKADQ
A0A517NFU9      -SRSYAGF---STDLLESPEVSQSAAW--PKLPIIAAIGLFLG-MTLGLLLAVGSELMDS
A0A5C5YWH4      -SRSYAGF---STDLLASPEVSRGAAW--PKLPIICALGLFLG-AMLGLALAITTELLDS
A0A3D2TNK4      -RQNQAPI---RATVVREPIANNNPVT--PQIRLIAAVCLLGG-TCVGVVMAYAQDVLAD
A0A7C1Y4F0      TAQDVESL---RISILEVARAADRPSK--PQKAKVMAMALALG-LLMGGGLAFLRDWLDF
A0A6I0ENW6      -ELISGPA---RIEPAGQVKVSSRPKN--DRRPLFSGVLVFGW-LAAGLALAYFRAAMDP
A0A6L3A0B7      -ELISGPA---RIEPAGQVKVSSRPKN--DRRPLFSGVLVFGW-LAAGLALAYFRAAMDP
A0A0J1B4A0      -TNDYSGF---STDLIVMPLPASVPVW--PSRTKIAALGILAG-GMLGLALALLAEMTDR
A0A142WSB9      -SRSQEGY---KVSQLSQV-RIERSLK--QVLKVFGACGLL-G-LISVFALAYVREWYDT
M5SZR3          -SRDYGGF---KANVISPP-GFSWKVK--PEALIVFPMAIFVG-TFFGFGLACLAELANR
M5TW92          -SRDYGGF---KANVISPP-GFAWKVK--PEALIVFPMAIFVG-TFFGFGLACLAELANR
A0A2S8FKY2      -ELR-GAP---RITLLSEAKTGTVTDK--KKPIMITAAAALAG-FVLPGGLLLLRDFRKK
A0A517N8P6      -PGMNSGL---HVKVLRPA-GLGMLVG--PLLSRALVMGGFLG-LVAGGALAFLWDWSER
A0A432MJP4      -VGEYSGV---VTQTIEPPHALRKAVR--PRVLLTLCMALMSG-LVLGTMAALAADGLDS
M5UQ35          -TNDYTGF---STDLLVTPSPAMLPVW--PAKSKIAAIGILLG-AMLGAALAMIAELLDR
A0A0S8FY64      -TKDVGVT---NVSFVERASPPQAPVR--PNKQVNLILGALLG-VLLGVGLAYGLEYLDD
A0A1N6KFT7      -VSDYSSI---SCQVIEPPSALPYPVQ--PRVKMTLLMGLMTG-LFLGIGLAYLADRLDP
L0DFG4          -VSDYSSI---SCQVVDPPSALPSPVQ--PRVRMTLALGLMGG-LLLGMGLALLVDRLDP
A0A5C5XXG1      -ASGLRGY---LYELLETPRI-GAKSW--PSLPLCGLGGLMLG-VFAGLTLAVANDVRDG
A0A7C7YUM8      -TAAATSA---AAVLIDPAVPPRSRSF--PRAAIFLVLGAVLG-LFLGCALAFLSHTLRS
A0A7C2AHI6      -SEAATLP---SAVLIDPAKPPRFRSS--PRLVLSLIVASILG-LAAGLLLAFLRQNLAG
A0A518BJJ1      -TRASTVA---AADFIDAAAAPDLRYS--PRIGFTLMLSSVLG-LGLGLGLAWLRESLRR
A0A518D182      -ARASALS---SADFVDRAAAPDRRYA--PRIGFTLGLGLVAG-VLAGLALLLVREHLAE
A0A5C5WTY6      -AGDTASF---TQEILEDP-RVGELVW--PKPLLCLALGLLGG-VLVGSGVGVSREFMDQ
A0A5C5Y033      -ASGLSGF---LYEFLEVP-RLGKRVW--PNVPLCSLGGLVLG-LLCGMVLAVGNELRDS
A0A5C6G1Y2      -ASGLSGF---LYEFLEVP-RLGKRVW--PNVPLCSLGGLVLG-LLCGMVLAVGNELRDS
A0A354PDV6      -ASGLSGY---VYELLETP-RPGIRSW--PKLSICALGGLMLG-LFGGLFLSIANDLRDS
A0A5C6FZ02      -ASGLRGY---LYELLETP-RIGAKSW--PSLPLCGLGGLMLG-VFAGLTLAVANDVRDG
M5TIT3          -ASGLSGY---LYEFLEVP-RLGVKSR--PKKSLCALGGLMLG-LFMGLSLAVANEIQDG
A0A5M6CY44      -ASSLSGY---LYEFLEVP-RVGEPVW--PKLPLCAVGGLALG-LCGGLALAFGTDVRDR
F2AXG2          -TSELTGY---LYEILSIP-RTGEKSW--PKLPLCGLGGLMLG-LFSGLFLAVANDVRDG
M2BB46          -TSELTGY---LYEILTIP-RTGEKSW--PKLPLCGLGGLMLG-LFSGLFLAVANDVRDG
L7CLQ6          -AKGLTGY---LYEFLAVP-RTGEKSW--PKLPLCGLGGLMLG-LFSGLFLAVANDVRDG
A0A0J1B719      -ASGLTGY---LYEFLAVP-RTGEKSW--PKLPLCGLGGLMLG-LFSGLFLAVANDVRDG
Q7UF18          -ASGLTGY---LYEFLAVP-RTGEKSW--PKLPLCGLGGLMLG-LFSGLFLAVANDVRDG
A0A2G1W1E0      -ASGLTGY---LYEFLAVP-RIGQKSW--PKLPLCGLGGLMLG-LFSGLFLAVANDVRDG
K5E235          -ASGLTGY---LYEFLAVP-RIGQKSW--PKLPLCGLGGLMLG-LFSGLFLAVANDVRDG
A0A5C6FFI9      -AGSYAGF---STDLLSNPEPAKSPAW--PRLPIVLVLGSFLG-FFLGIATGISAELLDT
A0A5C5WDJ1      -SRSYAGF---STDLLASAEVPMNPVW--PRLSIVLAIGLVNG-AILGLILVVAAETLDS
A0A5C5X547      -ESKGQSK---RIEVMAYATRAQKDDP--KKQIALTIGVGLAG-LFAPLILLMWRDITKQ
A0A353FIP5      -AAGAAVE---AISIVDWAVPPLLRAS--PRLTLSSLAGILLG-LFLGSFFALWRESSQK
A0A5B1CIK7      -ASGLSGY---LYEFLEVP-RLGEKSW--PKLPICGLGGLMLG-TFGGLFFAVANEFRDR
A0A5C5WHS2      -ASGLSGY---LYEFLEVP-RLGKKSW--PKLPICGLGGLMLG-LFSGLVLAVANEVRDR
A0A5C6B6G8      -ASGLSGY---LYEFLELP-RIGRKVW--PSLPICGLGGLMLG-LATGVFLAFANEIRDG
A0A5C5ZZN3      -ASGLSGY---LYEFLEVP-RMGVKSW--PKLPLCALGGLMLG-LFGGLFVAVANDVRDG
A0A5C5XS91      -ASGLSGY---LYEFLEVP-RRGEKSW--PKLSLCGLGGLMLG-LFSGLFLAVANDLRDG
A0A5C6C4E6      -ASGLSGY---LYEFLEVP-RRGEKSW--PKMSLCGLGGLMLG-MFSGLFLAVANDLRDG
A0A2E1VVJ1      -AQAATIE---QVEIIDRALPPRLRAL--PNVRANLVVGILLG-LAIGSILALARESFTR
A0A3M2AEL0      -TEAASLA---TVDVIDWAIPPDSRSR--PILAMNTALGLLLG-LVAAFALGLYREGRVR
A0A2A2W9R6      -TNDYSGF---STDLLVMPAPANFPVW--PSKSKIAIMGVMGG-IMLGLGLAMLAELADR
A0A518HKC1      -TNDYSGF---STDLLVMPVPASLPVW--PAKSKIAMMGIMGG-IMLGLGLAMLAELADR
A0A518L3P0      -TNDYSGF---STDLLVMPVPASLPVW--PAKSKIAMMGIMGG-IMLGLGLAMLAELADR
A0A255R1S0      -TNDYSGF---ATDLLVQPVPARFPIW--PSKSKIAMAGLMAG-GMLGLALAVLAELIDR
A0A5B9MKP1      -TNDYSGF---STDLLVMPVPASVPIW--PSKSKIAMMGIMGG-LMLGLGLAMLAELADR
A0A0S8J591      -YRSYEDI---KARVISQADIPKGKFS--PNPALNLPLGLVVG-LMVGIIAAFFFEYLNT
A0A351FYP6      -DLDLPKTS--SVEIIDKADTPLRAVR--PNVPLNISLGVIVG-LILGVGLAFFIEYLDT
A0A532UT69      -TEETGAL---NISVLELARPANAPSE--PQKTRYMATALLAGLML-GGGLALARDWMDQ
A0A2D5AWU0      -ENQTGAL---NILVIDYGRPSNTPAS--PDRVSMMAYALAGGVGL-AFAIVMLRSFSDK
A0A1G2YQB7      -ERK-------RLARISVAYLASTAPY--QDRRMQFSIALMMAGCVSGMGLALLTNKLDV
A0A353P687      -ERK-------RLARISVAYLANTAPY--QDRRMQYSLAITMGSLVFGLGLALITNKLDL
A0A356EME5      -ERQAPA----RVVLFDEATPPDAPLV--EIPLAKMGLAAMVAFCV-PFGLALGWERIVR
M5RT57          -ESRAPG----RIVLLQPAEPTLHPVA--SFPLRNMAIAAFLSGCL-PFGLALLWELSTK
A0A356KTN1      --LHAAPLAVANARIIDRAKGAWRVRP---SHSRNVILGLLFGFGL-GAVIALIFERLSD
A0A518HFS8      -ELEAPP----RIRLLEPAKPQGPADP--MERYKFCAMAAVASMGA-FVGLVSLWEFRAQ
L0DC26          -ELQAPP----RIRLLEKAELPHTKDE--IRQIKMAGMAGCGAFAL-TLLGISLWETRAR
A0A3L7P4E4      -AVKAGYH---RTQVLAPATR-GYQVE--PNFQKCIIVGSVAGIAV-GLLLGLLVEAADK
A0A3L7PEB5      -AIKGGNY---RTQVLAPATR-GVQVE--PNFQKTMIMGSALGVLV-GLLLGFLVEAADK
A0A1U9NL64      -TEDVGAL---NISILEVARAPKDPSK--PQKARVAAMALVLGLMA-GGGLALLRDFMDK
A0A2N1UCJ3      -SEEAGAL---NISILETARPAEFATS--PKKAPTLAASLILGLLF-GLALAITRERLDW
A0A7C4EK84      -TGNTGAL---NISILETAQVPDRPVK--PHKSRVAGMALVLGLML-GIAAALAVEWTDQ
A0A7C3F0T2      -NEDTGLL---NITILEVATPAGAPSS--PNRQRTMAMALLVGLMV-GIGLAVALDWMDQ
A0A2E0X4J3      -TEKVGAT---KVNIMEVALPALEPSY--PSRPKFLAAGVMLGSLM-GFGLGWLRNLLDH
A0A5C5YU10      -NKKVGAM---NVSIIETASAPKLPTY--PSRAKFLGAGVMLGALS-GFGLAWLRDMLDH
A0A517MPZ6      -TEDVGAM---NVSIMEVARASSEPTY--PIPARFLAIGALLGGLT-GFGLAWLRDLMDH
A0A5C6CNV7      -IEDVGAM---NVSILEVAGPTTVPTY--PNRTRFLGVGGLLGGLV-GFGLAWLRNLMDH
A0A518K5H4      -SENVGAM---NVSILEVATP-GIQTF--PGRRKTLSLGLAFGSML-GFGLAWLRSMLDQ
A0A5C6AA28      -SEEVGAM---NVSILEVAGP-GMQTF--PDRPKTLSLGLAFGAML-GFGLAWLRNLLDH
A0A2E7ESJ6      -VSDYEGY---NYQTLAKPTVGDKVA---PLLLKVMPIAALFG-VVVGFGIAYLVDVADK
A0A2E9VK20      -APDEGYQ---LTQISPSRAEPDI-----KHVIKIVGGCLVMT-LMSTYAFLFLREMRDT
A0A3D4PJK1      -APDEGYQ---LTQISPSRAEPDI-----KHVIKIVGGCLVMT-LMSTYAFLFLREMRDT
A0A355AI52      -RQENGGV---RTTVVREPVVAERPVS--PKLSLTILAVLTGG-LASGIGIIFVIDTLDD
A0A354PCQ3      -ERRQDG----AVRTLTLATPPSSPVTALPVKHMGMAASAAMM-VPFLFGLLW-----EL
A0A0S8GZ23      -KRQRPA----RITISDEASTGPP-----VTKREKLLAALAIGALALGISFALLMGKIDK
A0A1I3DDV4      -AAGLSGY---IHEVLEEPQAGEEVW---PALNICVAGGMFLG-LCLGVLVAICNDQFDN
A0A2E0SMM6      -D-DRAEV---LAKIVKKPEISRDPIS--PNKVRTALFSLIMG-ISLGVGVIVVLEALDD
A0A3L7SI46      -GADSG-L---KISVPTVAKVVPSAVA--PKISTTVFLCTLFG-LMSGMAIIYVIDVLDD
A0A5B9PJZ8      -LKDFKWR---KMSELNPASVAEQVA---PSLPLCLGGGLFLG-TLLGFLFAGVKEMAEK
A0A2S8G191      -EL-KSDS---RVTFFQDAQPPKSKN---PRSFAKIGMFGFAG-MMIPVAGFVFWDLRSQ
A0A2E7EGG1      -EM-YAPS---RVELVQKATTPEVPVQ--NLPWKMLLVSVLAS-ISLPFGLFLIWERTLK
A0A2E2N5A9      -TADQNSV---NVHVVDRAMVPEEPVK--PNRPLIVAVAGLIA-LFFVAGTGVVKDVLND
A0A7C8AGA2      -ERKRPAR---ISVAYQASSVPA------QGKRRKLAAALGFGGLALGAILALLLDKADK
A0A7C2FXP7      -EKKRP------ARISVAYKAEVIPIT--DKRIKLTLAALMGA-FALSFMAALLRDKADT
A0A2E3GWC6      -AHDEG-------YQLQQISPSQAELD--FKRILKIVGGITIMLLVATYGLLFLLALRDT
F0SLB0          -AHDEG-------YQLQQISPSQAELD--FKRILKTVGGITIMLLVATYGLLFLLALRDT
A0A3L7NDH9      -RQEHGGV---KMSVVREPLVPSKPVS--PNLLLTLVAVLVGG-GAVGIGMIVVVDVLDD
A0A1N6DAJ8      -ELQAPP----RIRLLEKAELPRTKDE--IRQIKMAGMAGCGA-FALALVGVSFWEFRSR
A0A532UD06      -TEDTGAL---NISVLEVARPARNPSE--PQKRKIMATALALG-LVFGTCLAFLRDWIDY
A0A660URN1      -TEDVGAL---NISILEVAYPAIHPSR--PQKAKIMMAALVLG-LMLGFALALVRDWMDY
A0A517ZCB5      -NKDNH-L---RTAVISEPQVNPVPVS--PRLTVVAMLCLIIG-TGGGLATVYLMDIIDD
A0A225EH48      --LDRSDS---RIQLRQPAVVSQLLNI--QKKILCGIAAFFAGFLLIALAVAFL-EWRSR
A0A518INW8      -TSDYAGY---TIDLLSPPGPGSLVW---PVLAKILLNGGLAG-LLVGGLLAFWAEHADQ
A0A518JPH9      -TSDYAGF---TIDLLSPPGVGGQIW---PKLSKILMNGALAG-LLVGGLLAFWAEYADQ
A0A5C5VEK8      -TT-QAPV---NVSIIETASVAPDPSY--PSRPKFLGAGVMLG-ALCGFGIAWLRDMLDH
A0A532UTJ0      -QRDRPK----RISVYYHADVANI-----NDKRIKLSVAVIFGALVCGMGLAYLRDKADL
A0A432MFP3      -ESRPAD----TITVIDPATPGLMLSN--KRDKFLALTPLAM--LGLVLGLVTLVELRSG
A0A2E2CCW9      -SQGNSGY---MLTQLAPVKDELVI----KRQLKFLMAGAAGG-LGLILAFSYFREMRDT
A0A3C0AGX3      -SQGNSGY---MLTQLAPVKDELVI----KRQLKFLMAGAAGG-LGLILAFSYFREMRDT
A0A518AAQ5      -AKGNSGY---TMTQLSPVKDELVI----KRQLKFLMAGGAAG-LGLVLALSYFREMRDT
A0A517QBG9      -AKGNSGY---TMTQLSPVKDELVI----KRQLKFLMAGGAAG-LGLVLALSYFREMRDT
A0A518FTU3      -AKGNSGY---TMTQLSPVKDELVI----KRQLKFLMAGGAAG-LGLVLALSYFREMRDT
A0A517WHH5      -AKGNSGY---TMTQLSPVKDELVI----KRQLKFLMAGGAAG-LGLVLAFSYFREMRDT
A0A5A8BGT3      -AKGNSGY---TMTQLSPVKDELVI----KRQLKFLMAGGAAG-LGLVLAFSYFREMRDT
A0A2E7K7A9      -AQGNSGY---TMTQLSPVKDELVI----KRQLKFLMAGGAAG-LGLVLAFSYFREMRDT
A0A517PTS5      -AQGNSGY---TMTQLSPVKDELVI----KRQLKFLMAGGAAG-LGLVLAFSYFREMRDT
A0A6I6AH34      -AQGNSGY---TMTQLSPVKDELVI----KRQLKFLMAGGAAG-LGLVLAFSYFREMRDT
A0A517VTK3      -SQGNSGY---TLTQLSPVKDVLVI----KRQLKFLLAGGAVG-LGLVLAISFFREKQDT
A0A517WQT4      -SQGNSGY---TLTQLSPVKDVLVI----KRQLKFLLAGGAVG-LGLVLAISFFREKQDT
A0A517VID8      -SQGNSGY---ILTQLAPVKDELVI----KRQLKFLMAGTAAG-LGLILAFAYFREMRDT
A0A517RK10      -SQGDAGY---TLTQLAPVKDELVI----KRQLKFLMAGGAVG-LGLVLAISYFREMRDT
A0A518IH18      -SQGDGGY---TLTQLAPVKDELVI----KRQLKFLIAGGAVG-LGLVLAISYFREMRDT
A0A5C5XLF4      -ASDEGYQ---LTQISPSRAEPDI-----KHVIKIVGGCLVMT-LMSTYAFLFLREMRDT
A0A2D5NDU9      -DPDSGKT---VAHVLDYAEPNEAKLA--SGQPIRLPTGILLG-LLAGIALAWFQGMLDT
A0A1P8WP26      -TGDTF-I---RTEISSPPRVNQLPVS--PRPVIVGFLSIFFG-TAGGLGIIWVLDIMDD
A0A3L7V1F3      -NKDKM-V---ITSIPRKPTLSTRPVN--PRLAITGILSLMLG-SIAGLGIIWVLDIMDD
D5SZ21          -GKDKG-I---RTAVVGEPKVNPRPVH--PKLSLTVAVSLMAG-ISLGLALVYLADLLDD
A0A286RGB6      -ELRAKP----RITVVQRAEVPRVADS--DRRIQLAIMGGLAG-FILPGAVLLWWDVRRK
A0A518CHE5      -D-DRASV---LAKTVKKPEISRYPIS--PNKIRTAMFSLILG-IAMGIGVIVVLEALDD
A0A1V5N3W2      -ERKRPAR---ISVAYNASSLPL------PSKRIKLMGAALFGALAAGIFLAFVRDKADK
A0A3E0MY27      -ELSVQKP---KVSLRGEATVPAMYDS--SNRDRYTVLAALAG-FGLAIVGVSLYEFQFR
A0A7C4Z5R7      -EP-PLPA---RVNLMEKAEPPQTNSR---DKTLRLAGAAGVGVFGLVFLAVAFLEYRAR
A0A2E0X9P6      -ELDAPD----RITLKQSAAVPARPLN--PIPYELLLVVCAAS-LATPFAVGALREVSVR
A0A286RLF2      ----AGDL---RASVITEPRENRSPVS--PSLPRVLIMVILGG-LTLGMFVVYVMDVLDD
A0A517NSK8      -VRDYAGF---DTDVIGDADIQEQSSW--PDPKIVLPLGMIAG-LALGVMLAFIADLCDT
A0A5C5Z0D6      -VRDYAGF---STDVIGDAETQRRPSW--PNPLIVLALGIFAG-GLLGFGTALLADVMDT
M5UE94          -VRDYAGF---STDVIGDAESQERPAW--PRPLIVLALGIFAG-GMFGMGMALLADLMDT
A0A2E8FLY0      -GKERGGL---RTKIVSQPKAAKSPVT--PRLLVVALCALTTG-LGLGLGLIYVLDYFDD
A0A3D2U1E1      -GKERGGL---RTKIVSQPKVAKAPVS--PRLLIVAFAAIVGG-LGSGLGLIYVLDYFDD
E8R3W3          -ELDAPP----RITLINPADAVRIVGD--PTKRLKLSGMIGAGVFFASLVGIALLEFYSN
A0A5C5ZM48      -ESQAID----RVELLREGEIEQTPVV---GMPWKKMAAAALGCWFLPFAVALIAERSLR
A0A5B9WF77      -TQDKSAV---TIPRIDRAKAPRDSFNN-KRLKFMAIVPVVV--LGALLGLFLLLEIRAE
A0A518BBX8      -VTQSGGY---EAKIIAPPELGEQVW---PMAIIIFPVAGLLG-IMSGLGLVYLVDMADT
A0A1P8WN28      -DHGSGAF---KVAPLSDPRIPKFAVY--PVLTNTLVMFCVAA-VALALGVIYVIDLMDD
A0A3B9CTT0      -SENATHF---KVAVLSDAMVPRTPSL--ESLNSRLIFYCVLA-VMAAMGVIYVLDLMDD
A0A518ALT3      -ER-GAPT---RASLMHTASPPRLSIE--PIPFKLLAIACLSA-LIAPLGLATVREVVVK
A0A3M1QRP3      -ERFAPAS---IRKIADARPSGAADVDKRPKLSLAAVFGAAFAGLLAGLARAYFTGALFE
A0A517TMV0      -QQVSAPI---QTTIVEEPLPSERPAS--PQLRMVLAASLLGG-LVLGVGVVYTQDLLDD
A0A3E0MY88      -AKDQGDI---RSEIIKEPAASRVPVS--PRLKTVAAACLFSG-LVIGGVVIFVLDTLDD
A0A5B9QF68      -RQMQAPI---QATVVREPVPDRVPVS--PQIRFLVFFCLASG-TAVGAVIVYVQDVLDD
A0A5B9QGF0      -RQMQAPI---QATVVREPVPDRVPVS--PQIRFLVFICLASG-IAVGTAIVYVQDILDD
A0A5C6CK24      -RQMQAPI---QATVVREPVPDRVPVS--PQIRFLVFICLASG-TAVGTVIVYVQDVLDD
A0A2E3RCU8      -RHGEGEI---RATIIKEAAASGQIVS--PRLSRVIVFWFLAT-IGIGFALVYVQDTIDD
A0A1C3E6N1      -GKDKG-I---RTAVVGEPKVNPRPVH--PKLSLTVAVSLMAG-ISLGLALVYLADLLDD
A0A518GJT2      -GKDKG-I---RTAVVGEPKVNPRPVH--PKLSLTVAVSLMAG-ISLGLALVYLADLLDD
A0A2E8B0L9      -NSEGGDV---RVSMVNEPKANERPVS--PRLALTGILSLIGG-LGIGCALVYVMDLVDD
A0A5Q4GFE7      -GHSRSDV---RVAVVSEPKASDRPVS--PKLPLVAMLCLVGG-LGIGLALVYVIDVLDD
A0A257WS34      -GADDG-L---RIRVVSEPRVNEQPVS--PKLSTTGILCLFLG-TTLGLGVIYLRDAIDD
A0A7C4LP10      -GADNS-L---RVRIVSEPKVLLFPVS--PKLSSTGLLALALG-TVVGLGLIYVLDAIDD
A0A517MLW3      -GQDQAAV---RVAVIGKPKALIAAVS--PRLRLVVLAAGFFS-TLLSVGLVYIADLRDD
A0A5B9QVD0      -GSDQAAV---RVAVIGDPKAGMGAVA--PRLKVTAALALMLA-MGISVGLVFFLDLRDD
A0A3A0DET7      -TEEFGAM---NVSILEVAGPATIPSY--PSRARFLAVGLMLG-GVVGFGLAWLRELLDH
A0A3B8PNV4      -GKERGGL---RTKIVSHPKAAKLPVT--PRLLVVALCALACG-LGAGLGMIYILDVLDD
A0A3D1DR40      -GKERGGL---RTKIVSHPKAAKLPVT--PRLLVVALCALACG-LGAGLGMIYILDVLDD
A0A2E7RYU8      -GKERGGL---RTKIVSHPKAAKLPVT--PRLLVVALCALACG-LGGGLGVIYILDVLDD
A0A3B8LXG8      -GKERGGL---RTKIVSHPKAAKLPVT--PRLLVVALCALACG-LGGGLSVIYILDVLDD
A0A286RD13      -ELAAPPR---VRVLEEASTPRISNIN--DKYRLVSFLGLMAF-LGTGAAVV-LLDFFLR
A0A2E3GWX1      -NQ-QTSL---RTRITKHAEPNPAPVS--PRLTLTLAMSIVAG-MGLGALTVLLMDLLDD
F0SG60          -NQ-QTSL---RTRITKHAEPNPAPVS--PRLTLTLAMSIVAG-MGLGALTVLLMDLLDD
A0A2E9VST2      -NK-QSSL---RTRITKHAEPNRIPVT--PKLTSTLMLSIFAG-LFLGATTVLLLDLLDD
A0A356A6X2      -NK-QSSL---RTRITKHAEPNRTPVT--PKLTNTLLLSILAG-LFFGATTVLLLDLLDD
A0A5C5XLM3      -NK-QSSL---RTRITKHAEPNRTPVT--PKLTSTLMLSILAG-LFFGATTVLLLDLLDD
A0A7C5FXU1      -ELRSRP----RITLIQRATPPAVPDQ--ERRVQLTVLASLGG-MALPIVGILWWDVRRR
A0A3M1VCL4      -GSDSGAL---KTEVVSHPKVVPQPVS--PRLVLVALVALTLG-TTTGLGMIYVLDSIDD
A0A5C5V7Z9      -HQVQAPI---RASIVEEPLPEETPVS--PRFASLFGSAILGG-LALGAVIVFVRDQLDD
A0A5C5YT05      -HQVQAPI---RASIVEEPLPEETPVS--PRFARLFGSALVGG-VLLGAGIVFIRDQLDD
A0A518D7F9      -HQLQAPV---RVTVIEEAMPNERPVS--PQLRLVVLASLCGG-LAVAAGVVYAQDLLDD
A0A5C5ZIP0      -RQVQAPI---RATIVQEPLPSDRPSS--PQLKLVLVASLLSG-LAIGLGLIYVQDLMDD
A0A518KBK3      -HQVQAPI---RATIVEEPLPSDLPAS--PQLRLVLVASLMAG-LCLGVGLVYVQDLLDD
A0A5C6AKF9      -TQVQAPI---RATIVQEPLPADRPAS--PQLRMVLMASLLGG-LCLGIGVVYVQDLLDD
A0A6M5Z0K7      -TKSIARK---RVREVAPAEKGEILNK--FGRHIEAAGGGVFG-VLFGLLTISVLDHRRN
A0A350CI62      -NKDTF-L---STKVSSRPTVPIRPVS--PRLPIAVLLSLLIG-TGTGLAVIWVLDIMDD
A0A4P5WQK6      -NKDTF-L---STKVSSRPTVPIRPVS--PRLPIAVLLSLLIG-TGTGLAVIWVLDIMDD
A0A3C1X4W5      -NKDTF-L---STKVSSRPTVPIRPVS--PRLPIAVLLSLLIG-TGTGLAVIWVLDIMDD
A0A3D3W3A7      -NKDTF-L---STKVSSRPTVPIRPVS--PRLPIAVLLSLLIG-TGTGLAVIWVLDIMDD
A0A518DRX3      -NQNQSDV---RVAVVGEPLANENPVS--PNLKMTVLLSLLIG-LGGGAALVYGIDLLDD
A0A518DZF9      -NQNQSDV---RVAVVGEPLANENPVS--PNLKMTVLMSLLIG-LGGGAALVYGIDLLDD
A0A518AKT8      -YQSQGPI---QAVVVEDPLPELKPVS--PRIKTVFLMSVLSG-LIVGVSLAYIQDALDD
A0A5C5ZR72      -TESKAPA---RVEVMDEVMSSNVPEE--AIPWKQLFVACAMS-MVVPYGVVVLREMALR
A0A7C5R0U3      -TREQADV---RLAVVNPPVVPREPVS--PRAGTVFPMALAAG-LLVGLLSAYALELLDD
A0A517TY85      -TEQRAPE---RVFLMQVAEPPSMALE--PIPYKYLLVACLAS-MLAPLGLAVAYEALLR
A0A5B9QEI7      -TEQRAPT---RVTLMQSASPPHIAIE--PIPYKYLLLASLVS-LVTPLGLAIAYEFLAK
F0SI78          -VDETSVL---TATVVNHPSDGSEVRL--KVFNYAGMGGM--GGLAIGMLVGLLLEYSDK
A0A517MDV3      -MQGYGGF---VTEILRAPEFGEL-VW--PIIPLVLIAGLCFG-SMTGGGLGLLIDLGDR
A0A518IQ30      -QTEGGDI---RVSVVGEPVASPNAVA--PQLKVIGLLSLFAG-CGIGIAIAYITDLLED
A0A517LWP4      -QTEGGDI---RVSVVGEPVASPGAVA--PRLRIIGVLSIFAG-CAIGIAIAYVTDLLED
A0A518JNW8      -QTEGGDI---RVSVVGEPVASPGAVA--PRLKVIGLLSIFAG-CGIGIAIAYITDLLED
A0A2E7ENQ5      -RQDQAEV---RMAVVSEATASDSPVH--PRLLTVLATVIVSG-LSLGIGLAYVLDVLDD
A0A7C2KUQ9      -EGRAPG----RINVQSYADEPSEPYN--ARRSLLLTAMAICGAAALALAAAYVRVSLDQ
A0A7C5BZF0      -QQKGREV---RAFVISEPKMNPTPVS--PNWQFVLLGALGAG-VALGLAVVYVVDILDD
A0A1G3AQE9      -SREGQQI---CATLLDEPRVNRTPVS--PNLARTVLAVLTLG-LGLGLGAVYILDILDD
A0A3L7UQT9      -V-SGEGI---KVDLNKLPKAGKLPSS--PRLVLVVAVCFILG-IGGGLGLIYILDLLDD
A0A4P5YBU2      -V-SGEGI---KVDLNKLPKAGKLPSS--PRLVLVVAVCFILG-LGGGLGLIYILDLLDD
A0A7C7V5U8      -KREGADM---RAVVVTEPERIDQPVS--PSLRRVVLMVLIAG-LGTGLLAVYVLDILDD
                                                                            

A0A5S9IPR9      SIKTVEEVQQLTPARIMGFIPFISPKIFMGKTTHVVEEKE--------------------
A0A533Q9U4      TIRTQEDVEKYLKTSLLGIVGHIPLDKKDTDFTELIAHSS--------------------
A0A1U9NNE1      RMRTPTDLNKSLSTRIIGTTVCPTEVKRSELSERL-------------------------
A0A2G2JCA2      KVSGREQLELQSNTPVLAEISQLPK----------RRTMS--------------------
A0A533Q6B7      TIKTQEDVKKYFGTVLLGIVGHIPQKKKDARTMQLITYNL--------------------
A0A5S9IJB5      SVKGKDQLEKMMQRPVLGLIAEGKKNKKSQYPEVLALS----------------------
A0A1G2XVR0      TVKSTEDVENYLGVTLLGLVERAKQSK---------------------------------
A0A1G3B0P0      TVKSTEDVENYLGVTLLGLVERAKQSK---------------------------------
A0A1E3X4X0      TLSTPEDVERYLQVPLLGAVGRIEMDKQKRRSEQPTPASG--------------------
A0A286U4B3      TIKSADDVEKHLNATVLGVLEKVEVER---------------------------------
A0A5C6DDS2      TIKSADDVEKHLKSTVLGVLEKVAVDK---------------------------------
A0A2E3GW02      RFRSPEEMMQMLGVPILGHIPEMPASQKRRKRNKSGDTVP--------------------
A0A5B9QNZ7      SFRSTADIETATGAPMLGAIGAMKFRR--------NKQLS--------------------
A0A1Z8N7H5      RFRTPEELSKRVGQPLIGLVRAL-------------PELS--------------------
A0A1G2YPI3      TLHSAEDISAVLSMPVLGVVPSMSRRESVTDRGR--------------------------
A0A1U7CZ81      RVADPDALSTRVQSEVFSLPPLPMVRASNKLNGPAEDDQI--------------------
A0A142YNY8      RVGDPDQLSTRVQSEVYSLPPIPMSRSPRRLGAPGDDDQI--------------------
A0A1U7GLS6      RVGNPDALSTRVQSEVYSLPPIPMARSPRRLGAPGEDDQI--------------------
A0A532UIN2      RLHSAEEISAVLNLPILGVVPSMPR----------RLSIA--------------------
A0A0S8KNX5      SLRTPDDVAKRIGIRIIGTTTSLHTVKPALLPERI-------------------------
A0A3D3UVZ8      SLRTPDDVAKRIGIRIIGTTTSLNTVKPALLPEQI-------------------------
A0A517NFU9      TFSDVADLERTVGAPAIAHVPRFNLRKLRKLLNK-DSGVQ--------------------
A0A5C5YWH4      TFSDVHDLERTLGAPAIAHVPRFNTRDLKSKTRS-GSLIQ--------------------
A0A3D2TNK4      RFNSPEELTLQLGVPVLAMVKKL-------------DALN--------------------
A0A7C1Y4F0      RLRSSEEVSAILGIPVLGVVPKMGASKVLPMRGH-KPSVP--------------------
A0A6I0ENW6      SMSEVSDVTNTVQVPFLGQMPRFAPG---------TDALS--------------------
A0A6L3A0B7      SMSEVSDVTNTVQVPFLGQMPRFAPG---------TDALS--------------------
A0A0J1B4A0      TFHDPAEVERIVGASILAHVPRLKESALKKKVKE-GSGIS--------------------
A0A142WSB9      SVRSVDEVRQLTGAHVLGIVPHFQKRNQN--SAMAHTGIS--------------------
M5SZR3          TFRTSDEISKHLMLPVIGRIALARVSAKPQLD---PEEMD--------------------
M5TW92          TFRTSDEISKHLMLPVIGRIALARLSAKPQLD---PEEMD--------------------
A0A2S8FKY2      HLSDLPTTRDELGLELLGTIPRLPRGIVRKPKAL-SHNLG--------------------
A0A517N8P6      TFRSPDEISTLLGLPILAHLPVILTPSKRQLKKSSGNDLF--------------------
A0A432MJP4      RVRSLDEVRSMLGSRILGVIPRLSKAEL-------AETTE--------------------
M5UQ35          TFKNPEEVERVVGAPILAHLPLLKTSKLKRHVRP-GSVVS--------------------
A0A0S8FY64      TVKTPDDVERRLNMPWLGYVPQMHSDGSREGLVSLAQHAI--------------------
A0A1N6KFT7      RIRTLDEVRKVLEFRLIGTIPKLLVDQLTLMG----EVGL--------------------
L0DFG4          RIRTLDEVRKVLNFALIGTIPKLRSDQISLMG----EIGL--------------------
A0A5C5XXG1      RFRSAAEVEETVSLPSLGRVGKLNSMRRGVRG----------------------------
A0A7C7YUM8      ALHSEAEVEQATGLPVLGSIPDFERGRTRIKGLNRGQRSL--------------------
A0A7C2AHI6      CMYSAAELEEASSLPVFGAIPDFRRGRLRVRG--AGDGYL--------------------
A0A518BJJ1      SLQGPSELEAVTGLPVLTTVPDFKHGKHRVAK--ATTDFI--------------------
A0A518D182      SLESEGELERITGLPVLASVPDFKDGG-RVAT--RTKDFV--------------------
A0A5C5WTY6      RFASVEQFETALGLQAFGVIDDL--------SGI-ELSTS--------------------
A0A5C5Y033      RFRTAQEVDEAIGLLNLGHVGQM--------SAI-DQGIA--------------------
A0A5C6G1Y2      RFRTAQEVDEAIGLLNLGHVGQM--------SAI-DQGIA--------------------
A0A354PDV6      RFHSAVEFEQFIGLRTLGRIGKV--------NSM-RQGVK--------------------
A0A5C6FZ02      RFRSAAEVEETVSLPSLGRVGKL--------NSM-RRGVR--------------------
M5TIT3          RFRSSAELDEAIGLPRLGSVGKL--------NSI-NQGVA--------------------
A0A5M6CY44      RFRSAAELDEMIGLPNLGRVGKM--------MSI-NQGVN--------------------
F2AXG2          RFRSAAELDEAIGLPSLGRVGKL--------NSI-NQGIK--------------------
M2BB46          RFRSAAELDEAIGLPSLGRVGKL--------NSI-NQGIK--------------------
L7CLQ6          RFRSAAELDEAIGLPSLGRVGKL--------NSI-NQGIK--------------------
A0A0J1B719      RFRSAAELDDAIGLPSLGRVGKL--------NSI-NQGIK--------------------
Q7UF18          RFRSAAELDEAIGLPSLGRVGKL--------NSI-NQGIK--------------------
A0A2G1W1E0      RFRSAAELDDAIGLPSLGRVGKL--------NSI-NQGIK--------------------
K5E235          RFRSAAELDDAIGLPSLGRVGKL--------NSI-NQGIK--------------------
A0A5C6FFI9      TFRDVEDLETTLQASAIAHVPLFNLRKLPIPSPD-QTPLA--------------------
A0A5C5WDJ1      TFSSVEELEGTTGAAVIAHVPRMALRDLRKAANV-KSMLD--------------------
A0A5C5X547      HVDDLKTMRLAIGLEHMGGIPRLPMKQLSGKNGKDDKKDS--------------------
A0A353FIP5      KIRSTAQMEAVTGLTQWASIPDFRHGANKIEAAKGKEHFL--------------------
A0A5B1CIK7      RFRSAAELDEAIGLPNLGMVGKL--------NSI-RDGIS--------------------
A0A5C5WHS2      RFRSASELDEAIGLPNLGMVAKL--------NSI-REGIS--------------------
A0A5C6B6G8      RFRTAAELDEAIGLPSLGRVGKL--------NSI-DMGIR--------------------
A0A5C5ZZN3      RFRSSAELDEAIGLLSLGRVGKL--------NSV-KQGVT--------------------
A0A5C5XS91      RFRSAAELDEAIGLTSLGRVGKL--------ESI-KKGVS--------------------
A0A5C6C4E6      RFRSAAELDEAIGLTSLGRVGKL--------NSM-KKGVA--------------------
A0A2E1VVJ1      RIRSAAQLEATTQLPVLGTIPDFRRGLARSQRAR-GKVFL--------------------
A0A3M2AEL0      KILSIAQLETATGLPQVGVIPDFRRGGTRSKHSR-ARDYL--------------------
A0A2A2W9R6      TFRNPGEVESVVGAPILAHMPMLRESRLQKQAIK-DSEIS--------------------
A0A518HKC1      TFRNPEEVESVVGAPILAHMPMLRESKLQKQAIK-DSAIS--------------------
A0A518L3P0      TFRNPEEVESVVGAPILAHMPMLPESKLQKQAIK-DSDIS--------------------
A0A255R1S0      TFKNPGEVEKAAGASIIAHLPQMVESKLAKQAKV-GSKIS--------------------
A0A5B9MKP1      TFKDPGEVESVVGAPILAHMPMLRESKLQKRVIK-GSAIS--------------------
A0A0S8J591      TIRMPRDIEDGLGLPVLGFVPAMSPKFKDFATRSLISHLD--------------------
A0A351FYP6      SVKTIDDVERALDAAVLGVIPQNVGSLMDEG-----------------------------
A0A532UT69      TLRSGDEISALLRMPVLGAVPAMLGERS----GRARGQKV--------------------
A0A2D5AWU0      KMRIIGELPHVLNVNVVGVMPRLKGPRS----RARTGRIV--------------------
A0A1G2YQB7      RLKTPDDM-KRIGVRIIGT-------------TTSKEKIK--------------------
A0A353P687      RLKTPDDITKRIGVRIIGT-------------TTSRDKIK--------------------
A0A356EME5      RISGAEDLEHETNLAVIGEIARLPERST---KAGKTTSRR--------------------
M5RT57          PISDVDQLTSNTTQTTVSEVAKLPVRTI-------SIGSR--------------------
A0A356KTN1      RLRTLKDAVNALGIPVLGVVP-HQREDE-------VELLA--------------------
A0A518HFS8      RIDATAEVAGRLGIGVVGALPTSPRGDR-------GGATA--------------------
L0DC26          RIDSAADVIQCLGMNLFGTLPILPRRSR----ILGSGDAE--------------------
A0A3L7P4E4      SFRSPDDISQTLRLPIVGISPQIQLGRRDRTNPIDPAIVT--------------------
A0A3L7PEB5      SFRSPDDISQTLRLPIVGISPQIQLGRRDRTNPIDPAIVT--------------------
A0A1U9NL64      RIRGAEEITALLGLPVLGVIPLMSKRKS----MAERGRRV--------------------
A0A2N1UCJ3      RLRSAEEISMVLATPVLGIVPSMSDKGKKD--NGNKGQKV--------------------
A0A7C4EK84      RLRTPEDVRSVLDLRVVGSVPRMSAKLA----FSQRGRQV--------------------
A0A7C3F0T2      RIHSADDVTNTLGLPILGMIPQMSAKQE----LSDRGQVV--------------------
A0A2E0X4J3      RLKSADEIGEALQLPLVGAIPLAPGVKN----RAEAGMML--------------------
A0A5C5YU10      RLKSVDEIQELLQLQVFGAVRRQLGKIG----REELGKLV--------------------
A0A517MPZ6      RLKSIEEIAATLQLPVLGALPLSAGKDD----RHETGRVV--------------------
A0A5C6CNV7      RLKSIDEIAQVLQLPVLGALPLSSERANDRKGRSAIGTVL--------------------
A0A518K5H4      RLKSIEEIASVMQLPVIGAVPLMAGSRGREGDRSVGGRLV--------------------
A0A5C6AA28      RLKSIEEIASVMQLPIVGAVPLVTGARSREGERNIGGRIV--------------------
A0A2E7ESJ6      AFRTPDEVASLMRLPVIGHVPLIDP---EKIPKLPGCNIE--------------------
A0A2E9VK20      SVKSLADLRAIVDTPILGTLPSIAN--PAKNLQAARETGL--------------------
A0A3D4PJK1      SVKSLADLRAIVDTPILGTLPSIAN--PAKNLQAARETGL--------------------
A0A355AI52      RARSPEELQAELNLPTLATIGILEE-----EDFEDGIGLE--------------------
A0A354PCQ3      RMRRITDSSMCGELSVIGEIARLPS---------GTRSYK--------------------
A0A0S8GZ23      TIYDPEDIERCIGVPMIGTTSDLTH----------VEKKL--------------------
A0A1I3DDV4      RFRTPSEIDSALGVPVIAQVGKITR--SRDKRKKGRMIVD--------------------
A0A2E0SMM6      RFRSADEIKYHLNLPVLAMVRRMEE----------TGGYA--------------------
A0A3L7SI46      RFRSPDELQTQLGLPMLAMIREMEA--LD------GSGLD--------------------
A0A5B9PJZ8      TFRSSEDIAAILGSRVIGHVGLFQRVRPRKDSPFSNVAPE--------------------
A0A2S8G191      RINAPSDISKNLRINVLGAIPFVPR-----------------------------------
A0A2E7EGG1      RVTSSEQLQVDNNLPVVGEIACLPE---KSITHELDDDID--------------------
A0A2E2N5A9      TFTTTEDIENKLNIPVLGIVPLVQQ----------AQGAQ--------------------
A0A7C8AGA2      SLHDPKDVVRRVGVRIIGTTTSPRN----------VDKLL--------------------
A0A7C2FXP7      SLTCPDDIVKRVGVKIIGTTTCTKH----------VSRPL--------------------
A0A2E3GWC6      TIKSLADVRSLFEAPILGTLPSVTN--PQKNLEMARQTGT--------------------
F0SLB0          TIKSLADVRSLFEAPILGTLPSVTN--PQKNLEMARQTGT--------------------
A0A3L7NDH9      RIRSPEDLQTFAGLSLLTMMGSLED---EADRDEEGSGLE--------------------
A0A1N6DAJ8      RVDSAADVIKSLGMNLFGTLPSLPQ-RSRGFRSGEAENVR--------------------
A0A532UD06      RLRSCEEISSVLHIPVLGVIPEISE--GQRSTITRGREIWLKLKSIFADISRTAYSRTVP
A0A660URN1      RLRSADEISAVLGLPVLGVVPTILP--EQNIAIHSGKALL--------------------
A0A517ZCB5      RFRSPDQLRSELGLPILAMIRKLPP--LA------DSGLS--------------------
A0A225EH48      RVDSVDQVVNELGLRVIGTIPAFPS----------KSSLR--------------------
A0A518INW8      TFRDPSDLQHSLNASVIAHVPRFVV--TR------KEKKA--------------------
A0A518JPH9      TFRDPSDLERSLNANVIAHVPRFQV--TR------KEKKA--------------------
A0A5C5VEK8      RLKSVDEIQEVLQLQVFGAMKRQMG----------RLGRE--------------------
A0A532UTJ0      SLRTPDDVAKRIGIRIIGTTTSLHT----------VKPAL--------------------
A0A432MFP3      RVGGTEELSGRLAAEVFA-VPPLPTTRDAERARLEGPGYD--------------------
A0A2E2CCW9      TMKSVDEIRNQLHLPILGEVPCFAD----------SDAAV--------------------
A0A3C0AGX3      TMKSVDEIRNQLHLPILGEVPCFAD----------SDAAV--------------------
A0A518AAQ5      TIRTVDEIRNQLHLPMLGEVPQFTE----------TPAHV--------------------
A0A517QBG9      TIKTVDEIRNQLHLPMLGEVPQFTE----------TPAHV--------------------
A0A518FTU3      TIKTVDEIRNQLHLPMLGEVPQFTE----------KPAHV--------------------
A0A517WHH5      TMKSVDEIRNQLHLPMLGEVPQFTE----------EPAHM--------------------
A0A5A8BGT3      TMKSVDEIRNQLHLPMLGEVPQFTE----------EPAHM--------------------
A0A2E7K7A9      TMKSVDEIRNQLHLPMLGEVPQFTE----------EPAHM--------------------
A0A517PTS5      TMKSVDEIRNQLHLPMLGEVPQFTE----------EPAHM--------------------
A0A6I6AH34      TMKSVDEIRNQLHLPMLGEVPQFTE----------EPAHM--------------------
A0A517VTK3      TLKSVDEIRNQLHLPVLGEVPTFDE----------SVSID--------------------
A0A517WQT4      TLKSVDEIRNQLHLPVLGEVPTFDE----------SVSID--------------------
A0A517VID8      TMKSVNEIRNQLHLPVLGEVPSFAE----------SEAVV--------------------
A0A517RK10      TVKSVDEIRNQFHLPILGEVPAFAE----------SEAAM--------------------
A0A518IH18      TVKSVDEIRDQLHLPILGEVPTFAE----------SEAAM--------------------
A0A5C5XLF4      SLKSLADLRAIVDTPILGTLPSIANPAKN-----LQAARE--------------------
A0A2D5NDU9      RVRTAEELQRRLPVPILASMPQTQA--APKETDAPTTTWD--------------------
A0A1P8WP26      RFRAPEELKLQLDTQILTMVPALEQ--FS------GEGFN--------------------
A0A3L7V1F3      RFRTPEELKLQLDTQVLSMIPRMEE--LQ------GEGFA--------------------
D5SZ21          RFRSPEETSLQLGAPVLSFIPSLPT--YD------GNGLD--------------------
A0A286RGB6      PVNTAHELPHAVGVDVWGTIPLVPTRALQMLPEENGRSRR--------------------
A0A518CHE5      RFRSPDEIKYHLNLPVLAMVRKMEE--TT------GYAID--------------------
A0A1V5N3W2      NLYTPEDLARTVGVAVVGTTSQLNY--RD------KIGLR--------------------
A0A3E0MY27      RLSSAHDMTEGLGMTVMGDVPLLSE--RP-WRLPGMSGID--------------------
A0A7C4Z5R7      RITSPEEVLQGVGMNVVGNVPLVPE--VARRNLVPPQGER--------------------
A0A2E0X9P6      RIATADDLERETALNLLGEVTRFPM--RP------VASRL--------------------
A0A286RLF2      RFRSVEEIQWQLRAPVLSIIREMPP--RE------GEGVE--------------------
A0A517NSK8      TFADPEDVEKTLGAPVLAHVNRFAPIRRK------RNEPA--------------------
A0A5C5Z0D6      TFVDPDDVQHTLGAPVLAHVPRFEPFKRK------RKDPP--------------------
M5UE94          TFVDPDDVQATLGAPVLAHVPRFDPIKRK------RKDPP--------------------
A0A2E8FLY0      RFRSPDELQLQTNLSVLAMVGELPA--AD------GPGLA--------------------
A0A3D2U1E1      RFRSPEELQVQAGLPVLAIVGELPPGNAE------TKGLD--------------------
E8R3W3          RVDNLNVLGASMGMNVIGAIPTLPR--QTNSSRSISKPND--------------------
A0A5C5ZM48      RVCDVRSLEAHANAPVLCEIARLPS--RP-----NSSGRR--------------------
A0A5B9WF77      RVVNPDSLSSRVQSEVYA-LPPIPR--QR------AIGAS--------------------
A0A518BBX8      SFRTSQEIQRRLGLPIVGLIPFIAA--PKTKGSGEDAQID--------------------
A0A1P8WN28      RLRSPEEVRDELGLNVLGIIRKLPQ--HE-------------------------------
A0A3B9CTT0      RLRTPEDVQDELGLPVLGIIRRLPE--EQ-------------------------------
A0A518ALT3      RVCNADELANETQLPLLGEVACLPV--RK-------VGTR--------------------
A0A3M1QRP3      VEGLHDRTVSQAG-PLLGPLPLVRD--PR------SATAE--------------------
A0A517TMV0      RFGSPEEMAHQLGCRVLSVVRELQP--LA------SHGLQ--------------------
A0A3E0MY88      RFRSPEDVTMRLGAPTLAMVAQLDM--TH------QTGVE--------------------
A0A5B9QF68      RFSSPEELTAQLGVPVLAMVRNLTP--LP------GEGME--------------------
A0A5B9QGF0      RFSSPEELTSQLGVPVLAMVRNLTP--LP------GEGMD--------------------
A0A5C6CK24      RFSSPEELTAQLGVPVLAMVRNLSP--LP------GEGME--------------------
A0A2E3RCU8      RFRTPDEMSKRVGYPIISLVRALPE--LG------GKGIE--------------------
A0A1C3E6N1      RFRSPEETSLQLGAPVLSFIPTLPT--YD------GNGLD--------------------
A0A518GJT2      RFRSPEETSLQLGAPVLSFIPTLPT--YD------GNGLD--------------------
A0A2E8B0L9      RFRSPDELRDQLGVPVLAMVRRLTV--AG------NEGAE--------------------
A0A5Q4GFE7      RFRSPEELQQQLGAPVLAMIRELAT--PA------TAGLQ--------------------
A0A257WS34      RFKSPDELQAQLGLPVLAMIRQMPQ--PE------GEGIQ--------------------
A0A7C4LP10      RFKSPDELKWLLGLPVLAMIRQIRE--TG------GTGIQ--------------------
A0A517MLW3      RFASLEEAERQTRTEILAVVEKLET--YG------EYGAE--------------------
A0A5B9QVD0      RFASLDDIERQTQTEILAVVEKLEP--HG------ETGPQ--------------------
A0A3A0DET7      RLKSVDEISEVVQLPVFGVVPQSSA--SA------DRALA--------------------
A0A3B8PNV4      RFRSPEELRLQLDVPVLALVGEMPV--TD------ELGLS--------------------
A0A3D1DR40      RFRSPEELRLQLDVPVLALVGEMPV--TD------ELGLS--------------------
A0A2E7RYU8      RFRSPEELRLQLDVPVLALVGEMPV--TD------EPGLS--------------------
A0A3B8LXG8      RFRSPEELRLQLDVPVLALVGEMPV--TD------EPGLS--------------------
A0A286RD13      PVSSAYQISYGLGLPVLGDLPLIER-----------------------------------
A0A2E3GWX1      RFHSPDELKSQLGAPVLAMVRELPM--LD-----VETGLE--------------------
F0SG60          RFHSPDELKSQLGAPVLAMVRELPM--LD-----VETGLE--------------------
A0A2E9VST2      RFHSPDELKRELGAPVMAMVRSLPA--LP-----HTHGLE--------------------
A0A356A6X2      RFHSPDELKRELGAPVMAMVRSLPT--LP-----HTHGLE--------------------
A0A5C5XLM3      RFHSPDELKRELGAPVMAMVRSLPS--LP-----HTHGLE--------------------
A0A7C5FXU1      RVNTSEELSQNLGVEVLARIPYVPA--RA------LLGPK--------------------
A0A3M1VCL4      RFRSPEELQLQLGAPVLAIVRKLQQ--LE------GTGVA--------------------
A0A5C5V7Z9      RFTSPDEMSAQLELPVLSVVRTLNP--LP------GVGLD--------------------
A0A5C5YT05      RFASPDEMSQQLELPVLSVVRTLNP--LP------GTGLD--------------------
A0A518D7F9      RFGSPEEMSRELGLPILSIVRQLNP--TG------GERLE--------------------
A0A5C5ZIP0      RYGSPDEMALQLGCQVLALVRQLQP--IA------GSGIQ--------------------
A0A518KBK3      RFGSPEEMAMQLGCRVLAVIRELPL--RT------GVGLE--------------------
A0A5C6AKF9      RFGSPEEMALQLGCPVLAVVRDLPA--RS------GVGLE--------------------
A0A6M5Z0K7      RIHSPADVSKGLRLRVIGALPKLSG--AQ-------------------------------
A0A350CI62      RFRTPEELKLHLETQVLSMIPRMTE--LP------GEGFE--------------------
A0A4P5WQK6      RFRTPEELKLHLETQVLSMIPRMTE--LP------GEGFE--------------------
A0A3C1X4W5      RFRTPEELKLHLDTQVLSMIPRMSE--LP------GEGFD--------------------
A0A3D3W3A7      RFRTPEELKLHLDTQVLSMIPRMSE--LP------GEGFD--------------------
A0A518DRX3      RFRSPEEMVEQLGAKLLAAIRPLSL--TE------THGAQ--------------------
A0A518DZF9      RFRSPEEMVEQLGAKLLAAIRPLSL--TE------THGAQ--------------------
A0A518AKT8      RFNSPEELTAQLGVPVLTLVQRLEP--LV------GDGLQ--------------------
A0A5C5ZR72      RVTDSDQIYQDTNLRILGEISSFPK--RK------VAANP--------------------
A0A7C5R0U3      RFRTPDQIEEQLQLPLLSVIGQLAA--TP------ESGLD--------------------
A0A517TY85      RISSTDQLTKESLLPVIGEVARFPR--RR------VGAAP--------------------
A0A5B9QEI7      RISTPEQLTNESSLPLLGEVAQFPR--QR------VATTQ--------------------
F0SI78          RFRSPEEMMQMLGVPILGHIPEMPA--SQKRRKRNKSGDT--------------------
A0A517MDV3      SFRSTKEIESAVGAPMLGAVGTMKF--RR------HRGMD--------------------
A0A518IQ30      HFQSPDELEEQVGVSVIAMIQSLNG--SG------EAGGQ--------------------
A0A517LWP4      RFQSPDELQEQVGVSVIAMIQSLNG--SG------EAGGQ--------------------
A0A518JNW8      RFQSPDELQEQVGVSVIAMIQSLNG--SG------EAGGQ--------------------
A0A2E7ENQ5      RFRSVDELKDQLNVAVLAIVRQLSP--TS------ATGVD--------------------
A0A7C2KUQ9      AVQGVSDLKGPFETPFLGCVPLLRD--PQ------RPS----------------------
A0A7C5BZF0      RFRSIEELQLLTGTPVLATVRDLSI--PE------DPGLE--------------------
A0A1G3AQE9      RFRSREEMQSVLGVPALAIVQELKM--NQ------NSGID--------------------
A0A3L7UQT9      RFRSPDELRMQLGVPVLAMVRAMEP--TG------GTGAD--------------------
A0A4P5YBU2      RFRSPDELRMQLGVPVLAMVRAMEP--TG------GTGAD--------------------
A0A7C7V5U8      RFRSAEEMQAQLRAPVLAMVRQLAP--AT------GSGLE--------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------ENKDANLELLTS
A0A1G3B0P0      ------------------------------------------------ENKDANLELLTS
A0A1E3X4X0      -------------------------------------------LGGIADDNVFVPELFVH
A0A286U4B3      -------------------------------------------------DEVENFDTILH
A0A5C6DDS2      -------------------------------------------------DEVQNFDLISH
A0A2E3GW02      --------------------------------------------------I--DPTLVNY
A0A5B9QNZ7      --------------------------------------------------RLISPELVVY
A0A1Z8N7H5      --------------------------------------------------GEGLKKVSAF
A0A1G2YPI3      ---------------------------------------------------------KTY
A0A1U7CZ81      --------------------------------------------------DRFIQRLDHL
A0A142YNY8      --------------------------------------------------ERFIQRLDHL
A0A1U7GLS6      --------------------------------------------------DRFIQRLDHL
A0A532UIN2      --------------------------------------------------DRGQKVHKD-
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      --------------------------------------------------P----SLVCS
A0A5C5YWH4      --------------------------------------------------P----SLVTF
A0A3D2TNK4      --------------------------------------------------GENLETIHTH
A0A7C1Y4F0      --------------------------------------------------PVPIAAIDVP
A0A6I0ENW6      --------------------------------------------------D---------
A0A6L3A0B7      --------------------------------------------------D---------
A0A0J1B4A0      --------------------------------------------------A----MIPTF
A0A142WSB9      --------------------------------------------------P----QVVYL
M5SZR3          --------------------------------------------------DSLDRSLCTY
M5TW92          --------------------------------------------------DSLDRSLCTY
A0A2S8FKY2      --------------------------------------------------PYEDQVRDS-
A0A517N8P6      --------------------------------------------------PHTDQIVTVL
A0A432MJP4      --------------------------------------------------P----GLVVH
M5UQ35          --------------------------------------------------P----MIVAF
A0A0S8FY64      --------------------------------------------------Q----HATD-
A0A1N6KFT7      --------------------------------------------------V----SHAM-
L0DFG4          --------------------------------------------------V----SHAM-
A0A5C5XXG1      -------------------------------------------------------LIAG-
A0A7C7YUM8      --------------------------------------------------P----MRDA-
A0A7C2AHI6      --------------------------------------------------A----MLSN-
A0A518BJJ1      --------------------------------------------------A----LRDD-
A0A518D182      --------------------------------------------------A----MRDD-
A0A5C5WTY6      --------------------------------------------------P----KATG-
A0A5C5Y033      --------------------------------------------------G----LVAT-
A0A5C6G1Y2      --------------------------------------------------G----LVAT-
A0A354PDV6      --------------------------------------------------G----LIAT-
A0A5C6FZ02      --------------------------------------------------G----LIAG-
M5TIT3          --------------------------------------------------G----LIAT-
A0A5M6CY44      --------------------------------------------------G----LISA-
F2AXG2          --------------------------------------------------G----LIAT-
M2BB46          --------------------------------------------------G----LIAT-
L7CLQ6          --------------------------------------------------G----LIAT-
A0A0J1B719      --------------------------------------------------G----LIAT-
Q7UF18          --------------------------------------------------G----LIAT-
A0A2G1W1E0      --------------------------------------------------G----LIAT-
K5E235          --------------------------------------------------G----LIAT-
A0A5C6FFI9      --------------------------------------------------P----SLVTA
A0A5C5WDJ1      --------------------------------------------------P----SLMTF
A0A5C5X547      --------------------------------------------------K----LQRA-
A0A353FIP5      --------------------------------------------------A----LLDA-
A0A5B1CIK7      --------------------------------------------------G----LIAV-
A0A5C5WHS2      --------------------------------------------------G----LIAA-
A0A5C6B6G8      --------------------------------------------------G----LVSA-
A0A5C5ZZN3      --------------------------------------------------G----LIAT-
A0A5C5XS91      --------------------------------------------------G----LIAT-
A0A5C6C4E6      --------------------------------------------------G----LIAT-
A0A2E1VVJ1      --------------------------------------------------A----LLHD-
A0A3M2AEL0      --------------------------------------------------P----LRDE-
A0A2A2W9R6      --------------------------------------------------P----MVAAF
A0A518HKC1      --------------------------------------------------P----MIAAF
A0A518L3P0      --------------------------------------------------P----MVAAF
A0A255R1S0      --------------------------------------------------P----MITTF
A0A5B9MKP1      --------------------------------------------------P----MVASF
A0A0S8J591      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A532UT69      -----------------------------------------------------------H
A0A2D5AWU0      -----------------------------------------------------------E
A0A1G2YQB7      -----------------------------------------------------------E
A0A353P687      -----------------------------------------------------------K
A0A356EME5      -----------------------------------------------------------M
M5RT57          -----------------------------------------------------------Q
A0A356KTN1      -----------------------------------------------------------L
A0A518HFS8      -----------------------------------------------------------V
L0DC26          -----------------------------------------------------------H
A0A3L7P4E4      -----------------------------------------------------------I
A0A3L7PEB5      -----------------------------------------------------------I
A0A1U9NL64      -----------------------------------------------------------A
A0A2N1UCJ3      -----------------------------------------------------------H
A0A7C4EK84      -----------------------------------------------------------H
A0A7C3F0T2      -----------------------------------------------------------E
A0A2E0X4J3      -----------------------------------------------------------V
A0A5C5YU10      -----------------------------------------------------------H
A0A517MPZ6      -----------------------------------------------------------L
A0A5C6CNV7      -----------------------------------------------------------L
A0A518K5H4      -----------------------------------------------------------A
A0A5C6AA28      -----------------------------------------------------------A
A0A2E7ESJ6      -----------------------------------------------------PIMCTVH
A0A2E9VK20      -----------------------------------------------------APMLYYY
A0A3D4PJK1      -----------------------------------------------------APMLYYY
A0A355AI52      -----------------------------------------------------TVHMWNI
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E0SMM6      -----------------------------------------------------IDAVQTH
A0A3L7SI46      -----------------------------------------------------AIVT--Y
A0A5B9PJZ8      --------------------------------------------------------LIAL
A0A2S8G191      -----------------------------------------------------SVLVNSS
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------LARMYS
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A2E3GWC6      -----------------------------------------------------SPMLYYY
F0SLB0          -----------------------------------------------------SPMLYYY
A0A3L7NDH9      -----------------------------------------------------STHM--H
A0A1N6DAJ8      ------------------------------------------------------------
A0A532UD06      GEPKGKAKPGAQPIMAQVRAYRALRATGTKAQPFAVGASSPNKDETTTEEQALEEQALVE
A0A660URN1      -----KFKSGASRIWRTIQAGISSDAAGVETKTVSAVPRSED-----TAQGALDTKAIAE
A0A517ZCB5      -----------------------------------------------------SLYP--F
A0A225EH48      -----------------------------------------------SGDAGQAQNWRFV
A0A518INW8      -----------------------------------------------AKQSAISPLCRTV
A0A518JPH9      -----------------------------------------------AKQSSLSPLCRTV
A0A5C5VEK8      -----------------------------------------------------ELGKLVH
A0A532UTJ0      ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      -----------------------------------------------D-ESEFAPALWYY
A0A3C0AGX3      -----------------------------------------------D-ESEFAPALWYY
A0A518AAQ5      -----------------------------------------------D-DSQFDSALWYY
A0A517QBG9      -----------------------------------------------D-ESQFDSALWYY
A0A518FTU3      -----------------------------------------------D-ESQFDSALWYY
A0A517WHH5      -----------------------------------------------D-DSQFDSALWYY
A0A5A8BGT3      -----------------------------------------------D-DSQFDSALWYY
A0A2E7K7A9      -----------------------------------------------D-DSQFDSALWYY
A0A517PTS5      -----------------------------------------------D-DSQFDSALWYY
A0A6I6AH34      -----------------------------------------------D-DSQFDSALWYY
A0A517VTK3      -----------------------------------------------DSECEFDRALWYY
A0A517WQT4      -----------------------------------------------DSECEFDRALWYY
A0A517VID8      -----------------------------------------------D-DSEFAPALWYY
A0A517RK10      -----------------------------------------------D-DSDFDPALWYY
A0A518IH18      -----------------------------------------------D-DSEFDPALWYY
A0A5C5XLF4      -----------------------------------------------T-GLAPMLYY--Y
A0A2D5NDU9      ------------------------------------------------------------
A0A1P8WP26      -----------------------------------------------------SVLC--H
A0A3L7V1F3      -----------------------------------------------------AVMC--H
D5SZ21          -----------------------------------------------------SVHA--F
A0A286RGB6      -----------------------------------------------------------Y
A0A518CHE5      -----------------------------------------------------AVQT--H
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      -----------------------------------------------------------P
A0A7C4Z5R7      -----------------------------------------------------------N
A0A2E0X9P6      -----------------------------------------------------RSLPAWH
A0A286RLF2      -----------------------------------------------------VLEV--V
A0A517NSK8      -----------------------------------------------F-EIDSSVYA--F
A0A5C5Z0D6      -----------------------------------------------L-KIDSSIRV--Y
M5UE94          -----------------------------------------------F-EIDSSIRV--H
A0A2E8FLY0      -----------------------------------------------------SVPT--F
A0A3D2U1E1      -----------------------------------------------------AVQT--F
E8R3W3          -----------------------------------------------------RQVV---
A0A5C5ZM48      -----------------------------------------------S-EYRLEQALRVF
A0A5B9WF77      ------------------------------------------------------------
A0A518BBX8      -----------------------------------------------A-AIDMTLCA--H
A0A1P8WN28      -----------------------------------------------------VDQARIY
A0A3B9CTT0      -----------------------------------------------------LSQCKIY
A0A518ALT3      -----------------------------------------------------HQLMAPN
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      -----------------------------------------------------AVQM--F
A0A3E0MY88      -----------------------------------------------------AVHT--H
A0A5B9QF68      -----------------------------------------------------TVHT--H
A0A5B9QGF0      -----------------------------------------------------TVHT--Y
A0A5C6CK24      -----------------------------------------------------TVHT--H
A0A2E3RCU8      -----------------------------------------------------KVSA--Y
A0A1C3E6N1      -----------------------------------------------------SVHA--F
A0A518GJT2      -----------------------------------------------------SVHA--F
A0A2E8B0L9      -----------------------------------------------------SLQV--H
A0A5Q4GFE7      -----------------------------------------------------AIQV--H
A0A257WS34      -----------------------------------------------------QVLT--F
A0A7C4LP10      -----------------------------------------------------QVLT--Y
A0A517MLW3      -----------------------------------------------------AIQM--H
A0A5B9QVD0      -----------------------------------------------------AIQM--H
A0A3A0DET7      -----------------------------------------------------GQLV--L
A0A3B8PNV4      -----------------------------------------------------SVRM--L
A0A3D1DR40      -----------------------------------------------------SVRM--L
A0A2E7RYU8      -----------------------------------------------------SVRM--L
A0A3B8LXG8      -----------------------------------------------------SVRM--L
A0A286RD13      -----------------------------------------------------PIMRWMS
A0A2E3GWX1      -----------------------------------------------------SIYT--H
F0SG60          -----------------------------------------------------SIYT--H
A0A2E9VST2      -----------------------------------------------------SIFT--Y
A0A356A6X2      -----------------------------------------------------SIFT--Y
A0A5C5XLM3      -----------------------------------------------------SIFT--Y
A0A7C5FXU1      -----------------------------------------------------ASSP--R
A0A3M1VCL4      -----------------------------------------------------SVLT--F
A0A5C5V7Z9      -----------------------------------------------------AVHM--H
A0A5C5YT05      -----------------------------------------------------AVHM--H
A0A518D7F9      -----------------------------------------------------AVHM--F
A0A5C5ZIP0      -----------------------------------------------------SVQM--F
A0A518KBK3      -----------------------------------------------------KVQM--F
A0A5C6AKF9      -----------------------------------------------------KVQM--F
A0A6M5Z0K7      -----------------------------------------------------------S
A0A350CI62      -----------------------------------------------------AVMC--H
A0A4P5WQK6      -----------------------------------------------------AVMC--H
A0A3C1X4W5      -----------------------------------------------------AVMC--H
A0A3D3W3A7      -----------------------------------------------------AVMC--H
A0A518DRX3      -----------------------------------------------------AVQV--H
A0A518DZF9      -----------------------------------------------------AVQV--H
A0A518AKT8      -----------------------------------------------------SLHT--H
A0A5C5ZR72      -----------------------------------------------------QMLPRRL
A0A7C5R0U3      -----------------------------------------------------EFIA--Q
A0A517TY85      -----------------------------------------------------V-IAGPP
A0A5B9QEI7      -----------------------------------------------------AQIAAPQ
F0SI78          -----------------------------------------------V-PIDPTLVN--Y
A0A517MDV3      -----------------------------------------------K-TLSPELVV--Y
A0A518IQ30      -----------------------------------------------------NLHM--F
A0A517LWP4      -----------------------------------------------------NLHM--F
A0A518JNW8      -----------------------------------------------------NLHM--F
A0A2E7ENQ5      -----------------------------------------------------SLQV--H
A0A7C2KUQ9      ------------------------------------------------------------
A0A7C5BZF0      -----------------------------------------------------VLPA--Y
A0A1G3AQE9      -----------------------------------------------------QLPT--Y
A0A3L7UQT9      -----------------------------------------------------AVLC--H
A0A4P5YBU2      -----------------------------------------------------AVLC--H
A0A7C7V5U8      -----------------------------------------------------CLQV--Y
                                                                            

A0A5S9IPR9      ---------NTNV-----------------------------------------------
A0A533Q9U4      --------PKHSI-----------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      --------PGNST-----------------------------------------------
A0A533Q6B7      --------PKYPI-----------------------------------------------
A0A5S9IJB5      --------TRSPV-----------------------------------------------
A0A1G2XVR0      EA------PKSVF-----------------------------------------------
A0A1G3B0P0      EA------PKSVF-----------------------------------------------
A0A1E3X4X0      RK------SKSNI-----------------------------------------------
A0A286U4B3      EL------PKSTF-----------------------------------------------
A0A5C6DDS2      EL------PMSTF-----------------------------------------------
A0A2E3GW02      HR------PNSRI-----------------------------------------------
A0A5B9QNZ7      HR------PESPQ-----------------------------------------------
A0A1Z8N7H5      SD------PVSVF-----------------------------------------------
A0A1G2YPI3      LD------SKSNW-----------------------------------------------
A0A1U7CZ81      RF------AVCGD-----------------------------------------------
A0A142YNY8      RF------AVCGD-----------------------------------------------
A0A1U7GLS6      RF------AVCGD-----------------------------------------------
A0A532UIN2      --------SDSPV-----------------------------------------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      YA------PRSTE-----------------------------------------------
A0A5C5YWH4      HA------PRSAE-----------------------------------------------
A0A3D2TNK4      AC------PNAPE-----------------------------------------------
A0A7C1Y4F0      AG------EATASSDLAPVAAQDAEQAATETRDAVEGDRRTPSELESVRWVQRMSKKAGR
A0A6I0ENW6      --------TSPML-----------------------------------------------
A0A6L3A0B7      --------TSPML-----------------------------------------------
A0A0J1B4A0      HL------PRGTE-----------------------------------------------
A0A142WSB9      HH------PGSRE-----------------------------------------------
M5SZR3          FR------PISVE-----------------------------------------------
M5TW92          FR------PISVE-----------------------------------------------
A0A2S8FKY2      --------SDSVA-----------------------------------------------
A0A517N8P6      HH------PHAPC-----------------------------------------------
A0A432MJP4      QR------PGSLT-----------------------------------------------
M5UQ35          HA------PRSSE-----------------------------------------------
A0A0S8FY64      --------SS--------------------------------------------------
A0A1N6KFT7      --------PRSVW-----------------------------------------------
L0DFG4          --------PRSVW-----------------------------------------------
A0A5C5XXG1      --------ELSPN-----------------------------------------------
A0A7C7YUM8      --------PGGPQ-----------------------------------------------
A0A7C2AHI6      --------PGSPV-----------------------------------------------
A0A518BJJ1      --------PHGVV-----------------------------------------------
A0A518D182      --------PSGPV-----------------------------------------------
A0A5C5WTY6      --------NAKGS-----------------------------------------------
A0A5C5Y033      --------DGSSE-----------------------------------------------
A0A5C6G1Y2      --------DGSSE-----------------------------------------------
A0A354PDV6      --------ELTPD-----------------------------------------------
A0A5C6FZ02      --------ELSPN-----------------------------------------------
M5TIT3          --------ELSPN-----------------------------------------------
A0A5M6CY44      --------ELSPD-----------------------------------------------
F2AXG2          --------ELSPD-----------------------------------------------
M2BB46          --------ELSPD-----------------------------------------------
L7CLQ6          --------ELSPD-----------------------------------------------
A0A0J1B719      --------ELSPD-----------------------------------------------
Q7UF18          --------ELSPD-----------------------------------------------
A0A2G1W1E0      --------ELSPD-----------------------------------------------
K5E235          --------ELSPD-----------------------------------------------
A0A5C6FFI9      HC------PRSAE-----------------------------------------------
A0A5C5WDJ1      HS------PRSPE-----------------------------------------------
A0A5C5X547      ------------L-----------------------------------------------
A0A353FIP5      --------PDSRV-----------------------------------------------
A0A5B1CIK7      --------ENSPN-----------------------------------------------
A0A5C5WHS2      --------ENSPN-----------------------------------------------
A0A5C6B6G8      --------ELSPD-----------------------------------------------
A0A5C5ZZN3      --------ELSPD-----------------------------------------------
A0A5C5XS91      --------GESPD-----------------------------------------------
A0A5C6C4E6      --------GESPD-----------------------------------------------
A0A2E1VVJ1      --------PESAA-----------------------------------------------
A0A3M2AEL0      --------PDSPT-----------------------------------------------
A0A2A2W9R6      HV------PRATD-----------------------------------------------
A0A518HKC1      HV------PRATD-----------------------------------------------
A0A518L3P0      HI------PRATD-----------------------------------------------
A0A255R1S0      HQ------PRGID-----------------------------------------------
A0A5B9MKP1      HL------PRAVD-----------------------------------------------
A0A0S8J591      --------SRSGP-----------------------------------------------
A0A351FYP6      --------DESPH-----------------------------------------------
A0A532UT69      LD------PDSPA-----------------------------------------------
A0A2D5AWU0      EQ------PGSSA-----------------------------------------------
A0A1G2YQB7      SM------WPRQL-----------------------------------------------
A0A353P687      AM------WPRQL-----------------------------------------------
A0A356EME5      AQ------KLRLY-----------------------------------------------
M5RT57          TK------AMSIF-----------------------------------------------
A0A356KTN1      RE------SRSVY-----------------------------------------------
A0A518HFS8      R--------RRAL-----------------------------------------------
L0DC26          RR------WGSML-----------------------------------------------
A0A3L7P4E4      HR------PRSQS-----------------------------------------------
A0A3L7PEB5      HR------PRSQS-----------------------------------------------
A0A1U9NL64      LN------PSSPV-----------------------------------------------
A0A2N1UCJ3      LE------PKSSI-----------------------------------------------
A0A7C4EK84      LD------PMSQV-----------------------------------------------
A0A7C3F0T2      LE------PTSHA-----------------------------------------------
A0A2E0X4J3      NA------PRAAF-----------------------------------------------
A0A5C5YU10      LQ------PRSTS-----------------------------------------------
A0A517MPZ6      TH------PRSMA-----------------------------------------------
A0A5C6CNV7      TH------PRSTA-----------------------------------------------
A0A518K5H4      LQ------PRSTA-----------------------------------------------
A0A5C6AA28      LQ------PRSVA-----------------------------------------------
A0A2E7ESJ6      K-------PKSPQ-----------------------------------------------
A0A2E9VK20      HD------PGSPE-----------------------------------------------
A0A3D4PJK1      HD------PGSPE-----------------------------------------------
A0A355AI52      --------SDDAA-----------------------------------------------
A0A354PCQ3      --------GRRIF-----------------------------------------------
A0A0S8GZ23      --------LLEQV-----------------------------------------------
A0A1I3DDV4      --------AQAPE-----------------------------------------------
A0A2E0SMM6      VN------PNSVE-----------------------------------------------
A0A3L7SI46      AK------PDSLE-----------------------------------------------
A0A5B9PJZ8      HQ------PSNQN-----------------------------------------------
A0A2S8G191      RNSKKQEYWKNLI-----------------------------------------------
A0A2E7EGG1      --------QLGLF-----------------------------------------------
A0A2E2N5A9      EG------NNPLF-----------------------------------------------
A0A7C8AGA2      --------LARQL-----------------------------------------------
A0A7C2FXP7      --------LAQQL-----------------------------------------------
A0A2E3GWC6      HD------PASPE-----------------------------------------------
F0SLB0          HD------PASPE-----------------------------------------------
A0A3L7NDH9      KS------NDDAA-----------------------------------------------
A0A1N6DAJ8      --------WKSML-----------------------------------------------
A0A532UD06      FGQVVHFKPRSIA-----------------------------------------------
A0A660URN1      RGQRVHLAPKSHV-----------------------------------------------
A0A517ZCB5      SK------PNAVE-----------------------------------------------
A0A225EH48      LN----------------------------------------------------------
A0A518INW8      FA------PHSVE-----------------------------------------------
A0A518JPH9      FA------PHSVE-----------------------------------------------
A0A5C5VEK8      LQ------PRSTS-----------------------------------------------
A0A532UTJ0      --------LPEQI-----------------------------------------------
A0A432MFP3      -----------PK-----------------------------------------------
A0A2E2CCW9      YR------PASRE-----------------------------------------------
A0A3C0AGX3      YR------PASRE-----------------------------------------------
A0A518AAQ5      YR------PASRE-----------------------------------------------
A0A517QBG9      YR------PASRE-----------------------------------------------
A0A518FTU3      YR------PASRE-----------------------------------------------
A0A517WHH5      YR------PASRE-----------------------------------------------
A0A5A8BGT3      YR------PASRE-----------------------------------------------
A0A2E7K7A9      YR------PASRE-----------------------------------------------
A0A517PTS5      YR------PASRE-----------------------------------------------
A0A6I6AH34      YR------PASRE-----------------------------------------------
A0A517VTK3      YR------PSSKE-----------------------------------------------
A0A517WQT4      YR------PSSKE-----------------------------------------------
A0A517VID8      YR------PASRE-----------------------------------------------
A0A517RK10      YR------PASRE-----------------------------------------------
A0A518IH18      YR------PASRE-----------------------------------------------
A0A5C5XLF4      HD------PGSPE-----------------------------------------------
A0A2D5NDU9      --------NEHEF-----------------------------------------------
A0A1P8WP26      VK------PNSTE-----------------------------------------------
A0A3L7V1F3      SK------PHSKE-----------------------------------------------
D5SZ21          VA------PHESS-----------------------------------------------
A0A286RGB6      QR------WRALF-----------------------------------------------
A0A518CHE5      VN------PNSVE-----------------------------------------------
A0A1V5N3W2      ----------QQL-----------------------------------------------
A0A3E0MY27      IS------LQGMM-----------------------------------------------
A0A7C4Z5R7      RT------WHTIL-----------------------------------------------
A0A2E0X9P6      HR------EMIVF-----------------------------------------------
A0A286RLF2      AD------PNSPA-----------------------------------------------
A0A517NSK8      HR------PRSPE-----------------------------------------------
A0A5C5Z0D6      HQ------PRSPS-----------------------------------------------
M5UE94          HQ------PRTPA-----------------------------------------------
A0A2E8FLY0      SE------PNGVE-----------------------------------------------
A0A3D2U1E1      AE------PNGSE-----------------------------------------------
E8R3W3          --------WEGML-----------------------------------------------
A0A5C5ZM48      EESTNVLATTIRW-----------------------------------------------
A0A5B9WF77      --------GPDDQ-----------------------------------------------
A0A518BBX8      LR------PRSVH-----------------------------------------------
A0A1P8WN28      VNDF----PQTTH-----------------------------------------------
A0A3B9CTT0      LEKF----AQTVQ-----------------------------------------------
A0A518ALT3      QH------DLLVY-----------------------------------------------
A0A3M1QRP3      --------EFTVQ-----------------------------------------------
A0A517TMV0      AK------PQATE-----------------------------------------------
A0A3E0MY88      VD------PNSPE-----------------------------------------------
A0A5B9QF68      TL------PHAVE-----------------------------------------------
A0A5B9QGF0      KL------PHAVE-----------------------------------------------
A0A5C6CK24      KL------PHSVE-----------------------------------------------
A0A2E3RCU8      ND------PASVF-----------------------------------------------
A0A1C3E6N1      VA------PHESS-----------------------------------------------
A0A518GJT2      VA------PHESS-----------------------------------------------
A0A2E8B0L9      VA------AGAVE-----------------------------------------------
A0A5Q4GFE7      VS------PESVE-----------------------------------------------
A0A257WS34      VK------PSAAE-----------------------------------------------
A0A7C4LP10      AR------PDSAE-----------------------------------------------
A0A517MLW3      VA------PSTRS-----------------------------------------------
A0A5B9QVD0      VD------PSARV-----------------------------------------------
A0A3A0DET7      QA------PRSSV-----------------------------------------------
A0A3B8PNV4      SE------PNSTD-----------------------------------------------
A0A3D1DR40      SE------PNSTD-----------------------------------------------
A0A2E7RYU8      SE------PNSTD-----------------------------------------------
A0A3B8LXG8      SE------PNSTD-----------------------------------------------
A0A286RD13      RNGHMPETMRSVL-----------------------------------------------
A0A2E3GWX1      TK------PNSVE-----------------------------------------------
F0SG60          TK------PNSVE-----------------------------------------------
A0A2E9VST2      TK------PNSVE-----------------------------------------------
A0A356A6X2      TK------PNSVE-----------------------------------------------
A0A5C5XLM3      TK------PNSVE-----------------------------------------------
A0A7C5FXU1      ARVWRGMLTESAK-----------------------------------------------
A0A3M1VCL4      AK------PNGVE-----------------------------------------------
A0A5C5V7Z9      VD------GNSVE-----------------------------------------------
A0A5C5YT05      VD------ANSVE-----------------------------------------------
A0A518D7F9      RD------GNSPD-----------------------------------------------
A0A5C5ZIP0      AK------PQAVD-----------------------------------------------
A0A518KBK3      SQ------PQATE-----------------------------------------------
A0A5C6AKF9      AQ------PQGAE-----------------------------------------------
A0A6M5Z0K7      AS------LARSL-----------------------------------------------
A0A350CI62      VR------PHSRE-----------------------------------------------
A0A4P5WQK6      VR------PHSRE-----------------------------------------------
A0A3C1X4W5      VR------PHSRE-----------------------------------------------
A0A3D3W3A7      VR------PHSRE-----------------------------------------------
A0A518DRX3      VN------PTAVE-----------------------------------------------
A0A518DZF9      VN------PTAVE-----------------------------------------------
A0A518AKT8      MC------PNASD-----------------------------------------------
A0A5C5ZR72      RR------EMYVF-----------------------------------------------
A0A7C5R0U3      QR------QDSAD-----------------------------------------------
A0A517TY85      SK------EMFVF-----------------------------------------------
A0A5B9QEI7      QR------QMFVY-----------------------------------------------
F0SI78          HR------PNSRI-----------------------------------------------
A0A517MDV3      HR------PDSSD-----------------------------------------------
A0A518IQ30      TN------PKSAE-----------------------------------------------
A0A517LWP4      TN------PKSAE-----------------------------------------------
A0A518JNW8      TN------PKSAE-----------------------------------------------
A0A2E7ENQ5      VA------PNDVA-----------------------------------------------
A0A7C2KUQ9      EQ------EQAAQ-----------------------------------------------
A0A7C5BZF0      AN------PNSAE-----------------------------------------------
A0A1G3AQE9      AS------PNAAE-----------------------------------------------
A0A3L7UQT9      AK------PNGVE-----------------------------------------------
A0A4P5YBU2      AK------PNGVE-----------------------------------------------
A0A7C7V5U8      AH------PDAAE-----------------------------------------------
                                                                            

A0A5S9IPR9      -------------------------------------------AEAFRAISTSI--FF-A
A0A533Q9U4      -------------------------------------------TEALKGIRTSI--IF-S
A0A1U9NNE1      -------------------------------------------ADDYRTIRANI----SM
A0A2G2JCA2      -----------------------------------VSTSLRMYEESIDSLRTNI--ML-P
A0A533Q6B7      -------------------------------------------TESIKRIRTSI--MF-S
A0A5S9IJB5      -------------------------------------------AESFRSLRTTL-----S
A0A1G2XVR0      -------------------------------------------SETIRNIRTGI--ML-S
A0A1G3B0P0      -------------------------------------------SETIRNIRTGI--ML-S
A0A1E3X4X0      -------------------------------------------AEAIRNIRTNI--IF-T
A0A286U4B3      -------------------------------------------AEAVRNVRTGI--ML-S
A0A5C6DDS2      -------------------------------------------AEAVRNVRTGI--ML-S
A0A2E3GW02      -------------------------------------------AEAYRLIRGTL--LL-T
A0A5B9QNZ7      -------------------------------------------AEAYRHLRTAL--MF-S
A0A1Z8N7H5      -------------------------------------------VESFRTLRTSL-----T
A0A1G2YPI3      -------------------------------------------AEAYRTIRTAV--FF-G
A0A1U7CZ81      -----------------------------------------------------------H
A0A142YNY8      -----------------------------------------------------------H
A0A1U7GLS6      -----------------------------------------------------------H
A0A532UIN2      -------------------------------------------AEAYRTIRTAV--FF-G
A0A0S8KNX5      -------------------------------------------IGDYQTIRANL--GL-L
A0A3D3UVZ8      -------------------------------------------VGDYQTIRANL--KL-L
A0A517NFU9      -------------------------------------------SEVYRVARTAL--MV-T
A0A5C5YWH4      -------------------------------------------SEVYRVARTSL--MV-A
A0A3D2TNK4      -------------------------------------------TEAFRTLRTVL-----S
A0A7C1Y4F0      SARGTTVGGASWDKSKTPVASAAEKPDIVRRGQKVHLESKSVVAEAYRTIRTAV--FF-G
A0A6I0ENW6      -------------------------------------------QESIRMIRTAL--LE-R
A0A6L3A0B7      -------------------------------------------QESIRMIRTAL--LE-R
A0A0J1B4A0      -------------------------------------------AETFRVLRTSL--LF-L
A0A142WSB9      -------------------------------------------SEAYRSLRTTL--FF-S
M5SZR3          -------------------------------------------SESYRALRTTL--FF-H
M5TW92          -------------------------------------------SESYRALRTTL--FF-H
A0A2S8FKY2      -------------------------------------------ATVLR-----------R
A0A517N8P6      -------------------------------------------SEAVRSVRTSL--FPVA
A0A432MJP4      -------------------------------------------AEAYRALRTGL--EF-V
M5UQ35          -------------------------------------------AETFRVLRTGI--IF-R
A0A0S8FY64      -------------------------------------------TEAFRSIRTNI--YF-S
A0A1N6KFT7      -------------------------------------------AEAYRSVRTSL--EF-L
L0DFG4          -------------------------------------------AEAYRSVRTSL--EF-L
A0A5C5XXG1      -------------------------------------------AEALRLGRTML--LPKI
A0A7C7YUM8      -------------------------------------------AEAYRSIRASL--RQAL
A0A7C2AHI6      -------------------------------------------GEAYRSIRSNL--KFAL
A0A518BJJ1      -------------------------------------------AEAYRSLRANL--RFAV
A0A518D182      -------------------------------------------AEAYRSLRASL--RFAV
A0A5C5WTY6      -------------------------------------------RETFRLTRTIL--AQ-S
A0A5C5Y033      -------------------------------------------SEAFRLGRTIL--LP-D
A0A5C6G1Y2      -------------------------------------------SEAFRLGRTIL--LP-D
A0A354PDV6      -------------------------------------------AEAIRMMRTLL--LM-D
A0A5C6FZ02      -------------------------------------------AEALRLGRTML--LP-K
M5TIT3          -------------------------------------------AEAFRLGRTVL--LP-E
A0A5M6CY44      -------------------------------------------AEAFRLGRTMM--LM-D
F2AXG2          -------------------------------------------AEAFRLGRTVL--LP-D
M2BB46          -------------------------------------------AEAFRLGRTVL--LP-D
L7CLQ6          -------------------------------------------AEAFRLGRTVL--LP-D
A0A0J1B719      -------------------------------------------AEAFRLGRTVL--LP-D
Q7UF18          -------------------------------------------AEAFRLGRTVL--LP-D
A0A2G1W1E0      -------------------------------------------AEAFRLGRTML--LP-D
K5E235          -------------------------------------------AEAFRLGRTML--LP-D
A0A5C6FFI9      -------------------------------------------AEVYRVARTSL--MI-R
A0A5C5WDJ1      -------------------------------------------AEIFRVGRTSM--MI-A
A0A5C5X547      -------------------------------------------SESVRGIVAQL--IR-R
A0A353FIP5      -------------------------------------------AEAYRGLRANL--TF-A
A0A5B1CIK7      -------------------------------------------AEAFRLGRTVL--LP-E
A0A5C5WHS2      -------------------------------------------AEAFRLGRTVL--LP-E
A0A5C6B6G8      -------------------------------------------AEAFRLGRTVL--LP-E
A0A5C5ZZN3      -------------------------------------------AEAFRLGRTVL--LP-D
A0A5C5XS91      -------------------------------------------AEAFRLGRTML--LP-E
A0A5C6C4E6      -------------------------------------------AEAFRLGRTML--LP-E
A0A2E1VVJ1      -------------------------------------------AEAYRSLRASL--RF-A
A0A3M2AEL0      -------------------------------------------AEAYRALRANL--RF-L
A0A2A2W9R6      -------------------------------------------AETFRFVRTSL--LF-L
A0A518HKC1      -------------------------------------------SETFRVVRTSV--LF-L
A0A518L3P0      -------------------------------------------AETFRVIRTSI--LF-L
A0A255R1S0      -------------------------------------------AETFRVLRTTL--LF-M
A0A5B9MKP1      -------------------------------------------SETFRVVRTSV--LF-L
A0A0S8J591      -------------------------------------------AEAFRGIRTEV--ML-R
A0A351FYP6      -------------------------------------------AEAYRVLRTNI-LFA-G
A0A532UT69      -------------------------------------------AEAYKTIRTAI--FL-G
A0A2D5AWU0      -------------------------------------------AEAIRNLRTAT--TF-A
A0A1G2YQB7      -------------------------------------------ADDYHAICINL--GL-M
A0A353P687      -------------------------------------------ADDYHSICINL--GL-M
A0A356EME5      -------------------------------------------EESIDSMRTFL--VL-A
M5RT57          -------------------------------------------EESIDSLRVGL--LL-G
A0A356KTN1      -------------------------------------------AEAFRRARVQLNAVG-A
A0A518HFS8      -------------------------------------------IESVDAVRTAL--LR-A
L0DC26          -------------------------------------------IESVDAARTAL--LH-V
A0A3L7P4E4      -------------------------------------------AEAFRGVRTYL--MA-A
A0A3L7PEB5      -------------------------------------------AEAFRGVRTYL--LA-A
A0A1U9NL64      -------------------------------------------SEAYRTVRTAV--FF-G
A0A2N1UCJ3      -------------------------------------------AEAYRSIRTSV--FF-G
A0A7C4EK84      -------------------------------------------AEAYRTVRTAV--LF-G
A0A7C3F0T2      -------------------------------------------AETYRTIRTAI--YF-G
A0A2E0X4J3      -------------------------------------------SEAVRTLRTSF--HF-G
A0A5C5YU10      -------------------------------------------AEAFRTLRTAV--HF-G
A0A517MPZ6      -------------------------------------------AESFRTLRTAI--HF-G
A0A5C6CNV7      -------------------------------------------AEAFRTLRTAI--HF-G
A0A518K5H4      -------------------------------------------AEAIRTLRTAL--YF-G
A0A5C6AA28      -------------------------------------------AEAIRALRTSL--HF-G
A0A2E7ESJ6      -------------------------------------------AESYRAVRTAL--YF-N
A0A2E9VK20      -------------------------------------------AEACRSVRATF--FV-R
A0A3D4PJK1      -------------------------------------------AEACRSVRATF--FV-R
A0A355AI52      -------------------------------------------AESFRTIRTVL-----V
A0A354PCQ3      -------------------------------------------EESIDSLRANL--FL-S
A0A0S8GZ23      -------------------------------------------AEDYQTIRANL--GL-L
A0A1I3DDV4      -------------------------------------------AESFRLLRTYL--LR-E
A0A2E0SMM6      -------------------------------------------SEAFRTLRTAI-----S
A0A3L7SI46      -------------------------------------------AESFRTLRSSI-----T
A0A5B9PJZ8      -------------------------------------------CEAYRSIRTSI--FF-R
A0A2S8G191      -------------------------------------------AESVGGIVARL--FR-P
A0A2E7EGG1      -------------------------------------------EESIDSLRTGL--VL-S
A0A2E2N5A9      -------------------------------------------TETIRTIRTKL--EM-A
A0A7C8AGA2      -------------------------------------------ADDYQAIRANL--GL-L
A0A7C2FXP7      -------------------------------------------SDDYQTIRANL--EL-L
A0A2E3GWC6      -------------------------------------------AESCRSVRATF--FV-R
F0SLB0          -------------------------------------------AESCRSVRATF--FV-R
A0A3L7NDH9      -------------------------------------------SEGFRTLRTVL-----A
A0A1N6DAJ8      -------------------------------------------VESVDAARTTL--LH-V
A0A532UD06      -------------------------------------------AEAYRTLRTSI--FF-G
A0A660URN1      -------------------------------------------AEAYRTIRTAV--FF-G
A0A517ZCB5      -------------------------------------------SEAFRSLRTTL-----E
A0A225EH48      --------------------------------------------ESVNSARTML--LH-T
A0A518INW8      -------------------------------------------SEVLTMARTSL--FV-H
A0A518JPH9      -------------------------------------------SEVLTMARTSL--FV-H
A0A5C5VEK8      -------------------------------------------AEAFRTLRTAV--HF-G
A0A532UTJ0      -------------------------------------------VGDYQTIRANL--GL-V
A0A432MFP3      -------------------------------------------FEQFVQQLDHL--RV-A
A0A2E2CCW9      -------------------------------------------AEAFRSLRTSL--LL-K
A0A3C0AGX3      -------------------------------------------AEAFRSLRTSL--LL-K
A0A518AAQ5      -------------------------------------------AEAYRSLRTSL--LL-K
A0A517QBG9      -------------------------------------------AEAYRSLRTSL--LL-K
A0A518FTU3      -------------------------------------------AEAYRSLRTSL--LL-K
A0A517WHH5      -------------------------------------------AEAYRSLRTSL--LL-K
A0A5A8BGT3      -------------------------------------------AEAYRSLRTSL--LL-K
A0A2E7K7A9      -------------------------------------------AEAYRSLRTSL--LL-K
A0A517PTS5      -------------------------------------------AEAYRSLRTSL--LL-K
A0A6I6AH34      -------------------------------------------AEAYRSLRTSL--LL-K
A0A517VTK3      -------------------------------------------AESFRSLRTSL--LL-K
A0A517WQT4      -------------------------------------------AESFRSLRTSL--LL-K
A0A517VID8      -------------------------------------------AEAFRSLRTSL--LL-K
A0A517RK10      -------------------------------------------AEAFRSLRTSL--LL-K
A0A518IH18      -------------------------------------------AEAFRSLRTSL--LL-K
A0A5C5XLF4      -------------------------------------------AEACRSVRATF--FV-R
A0A2D5NDU9      -------------------------------------------AEAARTLRTAI--YF-G
A0A1P8WP26      -------------------------------------------AESFRGLRTNL-----E
A0A3L7V1F3      -------------------------------------------VEAFRALRTSI-----E
D5SZ21          -------------------------------------------TEAFRTLRTAI-----Q
A0A286RGB6      -------------------------------------------SESVRKVAARI--IR-E
A0A518CHE5      -------------------------------------------SEAFRTLRTAI-----S
A0A1V5N3W2      -------------------------------------------VSDYQTIRSNL--RL-L
A0A3E0MY27      -------------------------------------------DESVDSIRSLL--LH-S
A0A7C4Z5R7      -------------------------------------------TESVDATRTLL--LH-A
A0A2E0X9P6      -------------------------------------------AESIDSLRTQL------
A0A286RLF2      -------------------------------------------SESFRTLRTAL-----A
A0A517NSK8      -------------------------------------------AEIYRVIRTSM--LM-S
A0A5C5Z0D6      -------------------------------------------AEVFRVMRTGL--LV-E
M5UE94          -------------------------------------------AEVFRVLRTGL--LV-A
A0A2E8FLY0      -------------------------------------------TEAFRTLRTAL-----A
A0A3D2U1E1      -------------------------------------------NEAFRTLRTTL-----A
E8R3W3          -------------------------------------------RESINEIRSHV--LH-A
A0A5C5ZM48      -------------------------------------------ADGFKGIRV--------
A0A5B9WF77      -------------------------------------------IDRFIQRLDHL--RF-A
A0A518BBX8      -------------------------------------------AEAYRGLRTAL--YF-S
A0A1P8WN28      -------------------------------------------AECFRTLKTSI-----T
A0A3B9CTT0      -------------------------------------------AEAFRTLKTAV-----T
A0A518ALT3      -------------------------------------------TESIDSLRTTL-----A
A0A3M1QRP3      -------------------------------------------SECVRMVRTAL--LQ-R
A0A517TMV0      -------------------------------------------SEAFRTLRTAI-----T
A0A3E0MY88      -------------------------------------------CEAFRTLRTAL-----S
A0A5B9QF68      -------------------------------------------TEAFRTLRTAI-----S
A0A5B9QGF0      -------------------------------------------TEAFRTLRTAI-----S
A0A5C6CK24      -------------------------------------------TEAFRTLRTAI-----S
A0A2E3RCU8      -------------------------------------------VESFRTLRTSL-----A
A0A1C3E6N1      -------------------------------------------TEAFRTLRTAI-----Q
A0A518GJT2      -------------------------------------------TEAFRTLRTAI-----Q
A0A2E8B0L9      -------------------------------------------SEAFRTLRTTL-----A
A0A5Q4GFE7      -------------------------------------------SEAFRTLRTTL-----A
A0A257WS34      -------------------------------------------AECFRTLRSAI-----S
A0A7C4LP10      -------------------------------------------SECFRTLRSAI-----T
A0A517MLW3      -------------------------------------------SEAFRTLRAGL-----M
A0A5B9QVD0      -------------------------------------------SEAFRTLRAGL-----M
A0A3A0DET7      -------------------------------------------AEAIRTLRTAL--HF-G
A0A3B8PNV4      -------------------------------------------TEAFRTLRTAL-----S
A0A3D1DR40      -------------------------------------------TEAFRTLRTAL-----S
A0A2E7RYU8      -------------------------------------------TEAFRTLRTAL-----S
A0A3B8LXG8      -------------------------------------------TEAFRTLRTAL-----S
A0A286RD13      -------------------------------------------IESVDQLRTIL--LH-R
A0A2E3GWX1      -------------------------------------------TEAFRTLRTAI-----E
F0SG60          -------------------------------------------TEAFRTLRTAI-----E
A0A2E9VST2      -------------------------------------------TEAFRTLRTSI-----E
A0A356A6X2      -------------------------------------------TEAFRTLRTSI-----E
A0A5C5XLM3      -------------------------------------------TEAFRTLRTSI-----E
A0A7C5FXU1      -------------------------------------------SLVARLLREN-------
A0A3M1VCL4      -------------------------------------------TEAFRTLRLKL-----M
A0A5C5V7Z9      -------------------------------------------AEAFRTLRTSL-----T
A0A5C5YT05      -------------------------------------------AEAFRTLRTSL-----T
A0A518D7F9      -------------------------------------------AEAFRTLRTAL-----T
A0A5C5ZIP0      -------------------------------------------SEAFRTLRTAI-----A
A0A518KBK3      -------------------------------------------SESFRTLRTAI-----T
A0A5C6AKF9      -------------------------------------------SEAFRTLRTAI-----T
A0A6M5Z0K7      -------------------------------------------AESVDALRTTL--LH-L
A0A350CI62      -------------------------------------------VEPFRALRTSI-----E
A0A4P5WQK6      -------------------------------------------VEPFRALRTSI-----E
A0A3C1X4W5      -------------------------------------------VEAFRALRTSI-----E
A0A3D3W3A7      -------------------------------------------VEAFRALRTSI-----E
A0A518DRX3      -------------------------------------------SEAFRTLRTVL-----S
A0A518DZF9      -------------------------------------------SEAFRTLRTVL-----S
A0A518AKT8      -------------------------------------------SEAFRTLRTSL-----S
A0A5C5ZR72      -------------------------------------------AESINALRTSL-----V
A0A7C5R0U3      -------------------------------------------AEAFRTLRTTL-----Y
A0A517TY85      -------------------------------------------AESIDSLRTQL-----L
A0A5B9QEI7      -------------------------------------------TESIDSLRTQL-----M
F0SI78          -------------------------------------------AEAYRLIRGTL--LL-T
A0A517MDV3      -------------------------------------------AEAYRHLRTSL--LF-R
A0A518IQ30      -------------------------------------------SEAFRTLRTSL-----S
A0A517LWP4      -------------------------------------------SEAFRTLRTSL-----S
A0A518JNW8      -------------------------------------------SEAFRTLRTSL-----S
A0A2E7ENQ5      -------------------------------------------SESFRTLRSTL-----A
A0A7C2KUQ9      -------------------------------------------TEHVRMIRTAL--LE-R
A0A7C5BZF0      -------------------------------------------SEAFRTLRTAL-----A
A0A1G3AQE9      -------------------------------------------VEAFRTLRTAL-----S
A0A3L7UQT9      -------------------------------------------TEAFRTLRTAI-----S
A0A4P5YBU2      -------------------------------------------TEAFRTLRTAI-----S
A0A7C7V5U8      -------------------------------------------SEAFRTLRTAL-----S
                                                                            

A0A5S9IPR9      EEQTKNKT-----FVITSALAQDGKTTIFCNLALMMAKA-GHK-VLLIDGDLRRPRLR--
A0A533Q9U4      HPDKPKKV-----ILVTSSAPSEGKSLISANLAIVMAQT-GKK-VLLIDADLRKPTMH--
A0A1U9NNE1      LEEENQHI-----LAVTSSQPKDGKTTFSINFAASLAQN-DRK-VLLIDGDLRKPDIA--
A0A2G2JCA2      NNSDDIKV-----IVVSSACSREGKTSVACQLAISLARSSGRK-TLLIDGDMRSPDIH--
A0A533Q6B7      HPDNPKKT-----LLISSAIPSEGKTLLTSNLGVVMAQT-GKK-VLLVDADLRNPSLH--
A0A5S9IJB5      FSIEKNST-----FFVTSPVPGDGKSFCAANLSVAFTQN-DAK-VLLIDADMRKSRQH--
A0A1G2XVR0      TTDTPHKS-----LLITSTKQGEGKSFIAANLAIAFAQT-GKK-TLLVDTDFRKPRQH--
A0A1G3B0P0      TTDTPHKS-----LLITSTKQGEGKSFIAANLAIAFAQT-GKK-TLLVDTDFRKPRQH--
A0A1E3X4X0      ATDTPRKL-----IMIASANPDEGKTFFVSNLATVIAHT-GKK-VLMVDTDMRKPRLN--
A0A286U4B3      SADNPKRI-----MLVTSTTPSEGKTFVASNLAIVIAKT-GKK-TLIVDCDFRKPRVH--
A0A5C6DDS2      STDNPKKI-----ILVTSTTPGEGKTFVAGNLAIVIAKT-GKK-TLIVDCDFRKPRVH--
A0A2E3GW02      MGGERARV-----IQFTSPDPGDGKSTTCSNIALATANS-GKR-TLVIDLDLRRPTVH--
A0A5B9QNZ7      PGGKDLRL-----LQMTSPNPGDGKTLTTVNLAASLGQT-GKR-VLLIDCDLRRPRVG--
A0A1Z8N7H5      LSGVDSTR-----IAFTSSEPGDGKTTVIANLAVVCAQS-GKK-TLLIDGDLRRPGLT--
A0A1G2YPI3      APKDEAKT-----ILVTSPMPADGKTTLASNMAIAMAQA-GQR-VLILDADFRKPMQH--
A0A1U7CZ81      PEVGLGRC-----VLITSAIGGEGKTTLAAQLAARCGHA-GHS-TLLIDADLRRGSLC--
A0A142YNY8      PEVGLGRC-----VLISSAVGGEGKTTLAAQLAARCGHS-GHS-TLLIDADLRRGALS--
A0A1U7GLS6      PDVGLGRC-----VLISSAVGGEGKTTLAAQLAARCGHS-GHA-TLLIDADVRRGALS--
A0A532UIN2      APKNQAKT-----ILVTSPAPADGKTTLVSNLAIAMAQA-GQK-TLIIDGDFRKPMQQ--
A0A0S8KNX5      GGEGIPKK-----LVITSPGMKEGKTTFAINLATSIAES-GKR-VLLVDGDLRKPDVA--
A0A3D3UVZ8      GGRGIPKK-----LVVTSPGMKEGKTTFSVNLATSLSES-GKK-VLLIDGDLRKPDVA--
A0A517NFU9      NRKDDVRT-----IMMTSPQPGDGKSTTISNLAISFARA-GKS-VLLIDADMRRPVIA--
A0A5C5YWH4      NRKTNVRT-----MMMTSPQPGDGKSTTISNLAVSFARA-GKK-VLLIDADMRRPVIA--
A0A3D2TNK4      LSEQNCER-----ILISSSEPGDGKTTISANLSVALAQA-GHR-TLVIDADLRRPGFT--
A0A7C1Y4F0      APKEGAKT-----ILITSPAPGDGKSTLASNIAISMAQA-GQK-TLLIDADFRKPVQH--
A0A6I0ENW6      CSVRQGYT-----VLITSPNVGTGKTTFAMLLARSLAHV-GKR-VLLVDTDIRRSSLS--
A0A6L3A0B7      CSVRQGYT-----VLITSPNVGTGKTTFAMLLARSLAHV-GKR-VLLVDTDIRRSSLS--
A0A0J1B4A0      TKSQSKKV-----FLLTSPSPSDGKSTTIANLAVSVAQT-GKR-VLLIDADMRRPTVA--
A0A142WSB9      TRETGEKV-----IQVCSAEPGDGKSTTTANLAVALAQS-GKS-VVLIDADLRRPTVH--
M5SZR3          NRSREQSV-----IQVTSACPGDGKSTVAGNLGVSIAQS-GKR-VLLIDADLRKPRQH--
M5TW92          NRSREQSV-----IQVTSACPGDGKSTVAGNLGVSIAQS-GKR-VLLIDADLRKPRQH--
A0A2S8FKY2      SLSEQCQV-----LLISSAMPREGKSSLTCHLAISLAQA-GRK-VVVVDFDLRRPSMH--
A0A517N8P6      GAPPEYQV-----LQITSALPGDGKSTVAANLAASVARA-GKR-VLLIDADLRRPTQA--
A0A432MJP4      RRERDVRV-----IVVCSPSPGDGKSTVTSNLAIGLAQA-GRR-VLLIDCDLRKPSQD--
M5UQ35          CKSEGKRA-----FMITSPSPADGKSTMIVNLAASMAQT-GKR-VLLVDADMRRPTVA--
A0A0S8FY64      GQRGEMKT-----LMVTSAAPQDGKTVFAANLATTMAQD-GKR-VLLVDADLRRPALH--
A0A1N6KFT7      RRSRQVQL-----ILVTSAHSGDGKTTTASNLAISFAMA-GRK-VLLVDGDLRKPAQH--
L0DFG4          RRSRQVQV-----ILVTSSHSGDGKTTTASNLAISFAMA-GRR-VLLVDADLRKPSQH--
A0A5C5XXG1      KSRD-MRS-----IGVTSSMQGDGKSTITANLAASFSQV-GLS-VLVVDGDLRRPTVH--
A0A7C7YUM8      DGDGALKT-----LACTSCFQGEGKTVTNADLAIVFAKA-GRR-VLLVDCDLRKPQLH--
A0A7C2AHI6      EPDSVLRT-----VAVTSSAPGEGKTTTNANLAATFALG-GAK-VLLVDADVRRPAVH--
A0A518BJJ1      GDVNALRT-----MAATSCAPGEGKSTTNIDIAWAFASG-GRR-VLLVDADMRRPSVH--
A0A518D182      GDLGQMRT-----LAVTSSAPGEGKSTTNIDLAWCLASP-SRR-VLLVDADLRRPSVH--
A0A5C5WTY6      IQSRGIHS-----MGITSPTPGDGKSTMVSHLSTSFIRS-GMR-VLLIDADLRRPTIH--
A0A5C5Y033      IKSKKVRS-----IGFTSSMQGDGKSTIVANFAQAFAQV-GLN-VVVVDCDLRRPSQH--
A0A5C6G1Y2      IKSKKVRS-----IGFTSSMQGDGKSTIVANFAQAFAQV-GLN-VVVVDCDLRRPSQH--
A0A354PDV6      VKSKKLQT-----IAMTSPMQGDGKSTVISNLAVSFSQL-GMS-VLVMDCDLRRPSIH--
A0A5C6FZ02      IKSRDMKS-----IGVTSSMQGDGKSTITANLAASFSQV-GLS-VLVVDGDLRRPTVH--
M5TIT3          IRSGKLRT-----IGFTSSMQGDGKSTVAANFAVSFSQI-GLR-VLVIDADMRRPGVH--
A0A5M6CY44      IKAGKLKT-----IGFTSPLQGDGKSTIMSNFAVSFAQV-NLK-VLVIDADLRRPTVH--
F2AXG2          IRSGKVRA-----IGFTSPMQGDGKSTVVSNFAVSFSQV-GLK-VLVIDADLRRPSAH--
M2BB46          VRNGNVRA-----IGFTSPMQGDGKSTVVSNFAVSFSQV-GLK-VLVIDADLRRPSAH--
L7CLQ6          IRKENVRA-----IGFTSPMQGDGKSTVVSNFAVSFSQI-GLK-VLVIDADLRRPSAH--
A0A0J1B719      IRSGSVRT-----IGFTSPMQGDGKSTVVSNFAVSFSQV-GLK-VLVIDADLRRPSAH--
Q7UF18          VRNGNVRA-----IGFTSPMQGDGKSTVVSNFAVSFSQV-GLK-VLVIDADLRRPSAH--
A0A2G1W1E0      IRNGNVRA-----IGFTSPMQGDGKSTVVSNFAVSFSQV-GLK-VLVIDADLRRPSAH--
K5E235          IRNGNVRA-----IGFTSPMQGDGKSTVVSNFAVSFSQV-GLK-VLVIDADLRRPSAH--
A0A5C6FFI9      ADGSDTKV-----LMMSSPHPGDGKSTTISNLAISFAQA-GKR-VLLIDSDLRRPVIA--
A0A5C5WDJ1      NRKGSVQT-----IMVTSPQPGDGKSTTISNMAISFAQT-GKK-VLLIDADMRRPVIA--
A0A5C5X547      KASENQNC-----IMVSSATAGEGKTTASVEISRMLARS-GQK-TVLIDFDLRRPRIH--
A0A353FIP5      AKRNEIKS-----LAITSASQGEGKSTTIADLAISLANS-GAT-VLLVDADLRRPSIH--
A0A5B1CIK7      VRSGKLRT-----IGFTSPMQGDGKSTVCSNFAVSFSQI-GLR-VLVIDADLRRPSAH--
A0A5C5WHS2      IRSGELRV-----LGFTSPMQGDGKSTVTSNFAVSFSQI-GLK-VLVIDADLRRPSVH--
A0A5C6B6G8      IRSGKLQT-----IGFTSPMQGDGKSTVTSNFAVSFAQL-GLK-TVVVDADLRRPSIH--
A0A5C5ZZN3      IRSGKIRT-----IGFTSPMQGDGKSTVASNFAVSFSQI-GLR-VLLIDADLRRPSAH--
A0A5C5XS91      IRSGALRT-----IGFTSPMQGDGKSTVVSNFAVSFSQI-GLK-ILIIDADLRRPSAH--
A0A5C6C4E6      IRSGALRT-----IGFTSPMQGDGKSTVVSNFALSFSQI-GLK-VLVIDADLRRPSAH--
A0A2E1VVJ1      TGGREIRT-----MAITSAGQGEGKSTTLADLAIALAQG-GKK-VLLVDADLRRPVVH--
A0A3M2AEL0      AKGQAIKT-----LAITSSVQGEGKSVTTCDLAVALAQT-GAR-VLLVDADLRRPVVH--
A0A2A2W9R6      AKKQSKQV-----FLVTSPSPSDGKSTTIANLAVSMAQA-GKR-VLLVDADLRRPMVA--
A0A518HKC1      AKKQSKQV-----FLLTSPSPSDGKSTTIANLAVSMAQA-GKR-VLLVDADLRRPTVA--
A0A518L3P0      AKKQSKQV-----FLITSPSPSDGKSTTIANLAVSMAQA-GKR-VLLVDADLRRPMVS--
A0A255R1S0      AKRQSKKI-----FMITSPSPADGKSTTIANLAVSMAQT-GKR-VLLVDADMRRPTIA--
A0A5B9MKP1      AKKQSKQV-----FLLTSPSPADGKSTMVSNLAVSMAQA-GKR-VLLVDADMRRPTID--
A0A0S8J591      SDLRQVKT-----GMVTSTSPQEGKTTVAVNWAITLAQA-GNK-VLLIDGDLRKPMIH--
A0A351FYP6      RKSEDQTT-----FTVVSGGAGEGKTTTMFNLAVVFAQM-GDR-ILVVDSDLRRPSMH--
A0A532UT69      VPNGKAKT-----ILVTSPESAEGKTTMVSNLAISMAQA-GEK-TLILDADFRNPVQHLV
A0A2D5AWU0      LPKDSHGV-----VLVTSSVSGEGKSVTASNLAFALATG-GRR-TLLIDGDLRMPSLH--
A0A1G2YQB7      NNCTIPNK-----LAITSAGPQEGKSTLAVNLAMNLAKI-GKK-VLLIDGDLRKPDIA--
A0A353P687      NNCTIPNK-----LVISSASPREGKSTLAVNLATNLAKI-GKK-VLLIDGDLRKPDIA--
A0A356EME5      EEIKGARV-----LAVTSAASNEGKTSVAAQLALSLARASGKP-TLLIDGDMRAPDIQ--
M5RT57          EKHNDIQT-----LVVTSAVHGEGKSSISSQLAVSIGRATGEP-VLLIDGDLRAPDIH--
A0A356KTN1      FPSEGCGV-----LLCVSGIPREGKTLSALNLAIASAQA-GRR-TLLIDADMRSPRVH--
A0A518HFS8      SQVEPLQV-----IMVTSATKGEGKSSLSCHLATSLARA-GRR-TLLLDCDLRSPAIH--
L0DC26          SRTESVRV-----VMVASALGGEGKTSLSSHLATSLARA-GRR-TLLVDGDLRRPSAH--
A0A3L7P4E4      TRGEGHRI-----VLLTSPEPGDGKSTMSSNLAVTLAQT-GKS-VLLIDADMRRPTVK--
A0A3L7PEB5      TRGAGHSI-----VLLTSPEPGDGKSTMSSNLAVALAQT-GKS-VLLIDADMRRPTVK--
A0A1U9NL64      VPKESCKT-----ILVTSPQPAEGKSTLISNLGITMAQA-GQK-TLIVDADFRRPKQH--
A0A2N1UCJ3      VPKGQART-----ILITSPAPSDGKTTMVSNLAIAMAQA-GQK-TLIVDADFRKPMQH--
A0A7C4EK84      LPAGAARK-----MLVTSPTPGDGKTVCVSNLAIAMAQA-GQR-VLLLDADFRRPSQQ--
A0A7C3F0T2      VPNGQARK-----IVVTSPEPGDGKTTLVSNLGIAMAQA-GQR-TLIIDGDFRKPMQH--
A0A2E0X4J3      LGGPDVRA-----VCVTSPTAGDGKSTVASNLAIAMARA-GQR-TLLIDADMRKPRQH--
A0A5C5YU10      LAGDDCKV-----LVVTSPSPGDGKSVVTSNLAIATDQA-DRR-TLLIDADMRKPTQH--
A0A517MPZ6      LTRDDAKV-----IAITSPSPGDGKSVVASNLALTMAQA-DQR-VLLIDADMRKPKQH--
A0A5C6CNV7      LARDDAKI-----ICVTSPSPGDGKSTVASNMAIAMAQA-DQR-VLLIDADMRKPTQH--
A0A518K5H4      IG-GESKT-----FVVTSPAPGDGKSTVASNLAIAMAQA-NQR-VLLIDADMRKPTQH--
A0A5C6AA28      LA-GDART-----YVVTSPAPGDGKSTVASNLAIAMAQA-NQR-VLLIDADMRKPTQH--
A0A2E7ESJ6      SRGERHQV-----IQVTSPMPGDGKSTLASNLAVTIAQS-GKS-VLLLDADFRRPTQH--
A0A2E9VK20      AADVDAHI-----IQFTSSEPGDGKTTTISNLAISIAQA-GKR-VLLIDADLRKPMVH--
A0A3D4PJK1      AADVDAHI-----IQFTSSEPGDGKTTTISNLAISIAQA-GKR-VLLIDADLRKPMVH--
A0A355AI52      MGTEDSER-----IAVTSAEPGDGKTTISSNLAIAYQQA-GKR-VLIIDADMRKPGLT--
A0A354PCQ3      TRWKDTRS-----IAVVSSISGEGKSSVASQLSLSIAKA-TGQTVLLVDADLRCPDQH--
A0A0S8GZ23      SNGKIPHK-----MVVTSSGVREGKSTFAVNLATSLAQA-GKR-VLLIDGDLRKPDIE--
A0A1I3DDV4      VKAGNLRT-----AMITSSQAKDGKSTILANLGASFAEL-GLK-VLIIDGDMRAPTIH--
A0A2E0SMM6      FNTHESRR-----LLVTSTEKSDGKTTVMANLAVAFAQA-NKK-TLIVDTDMRRPGMT--
A0A3L7SI46      FSTSNTQR-----LVMTSTEPGDGKTTTLANLSVAFAQA-KKK-TLLIDADLRRPGMT--
A0A5B9PJZ8      AQETGAKI-----IQMTSPTPGDGKSTTIANLAASMAQS-GRK-VLLIDADLRKPRQH--
A0A2S8G191      SATRQYRV-----VMISSALAGEGKTTLAGQIAYALAES-GAR-TILVDFDLRRPALD--
A0A2E7EGG1      QKNESIQV-----VVVSSSVAGEGKSSVASQLAVSLARS-SGMPTLLIDGDMRSPDIH--
A0A2E2N5A9      NTDHYSQV-----IVTTSALPGEGKSTLSANLAHALAQL-GK--VILIDADLRKPTLA--
A0A7C8AGA2      DGDSASKI-----IVVTSPGIGDGKTTFSVNLATSFAQS-GEK-VLLIDGDLRKPDIA--
A0A7C2FXP7      NGDDLTRI-----IAVTSPGMGEGKTTFALNLATSFAQK-GEK-VLLIDGDLRKPGIA--
A0A2E3GWC6      ASDAGARI-----IQFSSPEPGDGKTTTISNLAISMAQA-GKK-VLLIDADLRRPMVH--
F0SLB0          ASDAGARV-----IQFSSPEPGDGKTTTISNLAISMAQA-GKK-VLLIDADLRRPMVH--
A0A3L7NDH9      MNGSQSQR-----IAISSSEPGDGKTTASTNLAVAYSQA-GKR-VLLIDADMRKPGLT--
A0A1N6DAJ8      SRTESVRV-----VMVASALSGEGKTSLSSHLATSLARA-GRR-TLLIDGDMRRPSAH--
A0A532UD06      VPKGGAKT-----ILVTSPAPGDGKTTLVSNLAIATAQA-GQG-TLVIDADLRKPRQH--
A0A660URN1      VPKGQAKT-----IVITSPAPGDGKSTLASNLALTMAQA-GQR-TLVLDADFRKPVQH--
A0A517ZCB5      FSNEDTKC-----MTISSTEPGDGKTTVMASLGVAFAQS-GRR-TILIDGDMRRPGLT--
A0A225EH48      AKTQNMQV-----LMVTSAMQGEGKTSLASQLATSMATA-GLR-TLVLDCDLRNPSLH--
A0A518INW8      AGQTNDNV-----IQVTSPMPGDGKSTMTVNLAAAIAKA-GKR-VLLIDADLRRPTLY--
A0A518JPH9      TGQTDENV-----IQVTSPMPGDGKSTMTVNVAAAIAKA-GKR-VLLIDADLRRPTLY--
A0A5C5VEK8      LAGDDCKV-----LVVTSPSPGDGKSVIASNLAIATDQA-DRR-VLLIDADMRKPTQH--
A0A532UTJ0      GDKGIPRK-----LVITSPGMKEGKTTFAVNLATSMAES-GKK-VLLIDGDLRKPDVA--
A0A432MFP3      LCGEGGQDGRGRCVLITSAVGGEGKTTLAAQLAVRCAEA-GAS-TVLIDADLRRATLG--
A0A2E2CCW9      TDRSGAKV-----LQMTSAEPGDGKTTSISNLALAIAQT-GRK-VLIVDADLRRPTIH--
A0A3C0AGX3      TDRSGAKV-----LQMTSAEPGDGKTTSISNLALAIAQT-GRK-VLIVDADLRRPTIH--
A0A518AAQ5      TDRSGAKV-----LQVTSAEPGDGKTTSVSNLAMAIAQT-GRK-VLIIDADLRRPTVH--
A0A517QBG9      TDRSGAKV-----LQVTSAEPGDGKTTSVSNLAMAIAQT-GRK-VLIIDADLRRPTVH--
A0A518FTU3      TDRSGAKV-----LQVTSAEPGDGKTTSVSNLAMAIAQT-GRK-VLIIDADLRRPTVH--
A0A517WHH5      TDRTGARV-----LQVTSAEPGDGKTTSVSNLALAIAQT-GRK-VLIIDADLRRPTVH--
A0A5A8BGT3      TDRTGARV-----LQITSAEPGDGKTTSVSNLALAIAQT-GRK-VLIIDADLRRPTVH--
A0A2E7K7A9      TERNGAKV-----LQVTSAEPGDGKTTSVSNLALAIAQT-GRK-VLIIDADLRRPTVH--
A0A517PTS5      TERNGAKV-----LQVTSAEPGDGKTTSVSNLALAIAQT-GRK-VLIIDADLRRPTVH--
A0A6I6AH34      TDRTGARV-----LQITSAEPGDGKTTTVSNLALAIAQT-GRK-ALIIDADLRRPTVH--
A0A517VTK3      TDQSGAKV-----LQMTSAQPGDGKTTSISNLALAIAQT-GRK-VLIVDADLRRPTIH--
A0A517WQT4      TDQSGAKV-----LQMTSAQPGDGKTTSISNLALAIAQT-GRK-VLIVDADLRRPTIH--
A0A517VID8      TDRSGAKV-----LQMTSAEPGDGKTTSISNLALAIAQT-GRK-VLIVDADLRRPTIH--
A0A517RK10      TDRSGAKV-----LQMTSAEPGDGKTTSISNLALAIAQT-GRK-VLIVDADLRRPTVH--
A0A518IH18      TDRSGAKV-----LQMTSAEPGDGKTTSISNLALAISQT-GRK-VLIVDADLRRPTVH--
A0A5C5XLF4      AADVDAHI-----IQFTSSEPGDGKTTTISNLAISIAQA-GKR-VLLIDADLRKPMVH--
A0A2D5NDU9      LAQIEGTS-----IQITSAEPGPGKSTIASILAIAMAKA-GHR-TLLIDGDLRKPVQS--
A0A1P8WP26      FAGGDTGR-----IVCTSTEPGDGKTTISSNMAVAFAQS-GRR-TLIIDADMRRPGLS--
A0A3L7V1F3      FSPQETNR-----LVCTSTEPGDGKTTVSSNLAVAFAQS-GKR-TLIIDADMRRPGLS--
D5SZ21          FAGDDIRR-----LVITSTEPGDGKTTVSTNLAVAYAQS-GRR-TIIIDCDMRRPGLS--
A0A286RGB6      SEHERLQV-----IMVTSAVPGEGKTTLASQLAASLAQM-GQK-TVILDFDLRRPSLH--
A0A518CHE5      FSSHESRR-----LLVTSTEKSDGKTTVMANLAVAFAQS-NKK-TLIVDTDMRRPGMT--
A0A1V5N3W2      SDGEIPKI-----LVVTSPASGDGKTTLAINLSLSLAQT-GQK-VLLIDGDLRKPDIA--
A0A3E0MY27      ASCESVQV-----VMVTSANSGEGKTTISSSLAASLGRS-GRR-TLLIDGDMRRPAVH--
A0A7C4Z5R7      AQADGTRV-----VMISSAVAGEGKTSLTCQLGASLARA-GQR-TLIVDFDLRKPSLH--
A0A2E0X9P6      MLTQGLGVGGVRVLAVASAGSGEGKTSVATSLAVSFAKA-TQHATLIIDADLRAPSAA--
A0A286RLF2      LSDRPTGA-----VVVTSTQPGDGKSTVSANLALTYAHV-GKR-TLLVDGDLRRPGLT--
A0A517NSK8      AKAKDQRI-----IQVTGPLPGDGKSTTSANLAVAFAQA-GKR-VLLIDADLRKPRVA--
A0A5C5Z0D6      AKAKGLHV-----FQVTSPLPGDGKSTTSVNLATAFAQT-GKR-TLIIDADLRKPRVG--
M5UE94          ARKNGHQV-----IQVTSPLPGDGKSTTSVNLAMAFAQT-GKR-TLIVDADLRKPRVA--
A0A2E8FLY0      FSSNPTTR-----LAVTSTEPGDGKTTILANLAVAFAQS-GKK-TLLIDADMRRPGMT--
A0A3D2U1E1      FSSEPTAR-----LVVTSTEPGDGKTTVLANLAVAFAQS-GKR-TLLIDADMRRPGLT--
E8R3W3          NMPTPPRV-----LLVTSSMPREGKTTLSSYLAVSMASC-GHR-TLLVDCDFRRPMSH--
A0A5C5ZM48      -------------VSVMSAMKNEGKTSLSSQLSICLAEA-GGK-TLLIDGDLRSPDIH--
A0A5B9WF77      VCGEPHDAEMGRCVLVTSAIGGEGKTTLAAQLAARCGNA-GIS-TLLIDADLRRASLC--
A0A518BBX8      MNAHNQNV-----VQVTSPNAGDGKSTTASNLAITFAQL-GRK-TLLIDADLRKPRVH--
A0A1P8WN28      LSPMDTKC-----IAITSTEASEGKTTTTVNLAASYAQT-GQR-TLLIDADMRRPGLS--
A0A3B9CTT0      LTAQQSKC-----LAVTSTDAGEGKTVTTVNLAASFAQT-GQK-TLLIDADMRRPGLS--
A0A518ALT3      LTEGVGVRDCHKTVAVCSGVSGEGKTNISTALAMSIAHA-SKMPTLIIDADLRSPDVS--
A0A3M1QRP3      LPHDRCNV-----IQITSASPGAGKTTFAIMLAKSLAHI-GKR-VLLVDADLRNPSIA--
A0A517TMV0      LGAEVSDR-----LVISSSEPSDGKTTISSNLAVSYAQT-GKR-TLLIDCDLRKPGLT--
A0A3E0MY88      FNPEETQR-----LVVSSAEPGDGKTTVLSNLGTSIAQS-GKK-VLMIDADLRRPGLT--
A0A5B9QF68      LSGVACGR-----LLISSSEPGDGKTTISVNLSVAMAQA-GKR-TLVIDADLRKPGFT--
A0A5B9QGF0      LSGTSCER-----LLISSSEPGDGKTTISVNLSVAMAQA-GKR-TLVIDADLRKPGFT--
A0A5C6CK24      LSGSSCDR-----LLISSSEPGDGKTTISVNLSVAMAQA-GKR-TLVIDADLRKPGFT--
A0A2E3RCU8      LSAAESTR-----LALTSSEPGDGKTTVIANLAVVYAQS-GKR-TLLIDGDLRRPGLT--
A0A1C3E6N1      FAGDDIRR-----LVITSTEPGDGKTTVSTNLAVAYAQS-GRR-TIIIDCDMRRPGLS--
A0A518GJT2      FAGDDIRR-----LVITSTEPGDGKTTVSTNLAVAYAQS-GRR-TIIIDCDMRRPGLS--
A0A2E8B0L9      FSGQDLQR-----IAITSSEPSDGKTTVLTNLAVSYAQA-GKR-TLLIDCDLRRPGLT--
A0A5Q4GFE7      FSGSDLER-----IAITSTEPSDGKTTVLANLAVSYAHS-GKR-TLVIDADLRRPGMT--
A0A257WS34      FCAGDTHR-----LCVTSTEPGDGKTTTLANLAVAFAQA-GKK-TLLIDADLRRPGMT--
A0A7C4LP10      FCAGDTQR-----LVITSTEPGDGKTTTLANLAVAFAQA-KKK-TLLIDADLRRPGLT--
A0A517MLW3      LNPAKPRL-----IAVSSSEPGDGKTTISSNLAVGLAQA-GKR-TLVIDADLRKPGMT--
A0A5B9QVD0      LNPDQPRL-----IAVSSSEPSDGKTTVSSNLATSLAQA-GKR-TLLIDADLRKPGMT--
A0A3A0DET7      MAGEDVKV-----LAITSPMPGDGKTTIASNLALAMAQA-DQR-VLLIDADLRKPSQH--
A0A3B8PNV4      FAGRPTQQ-----LVITSTEPGDGKTTVLANLGVAFAQS-GKR-TLVIDADMRRPGLT--
A0A3D1DR40      FAGRPTQQ-----LVITSTEPGDGKTTVLANLGVAFAQS-GKR-TLVIDADMRRPGLT--
A0A2E7RYU8      FAGRPTQQ-----LVVTSTEPGDGKTTVLTNLGVAFAQS-GKR-TLVIDADMRRPGLT--
A0A3B8LXG8      FAGRPTQQ-----LVVTSTEPGDGKTTVLTNLGVAFAQS-GKR-TLVIDADMRRPGLT--
A0A286RD13      AERQGLKV-----VLVTSALAREGKTTLVAQLATSLARA-GRR-VVVVDGDLRRPRLH--
A0A2E3GWX1      FASETHQR-----ISISSTEPSDGKTTVISNTAVAFAQA-GRR-TLLIDGDMRRPGLT--
F0SG60          FASETHQR-----ISISSTEPSDGKTTVISNTAVAFAQA-GRR-TLLIDGDMRRPGLT--
A0A2E9VST2      FACENHQR-----ISITSTQPSDGKTTVISNTAVAFAQA-GKK-TLVIDGDMRRPGLT--
A0A356A6X2      FACENHQR-----ISITSTQPSDGKTTVISNTAVAFAQA-GKK-TLIIDGDMRRPGLT--
A0A5C5XLM3      FACENHQR-----ISITSTQPSDGKTTVISNTAVAFAQA-GKK-TLIIDGDMRRPGLT--
A0A7C5FXU1      -ESNPPRV-----IVVTSAESSEGKTTVAGQLAIGLAQL-GHS-TLLVDFDLRRPHVD--
A0A3M1VCL4      FSETPAQR-----LVVSSTEPGDGKTTVLSNLAVAFAQA-GKR-TLLIDADLRRPGMT--
A0A5C5V7Z9      LRGDETER-----LVISSAEPSDGKTTVTSNLGVAFAQI-GKR-TLIIDADLRKPGMT--
A0A5C5YT05      LRGEETER-----LVISSAEPSDGKTTVSSNLGVAFAQV-GKR-TLIIDADLRKPGMT--
A0A518D7F9      LTGDVADR-----IVVSSAEPSDGKTTVSSNLAVAFAQI-GKR-TLVIDADLRKPGLT--
A0A5C5ZIP0      LGADAPDR-----LVISSAEPSDGKTTISSNLAVSYAQV-GKR-TLLIDADLRKPGMT--
A0A518KBK3      LGAEVSER-----LVITSSEPGDGKTTVSANLAVSYAQT-GRR-TLVIDCDMRKPGLT--
A0A5C6AKF9      LGAAVSDR-----LVISSSEPGDGKTTISANLAVSYAQT-GKR-TLVIDCDLRKPGLT--
A0A6M5Z0K7      HSAPQGTV-----LMVASSGAGEGKTTLATALAASLARA-RCR-TLIVDCDLRAPSLH--
A0A350CI62      FSPQDTNR-----LVVTSTEPGDGKTTVSMNLSVAYAQS-GRR-TLVIDADMRRPGLS--
A0A4P5WQK6      FSPQDTNR-----LVITSTEPGDGKTTVSMNLSVAYAQS-GRR-TLVIDADMRRPGLS--
A0A3C1X4W5      FSTQDTNR-----LVITSTEPGDGKTTVSMNLSVAYAQS-GKR-TLVIDADMRRPGLS--
A0A3D3W3A7      FSTQDTNR-----LVITSTEPGDGKTTVSMNLSVAYAQS-GKR-TLVIDADMRRPGLS--
A0A518DRX3      FGDLEGNR-----LIVTSTEPSDGKTTVISNLGASFAQS-GKR-TLLIDCDLRKPGLS--
A0A518DZF9      FGDLEGNR-----LIVTSTEPSDGKTTVISNLGASFAQS-GKR-TLLIDCDLRKPGLS--
A0A518AKT8      LMTDASER-----ILVSSAEPSDGKTTVSANLAVAFAQA-GKR-TLVIDADLRRPGMT--
A0A5C5ZR72      FAAEPDQP---LVIALTSAVSGEGKTSISVALAMSFANA-SGKPTLLIDGDTRKPGVP--
A0A7C5R0U3      FTARDLVS-----LAVTSAEPGDGKTTVLVSLASSLARS-GKR-VLVIDADLRKPAMT--
A0A517TY85      LTEHLGVPGERKVVAICSAASGEGKSSLATALAMSIAES-SKQPTLLIDADLRSPDIA--
A0A5B9QEI7      LTEQVGQPGVDKIIAICSAASGEGKSSLAAALTLSIAKA-SKKPTLLIDADLRSPDVS--
F0SI78          MGGERARV-----IQFTSPDPGDGKSTTCSNIALATANS-GKR-TLVIDLDLRRPTVH--
A0A517MDV3      PGGKELRV-----IQMTSPNPGDGKTLTTTNLAVSIAQT-GKQ-VLLIDCDLRRPRLG--
A0A518IQ30      LQGSDFSK-----LAITSSEPGDGKTTVIANLAVTYATA-GKR-TLLIDCDLRKPGLT--
A0A517LWP4      LQGSDFSK-----LAVTSSEPGDGKTTVIANLAVTYATA-GKR-TLLIDCDLRKPGLT--
A0A518JNW8      LQGSDFSK-----LAVTSSEPGDGKTTVIANLAVTYATA-GKR-TLLIDCDLRKPGLT--
A0A2E7ENQ5      FSEQGSEC-----VAISSSEPGDGKTTVLSNLGASSAQA-GKR-TLLVDADMRRPGLT--
A0A7C2KUQ9      IDRQRGSA-----VLISSAGPQAGKSTLALLLAESLAQC-GKH-VLLVDTDLRNSAVS--
A0A7C5BZF0      LAETETNL-----LAVTSAQPSEGKTTVLANLAVATARA-GKR-TLLIDADLRRPGLT--
A0A1G3AQE9      LANQETHQ-----LVVSSAEPGDGKTTVLANLAVAIAQS-GKK-TLLIDADLRRPGLT--
A0A3L7UQT9      FSDRQAQR-----IVVTSTEPGDGKTTVMSNLAVAFAQS-GKR-TLLIDADMRRPGMT--
A0A4P5YBU2      FSDRQAQR-----IVVTSTEPGDGKTTVMSNLAVAFAQS-GKR-TLLIDADMRRPGMT--
A0A7C7V5U8      LTDPPAQR-----VVVSSAEPGDGKTTVLANLAVSYAQS-DKR-TLLIDADLRRPGLT--
                                 .     **:                   :::* * *       

A0A5S9IPR9      ---RLFELPQGE---GFTELLR-----RDVS--SEEVVHKINE------------NLSCI
A0A533Q9U4      ---KLFKIDKSL---GLSNVLV-----KSGD-LRTV----AKE------TTIP--NVRAI
A0A1U9NNE1      ---RILNL--PEGTTGLSDVLE-----GKP--FANALWYAPSA------------GFDVL
A0A2G2JCA2      ---NVFEVPKSP---GLAEVLN-----RDIP-LKDAINREWSD------------SVHLL
A0A533Q6B7      ---KTFELDESS---GLSNSLI-----NPVN-LHRV----ARV------TKVP--NLYVI
A0A5S9IJB5      ---QIWNTPRYP---GLSNLIA-----DSEVNLDDV----VQN------VDVE--NLSFL
A0A1G2XVR0      ---KIFGIDLKP---GLSNHFI-----GEID-YESI----IKH------VNIP--HLNII
A0A1G3B0P0      ---KIFGIDLKP---GLSNHFI-----GEID-YESI----IKH------VNIP--HLNII
A0A1E3X4X0      ---KIFSVERNP---GVSNVLA-----GEAS-IESC----IKD------TEIS--NLNLI
A0A286U4B3      ---KAFNIQMMP---GLTNHIL-----GDND-LDSI----IKH------TAIP--NISVI
A0A5C6DDS2      ---KAFNIETMP---GLSNHFV-----GEGD-LDLI----IKP------TAIP--NLSVI
A0A2E3GW02      ---KLFGLDRDV---GVSTFLT-----SDVE-WADC----IQQ------TSVP--NLDVI
A0A5B9QNZ7      ---KLFSLDPDNTA-GLADVLT-----GKTE-LLDA----IYE------TEVP--EVSVM
A0A1Z8N7H5      ---RLLDLKSKP---GLSDLLN-----ADDE-VSGM----ISD--YLAPTDAP--NLDVL
A0A1G2YPI3      ---RIFKLNHENR--GLSSVLA-----GAAR-LEDA----IHQ------TEVK--GLDLL
A0A1U7CZ81      ---SLLDIPEGL---GLSDVL-----KEEAN-VEDV----AIP------VQGG--TFHLL
A0A142YNY8      ---PLLDVADSK---GLSDLLM----NEDLN-PEDL----AIP------VQGG--TFHLL
A0A1U7GLS6      ---PLLDVPEGA---GLSDALM----NDGLN-VEEL----AIP------VQGG--TFHLL
A0A532UIN2      ---KIFNVNHGDV--GLSSTLA-----GITT-SGEA----IRP------TEIE--GLELL
A0A0S8KNX5      ---RLLNLPKGAR--GLQDVLS------GVE-FEDV----VYS------IASS--GLDVL
A0A3D3UVZ8      ---RLLNLPKGSR--GLQDVLC------GVK-FEQA----VFS------VAST--GLDVL
A0A517NFU9      ---GLFNVAESP---GLSDVLR-----GEIS-ADTA----IKP------SEIP--NLNLM
A0A5C5YWH4      ---GLFGVQREP---GLSDVLS-----GTIS-ARES----IQN------TEVS--NLDLI
A0A3D2TNK4      ---TLMQLKGQP---GVADLLT-SPETPAQS-APPL----IHS------TIVK--DLDVL
A0A7C1Y4F0      ---KIFEVDDNK---GVSSVLA-----GRDT-IEQA----IQP------GVID--SLDVM
A0A6I0ENW6      ---QRVNAGPRK---GLVDFLR----TGKLT-TKDV----LFH------ADVL--GVDVI
A0A6L3A0B7      ---QRVNAGPRK---GLVDFLR----TGKLT-TKDV----LFH------ADVL--GVDVI
A0A0J1B4A0      ---ANFGVERSP---GLSDLLSHDGPINPAT-LAEC----VQA------SEQD--SLTLC
A0A142WSB9      ---DLFALPRQL---GLAEVLT-----GAIP-LESG----LKA------TPVA--NLSVL
M5SZR3          ---LFFGSEIGI---GLSNMIV-----DGAE-PTDA----IRA------TPVH--NLWLL
M5TW92          ---LFFGSEIGI---GLSNMIV-----DGAE-PTDA----IRA------TPVH--NLWLL
A0A2S8FKY2      ---SIFGLPVGP---GVGDILV-----GEAK-LADS----IRP------TDIP--NVDLL
A0A517N8P6      ---KIFGVQSEL---GLTSLIN-----GEGQ-LADI----VVP------TDTE--DLFVL
A0A432MJP4      ---RIHGIDRAP---GLSEVLR-----GIST-WREV----LQP------SAAE--DLRIM
M5UQ35          ---ASLGVSAEY---GLVDYLK-----GKAG-FEDV----LHP------CEQA--GLFVC
A0A0S8FY64      ---RAFELERSP---GLTNLLV-----EGRA-LQEI----VQQPSDGQLEGLQ--NLYVL
A0A1N6KFT7      ---KIFRLKGDQ---GLSHILR-----RLLP-LSRV----VQQ------TQIE--NLDFI
L0DFG4          ---KIFGLKADQ---GLSHVLR-----RLLP-LSRV----VQQ------TQTE--NLDFI
A0A5C5XXG1      ---RYFSVAPEG---GLTDLLT-----GSMD-LDDA----IKP------TEAD--GVSVI
A0A7C7YUM8      ---NIFTTQRAP---GFAEILE-----EGAV-WRDC----IQD------VGEE--NLSLL
A0A7C2AHI6      ---KTFGLEKGP---GFAEALM-----EEAD-WREC----VHR------TELE--GLAVL
A0A518BJJ1      ---RYLKLDRGP---GLAEVLA-----GTSE-WRDV----ARS------TDNP--LLSVI
A0A518D182      ---RYLGLGDQV---GLAECLT-----DEAD-WRER----RQP------SGRD--HLDVL
A0A5C5WTY6      ---KLFGLPNEL---GLSQFIS-----GSAT-LDEV----IQS------TKSD--DFKVI
A0A5C5Y033      ---RYLSLQDQQ---GMSEVLQ-----AKLP-LAEV----IQP------TEIE--NLSAI
A0A5C6G1Y2      ---RYLSLQDQQ---GMSEVLQ-----AKLP-LADV----IQP------TEIE--NLSAI
A0A354PDV6      ---NFFSVKREN---GLVDVLA-----DELE-PMEA----IRD------TDVE--NVHVL
A0A5C6FZ02      ---RYFSVAPEG---GLTDLLT-----GSME-LDDA----IKP------TEAD--GVSVI
M5TIT3          ---RFFSVDKAN---GLSEVLE-----GQLA-FEDA----VKE------TRAD--NVFVV
A0A5M6CY44      ---RYFSVENEL---GLSDLLE-----NETS-IEET----IRS------TAID--NVSVM
F2AXG2          ---RYFSIGKED---GLCDVLE-----GRLE-IPES----IKV------TEAE--NVSVM
M2BB46          ---RYFSIGKED---GLCDVLE-----GRLE-IPEA----IKV------TEAD--NVSVM
L7CLQ6          ---RYFSLGKED---GLCDVLE-----GRLE-IPEA----IKV------TEAE--NVSVM
A0A0J1B719      ---RYFSLGKED---GLCDVLE-----DRLE-ISEA----IKA------TEAD--NVFVM
Q7UF18          ---RYFSLGKED---GLCDVLE-----GRLE-IPEA----IKV------TEAE--NVSVM
A0A2G1W1E0      ---RYFSLGKED---GLCDVLE-----GRLE-IPEA----IKA------TEAD--NVFVM
K5E235          ---RYFSLGKED---GLCDVLE-----GRLE-IPEA----IKA------TEAD--NVFVM
A0A5C6FFI9      ---GLFGVDGGR---GLGDILM-----GEAT-LEDS----TVA------SSVE--NLDIL
A0A5C5WDJ1      ---KLFGIDQEP---GLSDYLE-----RRIP-FEGA----VTR------TEVA--NLDIV
A0A5C5X547      ---EIFEVDGAT---GIYDILT-----GNET-LDGA----LKY------IEED--KLTVI
A0A353FIP5      ---KLFSIQSNP---GLVDAIS-----GESP-CEDL----AQQ-----VSSIP--NLHIL
A0A5B1CIK7      ---RYFSVAKGA---GLCDVLE-----GRAE-FADV----IKE------TDAE--NVSVI
A0A5C5WHS2      ---RYFSVAKGA---GLCDVLE-----GREQ-FKDM----IRE------TEAE--GVHVV
A0A5C6B6G8      ---RYFSVSKTG---GLCDVLE-----GRLQ-LADV----IKD------TDAE--KVSVI
A0A5C5ZZN3      ---RFFSVGREE---GLCDILN-----DRTP-FADA----IKE------TRAD--NVWVI
A0A5C5XS91      ---RFFNLSKEN---GLCDLLE-----GRID-FNEA----VKE------TKVD--NVHVM
A0A5C6C4E6      ---RFFNLNKER---GLCDLLD-----GRIS-FEEA----VKE------TKAD--NVYVM
A0A2E1VVJ1      ---KYFDAEVSP---GLSEVLL-----EKNP-WQDC----VHK------APVA--NLDVL
A0A3M2AEL0      ---RLFGFPISP---GLSDVLK-----EDAS-PEKL----MHP------TNID--GLSVL
A0A2A2W9R6      ---KTFGIERSP---GLSDYLN-----HVVC-FSES----LHE------CEQI--NLTLC
A0A518HKC1      ---KNFGIERSP---GLSDYLN-----HVVC-FSES----LHE------CEQI--NLTLC
A0A518L3P0      ---KTFGIERSP---GLSDYLN-----RVVC-FSEC----LHE------CEQI--NLTLC
A0A255R1S0      ---SRFGVERGP---GLSDYLH-----GDAT-LMEC----LHH------TEQE--NLVIC
A0A5B9MKP1      ---KVFGVERSP---GLSDYLN-----GVVS-FSEC----QQD------CEQL--NLAVC
A0A0S8J591      ---RAFNM--KPDR-GLSTLLS-----EKDS-----ATVYIKK------TDIE--NLHVL
A0A351FYP6      ---RYFKV--SNTI-GLTNLLL-----GQNT-LDEV----IQT------SESP--NLHFI
A0A532UT69      FDVDVFEV--NGSK-GLASLLS-----RRAT-LEDI----AEK------TDIK--DLDLL
A0A2D5AWU0      ---EIYGV--ENLA-GLGQVMT-----RSIT-TDKV----IVQ------NVAA--GLDLM
A0A1G2YQB7      ---KYLNL-DNKGK-GMHQLLA-----DFK--LRDL----LMH------ADTP--GLAVL
A0A353P687      ---KYLKL-DNKGK-GMHQLLA-----DFK--LRDL----LLY------SDVP--GLSVL
A0A356EME5      ---EVFEV--RKSP-GLAEVLG-----GECD-LHEA----IVP------TWTP--SVDVL
M5RT57          ---NIFQV--SNNL-GMTSVLE-----GRAT-LDEA----VIR------DWSD--QIHLL
A0A356KTN1      ---RILGQ--PLEP-GLADAIE-----GKVEDLGER----LRR------TQVE--NLWVM
A0A518HFS8      ---LLMDE--PLAP-GLCEVLR-----GEVA-LDDA----VHA------TAAS--PLEVL
L0DC26          ---ELFDQ--PCVP-GFCEVLR-----GEID-IVGA----VQP------TVIS--GLSLL
A0A3L7P4E4      ---RLFSL--KNKM-GLSNLLG-----DVSLDVNEC----IES------VTFEGSTLDIL
A0A3L7PEB5      ---RLFGL--KNNT-GLSELLD-----EVPPDINEC----IQT------VSFEGSNLDIL
A0A1U9NL64      ---EVFEF--DREP-GISNILA-----GESQ-IDSV----IKN------TSID--GLDVL
A0A2N1UCJ3      ---NIFGFANEVEK-GLSSILS-----GQIS-LDDA----IRS------CPTD--GLFLL
A0A7C4EK84      ---RVFGL--DQRM-GLSRVLL-----ENVP-LDKA----IAP------TGIE--NLDVL
A0A7C3F0T2      ---RIFKV--ERER-GISSVLV-----GREP-LDAA----IHH------TEVK--CLDIL
A0A2E0X4J3      ---VTFGL--STEI-GLSTLLA-----DRRP-AADA----MQA------TDVD--NLTVI
A0A5C5YU10      ---TIFGV--DNTQ-GLSTALS-----ERRP-IEEL----IVS------SEIG--TLDFL
A0A517MPZ6      ---EVFEI--QVEH-GLSSVLA-----ERRP-ADEV----IQR------TEVD--TLDLL
A0A5C6CNV7      ---TIFEV--TCEQ-GLSTVLT-----ERRP-VREL----IVS------TEVV--NLDLL
A0A518K5H4      ---ETFGM--TPTT-GFSDVLT-----GAVL-AIEA----VVS------GVAP--NLDLL
A0A5C6AA28      ---EIFGV--EVES-GFAAVLS-----GVTP-AIEA----VVA------TSVP--SLDLL
A0A2E7ESJ6      ---EVFAM--EAPEIGLASVVA-----GDAE-PADAWQEIPF---------VP--NLRIM
A0A2E9VK20      ---QLFGM--REDI-GLSECLS-----GEIE-MANA----VQD------SGIE--NLHIL
A0A3D4PJK1      ---QLFGM--REDI-GLSECLS-----GEIE-MANA----VQD------SGIE--NLHIL
A0A355AI52      ---KLIDR--RGQV-GLSDILR-----GTEE-VAEQASGLAIQ------TGSV--PVDII
A0A354PCQ3      ---RLFGL--EMGP-GFSAVLA-----GKAS-LLDA----VNS------RLGN--LIHLL
A0A0S8GZ23      ---RLLNL--PHDSWGLMDVLY-----GLKK-FEET----VRS------VPLS--GLDVL
A0A1I3DDV4      ---RFLNM--PIDR-GLSETLQ-----GKTK-LDEV----IRP------TGIE--GLSVM
A0A2E0SMM6      ---NLLEM--RKEE-GLSKLLR-----SDEP-IHQCAVELIQP------SGAP--NLDIL
A0A3L7SI46      ---QLLEL--KGPR-GLSQILR-----ETTP-VAECCLENIFN------LGIE--NLDVM
A0A5B9PJZ8      ---KYFGV--DNDY-GLTSVVY-----GQME-PEEA----VRV------IQPE--YLSVV
A0A2S8G191      ---TAFDV--NLVP-GVTEWLS-----GEVE-IQDA----IQE------TGMR--NLDII
A0A2E7EGG1      ---RIFKV--ENKP-GLVGVLS-----GECD-FEDA----VNR------EWSE--HVHVL
A0A2E2N5A9      ---KNFGR--PKGSMGLTDIIE-----NRAS-LESC------I------TQVS--GVDMI
A0A7C8AGA2      ---EVLNL--PKGSRGLQDLLF-----GKEF-TKL-----VYN------TGTV--GLDVL
A0A7C2FXP7      ---QTLNI--PKELRGLQDLLF-----GKPL-AES-----VYR------IGST--GLDIL
A0A2E3GWC6      ---RLFGL--REEI-GFSEVLQ-----GELE-LLNA----IQP------TKIE--NLSVL
F0SLB0          ---RLFGL--REEI-GLSEVLQ-----GELE-LLNA----IQP------TKIE--NLSVL
A0A3L7NDH9      ---KLVGF--RSMP-GLSDILR-----GNQP-VSDHASACIRR------SGSV--PIDII
A0A1N6DAJ8      ---ELFDQ--PCVP-GLSEVLR-----DEVD-VADA----IQP------TAAG--GLWLL
A0A532UD06      ---RIFEI--DHEL-GLTNVLA-----GTVR-LDEA----IQP------GPVT--GLDLL
A0A660URN1      ---KIFEI--DHGK-GLSNVFA-----GAIT-LDEA----IEA------GPVE--GLDIL
A0A517ZCB5      ---RLFNL--TGHP-GLSTVLM-----SDRS-VEEAIDTLPHH------TELP--NLDVL
A0A225EH48      ---KLFDS--PLTP-GCAEVLL-----QEVD-VSDA----VQP------TTVP--NLWLI
A0A518INW8      ---KLLGT--QNAN-GLAEYLM-----GDAG-LDEV----AVP------SEIE--RLDFI
A0A518JPH9      ---KLLGI--QHPK-GLAEYLM-----GDAS-LEEV----TVS------SEIP--GLDFI
A0A5C5VEK8      ---SIFGV--DSKQ-GLSTMLR-----ERRP-VEDF----IIP------NALG--SLDFL
A0A532UTJ0      ---RLLNL--PKGSRGLQDVLC-----G------VKFEQAVYS------MAST--GLDVL
A0A432MFP3      ---RLFEV--PDCP-GLSDVLR-----GDAQ-LEDAL---VPI------SQVG--GCQLL
A0A2E2CCW9      ---KLFGL--ANSV-GLGDVLT-----GEID-AQTA----IRE------TRVS--HLSIL
A0A3C0AGX3      ---KLFGL--ANSV-GLGDVLT-----GEID-AQTA----IRE------TRVS--HLSIL
A0A518AAQ5      ---KLFGI--NNAV-GLGDVLA-----QEID-AQTS----IRE------TRIS--NLSIL
A0A517QBG9      ---KLFGI--NNAV-GLGDVLA-----QEID-AQTS----IRE------TRIS--NLSIL
A0A518FTU3      ---KLFGI--NNAV-GLGDVLA-----QEID-AQTS----IRE------TRIS--NLSIL
A0A517WHH5      ---KLFGI--NNAV-GLGDVLA-----QEID-AQTS----IRE------TRIS--NLSIM
A0A5A8BGT3      ---KLFGI--NNAV-GLGDVLA-----QEID-AQTS----IRE------TRIS--NLSIM
A0A2E7K7A9      ---KLFGI--NNAV-GLGDVLA-----QEID-AQTS----IRE------TRIS--NLSIL
A0A517PTS5      ---KLFGI--NNAV-GLGDVLA-----QEID-AQTS----IRE------TRIS--NLSIL
A0A6I6AH34      ---KLFGI--NNAV-GLGDVLA-----QEID-AQTS----IRE------TRIS--NLSIL
A0A517VTK3      ---SLFGI--VNGI-GLGDVLS-----EEID-AQTA----IRE------TRIK--DLSLM
A0A517WQT4      ---SLFGI--VNGI-GLGDVLS-----EEID-AQTA----IRE------TRIK--DLSLM
A0A517VID8      ---KLFGL--ANSV-GLGDVLS-----GDID-AQTA----IRE------TRVS--HLSIL
A0A517RK10      ---KLFGL--ANAI-GLGDVMA-----EEID-AQTA----IRE------TRIS--NLSIM
A0A518IH18      ---KLFGL--SNAI-GLGDVMA-----NEID-AQTA----IRE------TRIS--NLSIM
A0A5C5XLF4      ---QLFGM--REEI-GLSECLS-----GEIE-MANA----VQD------SRIE--NLDIL
A0A2D5NDU9      ---KRWQV--SGPG-GITSAVA-----EDLR-LIAA----VHE------TEVD--GLDLL
A0A1P8WP26      ---TLLDL--RDDK-GLSVILR-----STDE-FDEAVQGNLRA------TAVD--GLDVI
A0A3L7V1F3      ---TLLGL--RDDT-GLSKILR-----DSDE-LEVSIERNLRK------SDVK--GLDVI
D5SZ21          ---KTMKL--RGSY-GLSTILR-----NDDS-IENSLRNNVVV------SDLA--GLDII
A0A286RGB6      ---EVFNL--PISP-GVSEVLR-----AEIS-LKDV----VRP------TELE--NLFVV
A0A518CHE5      ---NLLEL--RKEE-GLSKLLR-----SEEP-VDQCAVELIQP------SGSP--NLDIL
A0A1V5N3W2      ---HFLKL--PENYWGLQDVLL-----GLRR-WEEA----VYT------LPEA--GVQVL
A0A3E0MY27      ---RMLDL--PLDT-GLSEVLR-----GEAA-VEEA----IRP------SRAP--GLWVM
A0A7C4Z5R7      ---ELFGL--PLTP-GIREIMR-----GEAH-ASEC----WRA------SRIE--GLSVL
A0A2E0X9P6      ---RMLGL--PNQP-GLADVLR-----GDLP-AVET----IAQ------VGSS--TAFLL
A0A286RLF2      ---QLLGL--RGEP-GISEVLR-----DTAP-IAEAIQARLKK------NIVP--DLDVL
A0A517NSK8      ---KLFRL--ENTL-GLSEAIG-----GLAD-AADV----ISD------TVVD--NLWAV
A0A5C5Z0D6      ---RLLHL--EGSL-GLSDALR-----QSLD-PSKV----VQT------TVQD--NLFAV
M5UE94          ---RLLHL--SGES-GFSEALQ-----DLCD-PTDV----VQS------TVSD--NLFAV
A0A2E8FLY0      ---ALMDL--RGPR-GLSTVLR-----GDEP-IANTATANLFA------TELG--TLDVM
A0A3D2U1E1      ---AMMDL--RGQQ-GLSSILR-----SNLP-PDTATQGNVFS------THLE--HLDVI
E8R3W3          ---QLFGT--QKSP-GLAEIFR-----NEID-LWSA----IQT------TSFN--LLSTL
A0A5C5ZM48      ---SAFDI--DPSP-GLGDVLD-----GHAS-LQQT----VVA------AEQP--GLWVL
A0A5B9WF77      ---PLLEV--PEGP-GLSDALQ-----GDVK-VDEL----IIP------VQGG--TFHLL
A0A518BBX8      ---RLFNL--SGKK-GLVSVIR-----DGAD-LDDV----IHD------TGID--GLSVI
A0A1P8WN28      ---RLLEI--RGNG-GLSEVLR-----ADSD-IPQMCKERVVQ------TEVP--LLEVL
A0A3B9CTT0      ---RLLEV--RGNG-GLSEILQ-----ADGG-IAELASERVTP------TDVD--GLYVL
A0A518ALT3      ---EYLDV--PSGP-GLSEVIS-----GSVP-LNEA----IYR------VGDS--LTFVL
A0A3M1QRP3      ---GRLGV--SG-A-GQEFLAS-----LLDA-QAGQTPRRDRA------TNVP--GLRVL
A0A517TMV0      ---ALMDL--KRMP-GVTDILT-----AGGD-IAAIAERCVRR------TDLE--TLDVI
A0A3E0MY88      ---ALFAL--KREH-GLSDVLN-----APEP-VEEVATRYVRG------TGIP--DLDVL
A0A5B9QF68      ---SLLQL--RGRP-GLADVLT-----SGLS-PAESAPSMVVA------TEVP--GLDVL
A0A5B9QGF0      ---SLLKL--KGRP-GVADVLT-----SGLS-PSESAPSMVVE------TEVP--GLDVL
A0A5C6CK24      ---TLLKL--KGRP-GVSDVLT-----SERS-PAESAPDLVVH------TEVP--GLDVL
A0A2E3RCU8      ---RLLDL--KSHR-GLSDVLA-----ADDP-IQEIIPGHVVP------TAAA--NLDVL
A0A1C3E6N1      ---KTMKL--RGSY-GLSTILR-----NDDS-IENSLRNNVVV------SDLA--GLDII
A0A518GJT2      ---KTMKL--RGSY-GLSTILR-----NDDS-IENSLRNNVVV------SDLA--GLDII
A0A2E8B0L9      ---KLFQL--RGVA-GLSDILR-----GNDE-VPAMCEERIQA------AGVD--GLDVL
A0A5Q4GFE7      ---KLFEM--RSNG-GLSEILR-----GDSP-IDAMCRPRVLP------SGIA--HLDVM
A0A257WS34      ---QLLGL--KGQQ-GLSHVLR-----DSRP-VQESCLDNIFH------LGQE--NLDVM
A0A7C4LP10      ---QLLEL--KGPR-GLSQVLR-----ETAP-IADSALENIFH------LGVE--NLDVM
A0A517MLW3      ---NLFNV--RHAK-GLSQLLV-----EMSP-VDVV-DKYVMS------TGID--NLELI
A0A5B9QVD0      ---NLFDL--RQCR-GFSQLLV-----EANV-AATV-KSYIQP------SGIE--DLDLL
A0A3A0DET7      ---TIFDL--STEK-GLATVLS-----ARMP-VGDA----IVR------LRES--SLEVL
A0A3B8PNV4      ---RKLNL--KGSR-GLSTILQ-----SEDP-IAVSAAGNLFA------TELG--SLDVI
A0A3D1DR40      ---RKLNL--KGSR-GLSTILQ-----SEDP-IAVSAAGNLFT------TELG--SLDVI
A0A2E7RYU8      ---RKLNL--KGPR-GLSTILQ-----SEEP-IGISAASNLLA------TELN--SLDVI
A0A3B8LXG8      ---RKLNL--KGPR-GLSTILQ-----SEEP-IGISAASNLLA------TELN--SLDVI
A0A286RD13      ---RLFRC--PLSP-GLSELAK-----NLAR-PEEI----VRN------AEIE--NLYVV
A0A2E3GWX1      ---RLFDL--RGQQ-GLSSILR-----DDQT-IEESAKANMVH------TGLM--NLDII
F0SG60          ---RLFDL--RGQQ-GLSSILR-----DDQT-IEESAKANMVH------TGLM--NLDII
A0A2E9VST2      ---AVFAL--KGQA-GLSTILR-----DTAS-IEESALKHITK------TRLE--NLDVI
A0A356A6X2      ---AVFAL--KGQA-GLSTILR-----DTAT-IEESASKYITK------TRLE--NLDVI
A0A5C5XLM3      ---AVFAL--KGQA-GLSTILR-----DTAT-IEESASKYITK------TRLE--NLDVI
A0A7C5FXU1      ---RFLGL--RRGP-GLAHVLR-----GEIS-L----EDAVQD------TEQP--LLRVL
A0A3M1VCL4      ---TLFGL--RAAP-GLSTVLR-----SEEP-LQVALQGCLFQ------SGCA--GLDFI
A0A5C5V7Z9      ---SLMDL--KGQA-GVTDILL-----CEGG-VAELAERCLVK------TPLE--KLDVI
A0A5C5YT05      ---SLMGL--KGHA-GVTDILI-----CEGA-IGALAERCLVK------TGLD--KLDVI
A0A518D7F9      ---ALLGL--KGQP-GVTDLLT-----ARGE-MSKLAPGVVRK------TDQP--GLDVI
A0A5C5ZIP0      ---ALMDL--KGKS-GVTDILT-----TSGD-VAAEARRCLLK------TEQP--NLDVI
A0A518KBK3      ---SLLEL--KGYE-GVTDILS-----AEGN-VGLIAQRCVVR------TALE--SLDVI
A0A5C6AKF9      ---ALLEL--KGQA-GVTDILT-----TRDD-VAAVAERCVLR------TALD--TLDVI
A0A6M5Z0K7      ---RLFGV--AQTP-GVCEVLS-----RTAR-VEAV----IRP------TAAE--CLDVL
A0A350CI62      ---TLLGL--RDDV-GLSRLLR-----SPDD-LDTAIAANLRT------TVVQ--GLDVI
A0A4P5WQK6      ---TLLGL--RDDV-GLSRLLR-----SPDD-LDTAIAANLRT------TVVQ--GLDVI
A0A3C1X4W5      ---TLLGL--RDDV-GLSRLLR-----SADD-LETAIAANLRT------TVVQ--GLDVI
A0A3D3W3A7      ---TLLGL--RDDV-GLSRLLR-----SADD-LETAIAANLRT------TVVQ--GLDVI
A0A518DRX3      ---TLFQV--RGLP-GLSDLLR-----SSEP-VGAMCEQRILS------TGIP--DLDLL
A0A518DZF9      ---TLFQV--RGLP-GLSDLLR-----SSEP-VGAMCEQRILS------TGIP--DLDLL
A0A518AKT8      ---TLLGL--KGQA-GVADILT-----SEEP-TASIAPRHVVH------TDEP--RLDVI
A0A5C5ZR72      ---DLIDL--RHGQ-GLTEVLA-----GQ----CTLDEALQPA------RGVA--NLQVL
A0A7C5R0U3      ---RVCQL--RGRK-GLVELLS-----QEGV-TCEEDPPVVSV-------APL--GIDVL
A0A517TY85      ---RLLGT--PAGP-GLAELLS-----GR----ATLREVIHRV-------GET--EAFVL
A0A5B9QEI7      ---SFLEV--PSQP-GIVELLG-----GE----VALEKAIHRV-------GKT--QAYVL
F0SI78          ---KLFGL--DRDV-GVSTFLT-----SDVE-----WADCIQQ------TSVP--NLDVI
A0A517MDV3      ---TLFGL--EDEA-GLSNVLT-----GDTE-L----VDSIHE------TPIE--NLSVM
A0A518IQ30      ---RLFDL--RGLG-GVSQLLT-----QADT-VEPVWGNEVKA------TGIG--NLSII
A0A517LWP4      ---RLFDM--RGLG-GVSQLLT-----QADV-VAPIWNHEVKG------TGIP--NLSII
A0A518JNW8      ---RLFDM--RGLG-GVSQLLT-----QADV-VAPIWANEVKG------TGIP--NLSII
A0A2E7ENQ5      ---RLFGF--RGKG-GLSDVLT-----KPND-LNELCEERIQK------TALA--GLDVL
A0A7C2KUQ9      ---KRCGV--RAEP-GLVGVLT-----SK-----ATDAEAVSH------YNGT--DLDVL
A0A7C5BZF0      ---ALLNM--RGRE-GLSAVIQ-----SAED-LETIARANIRR------TTLE--CLDVL
A0A1G3AQE9      ---ALMAM--RGIE-GLSSVIR-----SEED-IVRAAVAHIRP------SGLA--GLDVL
A0A3L7UQT9      ---ALLGL--KGQQ-GLSQVLR-----DERP-IAASVAENLFT------QITP--GLDVI
A0A4P5YBU2      ---ALLGL--KGQQ-GLSQVLR-----DERP-IAASVAENLFT------QITP--GLDVI
A0A7C7V5U8      ---ALLGL--KGFQ-GLSTVLR-----SDRD-VGELAAAHIRP------SGLE--GLDVL
                               *                                            

A0A5S9IPR9      TSGK-IPA---DPYETIHNSH-IKELIRELEHEYDYILIDAPPIGITTDALLLG--KKLG
A0A533Q9U4      ACGP-IPP---NPSELLSSSA-MVEMLQLAKEEFEWIIIDSPPILTVTDARILA--RVAD
A0A1U9NNE1      GNYD-RCL---KACDRLSRPE-VQSNIRNLCRYYDHVVIDTPPVLAFPDALLWA--RIAD
A0A2G2JCA2      TAGT-LMT---SPHKLLGTNV-FDKLMKGVRGRYRYVVLDTPPVLAASEALVMA--KQAD
A0A533Q6B7      TSGP-PSP---NPSELLSSSA-MVEFLKVAREEYDWIIIDSPPLLTVTDGSILA--RMVD
A0A5S9IJB5      PAGV-SPP---NPIELVEKER-FKEIIAECEQKYDYVIIDCPPIAIVADGVSVS--KVCQ
A0A1G2XVR0      TCGL-IPP---NPSELLGSHS-MEKFCDNVRNRFDIIIFDTPPTMTVTDAVVLS--RNVD
A0A1G3B0P0      TCGL-IPP---NPSELLGSHS-MEKFCDNVRNRFDIIIFDTPPTMTVTDAVVLS--RNVD
A0A1E3X4X0      TSGS-VPP---NPSEMLGSAS-MEKFCDDIRKMFDYVLLDSPPIMSVTDATILA--RLTD
A0A286U4B3      TCGL-IPP---NPSEMLGSHS-MEKFCKEIMDRFDTVILDTPPAMAVTDTIVLS--NMVD
A0A5C6DDS2      TCGL-IPP---NPSEMLGSHS-MEQFCMEVRERFDTVIFDTPPSLAVTDTVILS--NIVD
A0A2E3GW02      TAGK-KNE---QYGELLHNPK-LASVLDALRDKYDVIFIDSPPVLAVADATAIA--PLAD
A0A5B9QNZ7      PSGF-RPH---NPSELLQTNE-FFNLLAAVREKFDYVLLDSTPLLAVSESASIG--QRVD
A0A1Z8N7H5      PAGP-RRQ---NPSELLASDR-LAQIFAWAETKYDQILVDCPPTLVASDAVLVG--RIVD
A0A1G2YPI3      ACGP-EVP---NPAEILNSDT-FAKLLERLSNKYDRIVIDSPPVMPVTDAQILA--AICD
A0A1U7CZ81      CAGT-PVA---DTSRLFQGRN-FGMMIARLRQMYDLIIIDSPPVLPVPDGLIMG--RWTD
A0A142YNY8      SAGT-PTS---DTSRVFQGRA-FGMLIARLRQLYDLIIIDSPPILPVPDALIMG--RWTD
A0A1U7GLS6      SAGT-PTS---DTSRLFQGRA-FGMLIARLRQLYDLIIIDSPPILPVPDALIMG--RWTD
A0A532UIN2      PCGA-SVP---NPSELLNSDG-FAQLLEILSDRYDRVIIDSPPVMPVTDAQILA--AICD
A0A0S8KNX5      AADY-HNA--ADAYELLALPS-TAHRIDTISKKYDHVIIDTPPALGFPDALLWA--KVGD
A0A3D3UVZ8      AADF-QDS--ADAYEMLALPS-TAKRINAISRKYDHVIIDTPPALVFPDALMWA--KIGN
A0A517NFU9      ANGS-PTS---DPAELLESAR-FSMMLSEMSLHFDLVLIDAPPLLAVADPAIIA--PIVD
A0A5C5YWH4      PNGR-PTA---DPSELLESDR-FGAMVAELTQRYDLVLIDAPPLLAVADPAIIA--PLVD
A0A3D2TNK4      PAGL-RRP---NPAELLSSKA-FIELLAWAESKYDRVIVDCPPVLAVSDAQIVG--RLVD
A0A7C1Y4F0      ACGP-EVP---NPSELLNSDV-FTETLVKLTEQYDRVVVDSPPVGPVADAQILS--TVCD
A0A6I0ENW6      PAGD-RAS--VDDAERMANGR-FGQALKEWRGSYDFVILDSAPVLPVADARILA--GQAD
A0A6L3A0B7      PAGD-RAS--VDDAERMANGR-FGQALKEWRGSYDFVILDSAPVLPVADARILA--GQAD
A0A0J1B4A0      TSGS-RTS---EPSELLESDQ-WVAFLDLARKTYDVILIDTPPLLAVADPSIVA--DEVD
A0A142WSB9      TAGI-PPE---NPAELLSTSN-LEGLVQELRGRYDFVLFDSPPVLAVSDPCIIA--PQAD
M5SZR3          SAGQ-KTP---DPAELLTSTR-FAELMAQFREDYDYVIVDSGPLLAVSDPRIVM--AHTD
M5TW92          SAGQ-KTP---DPAELLTSTR-FAELMAQFREDYDYVIVDSGPLLAVSDPRIVM--AHTD
A0A2S8FKY2      PAGI-KEQ---SVPRSASTGR-LDQLFADLRKSYDFIIVDAGPVLGSPSTRFLAQPQHVD
A0A517N8P6      ASGP-RPN---NPAEALMMPE-FGQILDEARLQFDLIIIDTPPLLAVTDASNVA--TYAD
A0A432MJP4      TTGG-PVE---NPAELLMSER-FRSLVAELRGEFDRVLIDTSPLLYVADPSIVA--PSAD
M5UQ35          TDGS-RTS---QPAELLETDR-FAEFMAEARSAFDVILIDTPPLLAVADPVIVS--EHVD
A0A0S8FY64      SAGA-KTP---NPAELLGSSA-MARLVRQSREQYDVVIFDSCPAMFVADAAPIA--SGCD
A0A1N6KFT7      ASGS-DVD---NPAELLASSA-LTDFVAEIRNLYDMVVFDSSPLLAVTDPSILS--AVVD
L0DFG4          ASGP-EVD---NPAELLASAT-FTDFVSEIRNIYDMVVFDSSPLLAVTDPSILS--AMVD
A0A5C5XXG1      TAGA-STR---TPAELLQSEK-LEELTQQLEERFDLVIFDLPPVLAVSDPLVVA--PRID
A0A7C7YUM8      PAGQ-TST---SPGELLASRA-ALNLVEEMKEAYDLVVFDLPPAVVVADVAGFA--ANLD
A0A7C2AHI6      CCGS-WRG---TPGEALSGER-PAQLIDEFLAEYDVVLFDLPPAVVVADVEAFA--HKLD
A0A518BJJ1      PAGV-LRA---SAGDALGTTK-AQELIDEFTKSYDLVVFDLPPALAVADVETFA--HRLD
A0A518D182      VAGR-SRQ---VSADLLGSDA-MSELVDEWLAEYDLVVFDLPPALVVADVEVFA--HRLD
A0A5C5WTY6      TSGE-ISL---DSPEWLQTAA-LEELLRQT-EDFDLVLFDLPPVLAVSDAAVVL--PRLD
A0A5C5Y033      SAGK-TPE---NPAELLQGVN-LDKAIESLSNHFDLVLVDLPPVLAVSDPAVVL--PRLD
A0A5C6G1Y2      SAGK-TPE---NPAELLQGVN-LDKAIESLSNHFDLVLVDLPPVLAVSDPAVVL--PRLD
A0A354PDV6      PAGA-PTS---TPAELLQSPR-FDQLLEILKEKYDVVLLDLPPVLAVSDPLVVA--PKVS
A0A5C6FZ02      TAGA-STR---TPAELLQSEK-LEELTHQLEERFDLVIFDLPPVLAVSDPLVVA--PRID
M5TIT3          TGGA-TSP---RPAELLQSDK-LGEVLEAAKTQFDLVLVDLPPVLAVSDPIVVM--PRLD
A0A5M6CY44      TAGS-STK---TPAELLQTSR-LDEILDELKQEFDVILLDLPPVLAVSDPVVVL--PRID
F2AXG2          TAGS-SSQ---TPAELLQSQR-LDEVLAVVREDYDLVLVDLPPVLAVSDPVVVM--PRLD
M2BB46          TAGS-SSQ---TPAELLQSQR-LDEVLAVVKEDFDLVLVDLPPVLAVSDPVVVM--PRLD
L7CLQ6          TAGS-SSQ---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVL--PRLD
A0A0J1B719      TSGS-SSH---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLD
Q7UF18          TAGS-SSQ---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLD
A0A2G1W1E0      TSGS-SSQ---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLD
K5E235          TSGS-SSQ---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLD
A0A5C6FFI9      PHGK-ATS---VPAELLQSNR-MSVLVQEARRTYDLVLIDAPPVLAVADPSIVA--PLAD
A0A5C5WDJ1      PNGG-PTA---EPAELLESVQ-LTRLLQEACAKYDLVLIDAPPVLAVADPAIIA--PMVD
A0A5C5X547      PAGN-VES---EVYLESYSGM-LAELFATLQEQYDFVIVDCCPVLPVVDARIVS--EYVD
A0A353FIP5      PSGK-VDVGGINPGDLLAQEK-MSEIADSLRGAYDYVFFDVPPVLAVADASSFL--NRLD
A0A5B1CIK7      TAGS-SPK---MAAELLQSEK-LDEILSQAKEQYDLVIVDLPPVLAVSDPIVVM--SRLD
A0A5C5WHS2      TAGS-SPK---MAAELLQSDK-LDEVIAEAREMYDLVLVDLPPVLAVSDPIVVM--PRLD
A0A5C6B6G8      TAGS-SSK---MPAELLQMEK-LDELLEELKQQFDVVLVDLPPVLAVSDPVVVM--PRLD
A0A5C5ZZN3      PAGS-SSS---TPAELLQSSK-FDEILRMASTQFDLVLVDLPPVLAVSDPVVVM--PRLD
A0A5C5XS91      PAGS-SST---SPAEFLQSEE-LDEVLATARSQFDFVLVDLPPVLAVSDPVVVL--PRLD
A0A5C6C4E6      PAGS-SST---SPAEFLQSEE-LDEVLATARSHFDFVLVDLPPVLAVSDPVVVL--PRLD
A0A2E1VVJ1      PAGA-MVK---NPGDLLASEG-LVQLTESFLSEYDRVLFDVPPVLAVADASAFL--HNLE
A0A3M2AEL0      TAGS-RTA---RPGDLIASPA-MQGFLQDVRGSFDYILFDIPPVLAVADASGFV--SQLD
A0A2A2W9R6      PAGS-RTS---APSELLESES-IAEFIANARQSFDMVFIDSPPLLAVTDPAIIA--LHVD
A0A518HKC1      PAGS-RTS---APSELLESES-FGEFIAEARQSFDMIFIDSPPLLAVTDPAIIT--LHVD
A0A518L3P0      PAGS-RTS---APSELLESDS-FAEFIAEARQSFDMVFIDSPPLLAVTDPAIIT--LHVD
A0A255R1S0      PSGS-RTS---SPSELLESDR-FLEFIENVREGCDLVFFDAPPVLAVADPAIIA--LHVD
A0A5B9MKP1      PAGS-RTS---SPSELLESEQ-FAEFIAQARQSFDMVFIDSPPLLAVTDPAIIT--LHVD
A0A0S8J591      PGGP-IPS---NPAELLGSRK-MRTLVAEAAERYDSVIIDASPVLGVADANILS--TMVD
A0A351FYP6      PSGK-LPS---SSMGVLNSAK-MKEFVAEMKSRYDYVFFDAPPIMGVSDASVLA--SAVD
A0A532UT69      PCGE-QLI---NASEVLNSKS-FTTLLKDLAKKYDRIVIDSPPVVHVADAQILA--ATSD
A0A2D5AWU0      PAGD-PFG---KPAELFESGL-FPKLLDFLRKKYDCIVVDSPPILESSESRVMA--SEVD
A0A1G2YQB7      TAEP-CDI---AIINKLIHHKNLVEFINEVSRIFDHVIIDTPPILAAVDALLWS--SMVD
A0A353P687      TAEP-CDI---SIINRLIHHKNMVEFINEISRIFDHVIIDTPPVLAAVDALLWA--SMVD
A0A356EME5      PGGE-AKQ---NVHKLVGNGE-LSAILRQVSQKYAYVVLDTPPILAASESLVLA--KAAD
M5RT57          PAGR-LRV---NPHQLMTRES-LNKIFNELRAQYRYIVIDTPPILSASEAILLA--RCAD
A0A356KTN1      GAGR-CEA---NPGELLARDDTFHQLVWRLRRRFDRIVIDSPPVVAVSDATLMA--QAAD
A0A518HFS8      PAGC-CDA---AAVDALAREE-FPRLIQDLRGRYEFIIVDSAPALIVTDTLMLS--QHVD
L0DC26          TAGF-SDS---DSIQALASLD-LRAMFDQLKEHYDFLVIDSSPVLPVADALLIG--QHVD
A0A3L7P4E4      SSGE-CPI---DPGERLMSDR-MESLLNMLRDRYEWIIIDSPPVLAVTDSATLS--RLVD
A0A3L7PEB5      ASGE-CPI---DPGERLMSNR-MENLLSMLRDRYEWIIIDSPPVLAVTDSATLS--RLVD
A0A1U9NL64      ACGP-SIP---NASELLNSDE-FGELLSSLKAKYDRILLDAPPVMPVADARILA--AMCD
A0A2N1UCJ3      TSGP-EIL---NPSELLNSEA-FSNLLKELTHRYDRVIIDSPPVTSVADSQILA--AICD
A0A7C4EK84      PCGP-PPA---NPSELINSQA-FGAMLQTLAGKYDHVVIDSPPVVPVTDARILG--ALCD
A0A7C3F0T2      PTGP-TPP---NPSEMLNSPA-FADVLDQLSTQYDHILIDSPPVMPVTDARILG--AICD
A0A2E0X4J3      TSGP-VPS---HPVELLNNGY-FADLVTSLSEQFDRVIIDSPPVMPVADARVIA--AMSD
A0A5C5YU10      PAGP-TPS---NPLELLNNDY-FAEMLERLKLQYDRIIIDSPPVMPVADSRVIA--SMSD
A0A517MPZ6      PCGS-RPT---NPVELLNNGY-FSELLHELQQKYDKIVIDSPPVMPVADARVIS--AQTD
A0A5C6CNV7      PCGV-CPA---NPVELLNNGF-FSELLDKLRLDYDKIVIDSPPVMPVADARVIA--AQTD
A0A518K5H4      PCGP-IPP---NPVELLNNGM-FSEVLEQLLRQYDQIVIDSPPVMPVADSRMIS--AMVD
A0A5C6AA28      ACGR-IPA---SPVELLNNGN-FSEALEQLSRHYDQIIIDSPPVMPVADARLIS--AMVD
A0A2E7ESJ6      ACGP-RPE---NPSELLSSES-FANVLQLLRDQFDFVIVDTPPVLAVSDPMAVA--ARVD
A0A2E9VK20      SAGA-IPA---KPAELLSSSK-LHYLLGQAKRDYDFVLVDSPPVLAVSDPCITA--QSVD
A0A3D4PJK1      SAGA-IPA---KPAELLSSSK-LHYLLGQAKRDYDFVLVDSPPVLAVSDPCITA--QSVD
A0A355AI52      PAGR-RPP---NPGELLLGDR-FAELLAWADGEYDQVIVDAPPVLAGTDAAAVG--RLCD
A0A354PCQ3      PAGQ-LTA---SPHRLMSPER-LQEFMREALSHYSYVVIDTAPVLSAGETLAVA--STME
A0A0S8GZ23      TADGRNPA---EAVELLEKPQ-TAECINNISQRYDHVIIDTPPVLAVPDARLWA--RMAD
A0A1I3DDV4      TAGS-AVR---NPAELLQSEV-FDQVLEDCKSRFDMVLVDSGPVLLVSDPAIVS--QKCD
A0A2E0SMM6      PSGG-RPV---NPSELLSSNR-LSDFLAWAETVYDQIIIDAPPILAVSDAGIVG--RLAD
A0A3L7SI46      PSGS-RPA---NPSELLASDR-FNDILAWAESAYDQILIDAPPVLAVTDPAIIG--RLVD
A0A5B9PJZ8      TCGP-IPP---NPSELLTSAR-FEAIIGVYREQYDYILIDTPPLLAVTDPAIVC--RFVD
A0A2S8G191      AAGD-WGH---NSFRELTSNR-MDAFFKKLRQEYDYVIVDGSPILPVVDARLIG--QYVD
A0A2E7EGG1      PAGY-LDR---SPHKLMANEG-FKQLIAKARDSYRYIVVDTPPVLAASESLVMA--RDAD
A0A2E2N5A9      CAGT-AVR---DPLSLLSSSR-FSALIEALKTRYDRIVVDSPPTQGVSDAMVLA--AHAE
A0A7C8AGA2      AADHRNVS---DALDLLGKPR-TGQSIERISADYDHVIIDTPPVLAFSDALLWA--RMAD
A0A7C2FXP7      AADSRNVS---DALNLLSQKN-TAQCIRQASLAYDRVVIDTPPILAFPDALVWS--KIAG
A0A2E3GWC6      SAGA-IPA---KPAELLSSAK-LHYLFGEATREYDFVLVDSPPILAVSDPSITA--RSVD
F0SLB0          TAGA-IPG---KPAELLSSAK-LHYVFGEATREYDFVLVDSPPILAVSDPSITA--RSVD
A0A3L7NDH9      PAGQ-RPS---NPAELLLSER-FSELLSWAETTYDQIIVDASPVLAGTDAAAIG--RVCD
A0A1N6DAJ8      PAGL-CDS---DSIQALACRD-LRAMFDQLKEQYDFIVVDSSPVLPVADAMLIG--QHVD
A0A532UD06      SCGS-QVP---NPSEMLNSDV-FAQMLKDLPKCYDRVIIDSPPVLPVADSQIIA--ASCD
A0A660URN1      PCGP-EVP---NPSEILNSDT-FANMLNELVQKYDRVIIDSPPVTPVADSQILA--AICD
A0A517ZCB5      PAGP-RPA---NPVELLSGDR-LSMLVAWAETHYDQVLIDAPPSLAAADGQIIG--RMVD
A0A225EH48      PAGQCSNR---VIAALAQGHP-LETLFNRLRGQFDFIVVDSCPVLPVADALLVG--QHVD
A0A518INW8      SHGH-HAS---EPAELLESFA-LERLIAEARQEYDFVFIDSPPLLAVADPLIIA--SLVD
A0A518JPH9      CHGH-HAS---EPAELLESFA-LETLIAEARQDYDFVFIDSPPLLAVADPLIIA--AQAD
A0A5C5VEK8      PAGP-SPS---NPLELLNNDY-LIEVLERLKARYDRIIIDSPPVMPVADSRVIA--AMSD
A0A532UTJ0      AADFDNAA---DAYEMLAMPA-TKKRINTISRKYDHVIIDTPPTLGFPDALMWA--KIGG
A0A432MFP3      PAGS-PEA---YPNRILRGKA-FAPMLERLRRSFDVVIIDTSPVLPVPDALILG--RLAD
A0A2E2CCW9      TAGM-LPE---NPSEMLMSRA-FSELVNQLRKEYDYVLIDTPPLVVVSDPSVIA--SIVD
A0A3C0AGX3      TAGM-LPE---NPSEMLMSRA-FSELVNQLRKEYDYVLIDTPPLVVVSDPSVIA--SMVD
A0A518AAQ5      TAGM-LPE---NPSEMLMSRR-FAETVNQLRNDYDYVLIDTPPLVVVSDPSVIA--SIVD
A0A517QBG9      TAGM-LPE---NPSEMLVSRR-FAETVNQLRNDYDYVLIDTPPLVVVSDPSVIA--SIVD
A0A518FTU3      TAGM-LPE---NPSEMLVSRR-FTETVNQLRNDYDYVLIDTPPLVVVSDPSVIA--SIVD
A0A517WHH5      TAGM-LPE---NPSEMLMSRR-FAEMISQLRNEYDYILVDTPPLVVVSDPSVIA--STVD
A0A5A8BGT3      TAGM-LPE---NPSEMLMSRR-FAEMISQLRNEYDYILVDTPPLVVVSDPSVIA--STVD
A0A2E7K7A9      TAGM-LPE---NPSEMLMSRR-FAEMVNQLRNEYDYILVDTPPLVVVSDPSVIA--STVD
A0A517PTS5      TAGM-LPE---NPSEMLMSRR-FAEMVNQLRNEYDYILVDTPPLVVVSDPSVIA--STVD
A0A6I6AH34      TAGM-LPE---NPSEMLMSRR-FAEMINQLRNEYDYILIDTPPLVVVSDPSVIA--STVD
A0A517VTK3      TAGT-LPE---NPSEMLMSKR-FTHLLKQVRNDFDYVLVDTPPLAVVSDPSIVA--SSVD
A0A517WQT4      TAGT-LPE---NPSEMLMSKR-FTHLLKQVRNDFDYVLVDTPPLAVVSDPSIVA--SSVD
A0A517VID8      TAGM-LPE---NPSEMLMSRG-FSELVNQLRNDYDYILIDTPPLVVVSDPSVIA--SIVD
A0A517RK10      TAGT-LPE---NPSEMLMSRR-FIDLIKQLRNEYDYVLIDTPPLVVVSDPSVIA--STVD
A0A518IH18      TAGT-LPE---NPSEMLMSRR-FTDLIKQLRDAYDYVLIDTPPLVVVSDPSVIA--STVD
A0A5C5XLF4      SAGS-IPA---KPAELLSSSK-LHYLLGQAKREYDFVLVDSPPVLAVSDPCITA--QSVD
A0A2D5NDU9      AAGT-PPS---NPTEILNSEK-FGDLIAQACATYDRVIVDSSPMLPVADARILA--TKCD
A0A1P8WP26      SCGP-RPV---NPAELLSSER-FANLLAWAETRYDQIIVDAPPVLAVSDPLIIA--RLVD
A0A3L7V1F3      SCGP-RPV---NPAELLSSER-FSNMLAWAETKYDQIIVDAPPVLAVSDPAIVG--RLVD
D5SZ21          PAGP-RPA---NPLELLSSTR-FSELLAYVESQYDQVLIDAPPILAVSDAGVLG--RMVD
A0A286RGB6      TAGY-WSP---HRMAVLANGV-IGGLFRQLREDFDFVIVDGSPVLPVADTRFIS--THTD
A0A518CHE5      PSGS-RPV---NPSELLSSNR-LSDFLSWAETVYDQIIIDAPPILAVSDAGIVG--RLVD
A0A1V5N3W2      TADHRNNG---QAIDQLARPE-TAEIIRTISQNYDHVIIDTPPVLAIPDALLWS--KMAD
A0A3E0MY27      PAGR-CDH---ESIQSLTKEI-LGATLEQLRAEFDIIVIDTGPVLSVVDPLLIG--QHCD
A0A7C4Z5R7      PAG--HGD---HFRSPLTQEA-VQLVFEQLKGEFDFILIDTSPVLPVADALVIG--QHTD
A0A2E0X9P6      PAGR-SQD---NPHHLLLGGR-IKELFDRLQRDYALIVVDTPPVLAASESLVLA--RAAD
A0A286RLF2      PCGR-RPA---NPAELLAGPR-TAELLNWAVEHYDQVIIDSPPAPLASDTAIWG--RLAD
A0A517NSK8      GSGA-VPA---NPAELLQSED-FASLLKHWAEEFDYVIVDSPPVLAVSDAAIIS--QKCD
A0A5C5Z0D6      SAGS-IPE---NPSELLQSDK-FAQLLNAWRSEFDFIIVDTPPVLAVSDATIVS--EETD
M5UE94          SAGA-IPA---NPSELLQSDR-FSQLINVWRDKFDFIVVDTPPVLAVSDAAVVS--EEMD
A0A2E8FLY0      PAGP-RPL---NPAELLHGDR-FSELLAWAETVYDQILIDAPPALAVSDAAIIS--RQVD
A0A3D2U1E1      PSGA-RPA---NPAELLHGTR-FSELLAWAESIYDQILIDAPPALAVTDAAIIS--RQVD
E8R3W3          AAGE-GDP---QTIELLNHNL-LAGLIEQARGVFDFIIIDSAPVLPVSDTLLVG--RAVD
A0A5C5ZM48      PAGK-AVS---TPHRKLSWLQ--ERVLAAAREDYDYVVIDTPPLLVASEALMLA--RAAD
A0A5B9WF77      AAGT-PVP---DASRIVQGRS-FPMLIAQLRQTYEMIIIDSPPVLPVPDALALG--RWTD
A0A518BBX8      PCGP-LPE---NPAELLTSPH-FEELVEGVREKFDFVVIDTPPVLAVSDPSVVA--VRVD
A0A1P8WN28      PCGP-RIL---NAGMLLSMPA-LADILDWAVSEYDQVIVDCPPTLPVSDAAIVG--RYVD
A0A3B9CTT0      PCGP-RIL---NAGTLLSMPA-LSELLDWAVANYDQVMVDCPPSMPVSDAAIVG--RYVD
A0A518ALT3      PAGS-ERI---NPHQVVEGSA-IPDLLRKLGKRFSTVIIDTPPVLSASEALVYA--KASD
A0A3M1QRP3      VSSRPARL---EESEILAGVA-PQRCLDAWRERYDMVLLDCSPILPVADARILA--RLAD
A0A517TMV0      PAGP-RRP---DPAELLLGPN-LAELLAWADSRYDQVLLDCPPILAVSDAQIAA--RLVD
A0A3E0MY88      PSGP-RRP---NPAELLTSRR-LADLLAWAETHYDQILVDSPPVLAASDVMVIG--RIVD
A0A5B9QF68      PVGL-RRP---NPAELLSSHE-FVELLAWADSQYDRVIVDCPPVLAVSDAQVVG--QLVD
A0A5B9QGF0      PVGL-RRP---NPAELLSSNE-FVELLAWADSQYDRVIVDCPPVLAVSDAQVVG--QLVD
A0A5C6CK24      PVGL-RRP---NPAELLSSNE-FVELLAWADSQYDRVIVDCPPVLAVSDAQVVG--QLVD
A0A2E3RCU8      PAGP-RRQ---NPSELLASDR-LAQILAWAEGEYDQILVDCPPTLVASDAVLVG--RITD
A0A1C3E6N1      PAGP-RPA---NPLELLSSTR-FSELLAYVESQYDQVLIDAPPILAVSDAGVLG--RMVD
A0A518GJT2      PAGP-RPA---NPLELLSSTR-FSELLAYVESQYDQVLIDAPPILAVSDAGVLG--RMVD
A0A2E8B0L9      VCGP-KPP---NPVELLTDSR-FVDVIAWAETHYDQVLIDCPPVMAASDAAVVG--RLVD
A0A5Q4GFE7      PCGP-KPS---NPAELLSGPR-LADVLAWAEANYDQVLIDCPPILAAADAAIIG--RLTE
A0A257WS34      PSGA-RPI---NPSELLSTER-FSDVIAWAETIYDQILIDAPPILAVADPAIIG--RMVD
A0A7C4LP10      PSGP-RPA---NPSELLSSER-FNDLLAWAESIYDQILIDAPPVLAVTDPAIIG--RMVD
A0A517MLW3      PCGA-RPL---DPAELLASNA-LSDIVQWAASRYDHVVLDCPPVLIANDVALVT--RLTD
A0A5B9QVD0      PSGA-RPL---DPAELLSGPR-FSEVLEWATTQYDQIVLDCPPVLVANDVALAS--RLAD
A0A3A0DET7      PCGP-LPA---NPVELLNNGY-FAELLESLKTRYDRIVIDSPPVLPVADARVIA--AVSD
A0A3B8PNV4      PAGP-RPT---SPAELLHGGR-FAELIAWAESSYDQILIDAPPTLAVSDPAIIG--TMVD
A0A3D1DR40      PAGP-RPT---SPAELLHGGR-FAELIAWAESSYDQILIDAPPTLAVSDPAIIG--TMVD
A0A2E7RYU8      PAGP-RPG---SPAELLHGGR-FAELIAWAESAYDQILIDAPPTLAVSDPAIIG--TMVD
A0A3B8LXG8      PAGP-RPG---SPAELLHGGR-FAELIAWAESAYDQILIDAPPTLAVSDPAIIG--TMVD
A0A286RD13      TAGH-CDG---EVLEAVSQGK-LDRFLQSLRDQCDLVLVDSSPILTTADALILA--HVAD
A0A2E3GWX1      AAGP-RPS---NPVELLTSDR-FAELIAWAEGEYDQILIDAPPSLAVTDPAIIG--RLVD
F0SG60          AAGP-RPS---NPVELLTSDR-FAELIAWAEGEYDQILIDAPPSLAVTDPAIIG--RLVD
A0A2E9VST2      SAGP-RPS---NPVELLTSER-FEELIGWAEGVYDQILIDAPPSLAVTDPAIIG--RLVD
A0A356A6X2      SAGP-RPS---NPVELLTSER-FEELIGWAEGVYDQILIDAPPSLAVTDPAIIG--RLVD
A0A5C5XLM3      SAGP-RPS---NPVELLTSER-FEELIGWAEGVYDQILIDAPPSLAVTDPAIIG--RLVD
A0A7C5FXU1      PAGA-WTD---DLLSRILNGV-GQEFFARLRSSYEFVVIDCPPILPVADGRFIS--LFAD
A0A3M1VCL4      PSGP-RPS---NPAELLGSPR-FVDLLAWAETTYDQILVDAPPALAVADPTAVG--RFVD
A0A5C5V7Z9      PAGP-RRP---DAAELLSGPN-FTELLAWAEARYDQVLVDCPPVLAVSDAQIIG--RLVD
A0A5C5YT05      PAGP-RRP---DAAELLSGPN-FGELLAWAEGRYDQVLVDCPPVLAVSDAQIIG--RLVD
A0A518D7F9      PAGP-RRP---DPAELLVGPA-LTELLAWADSRYDQVLIDCPPVLAVSDAQIVG--RLVD
A0A5C5ZIP0      PAGP-RRP---DPAELLLGPN-FSELLAWADANYDQVLIDCPPVLAVSDAQIVG--RMVD
A0A518KBK3      PAGP-RRP---DPAELLLSPN-FAELLAWADSKYDQVLIDCPPILAVSDAQIAA--RLVD
A0A5C6AKF9      PAGP-RRP---DPAELLLGTN-FADLLAWADSRYDQVLVDCPPILAVSDAQIAA--RLVD
A0A6M5Z0K7      AAGEMSEA---AAAGLASPGA-VQRLIEELRGRYDFIVIDSSPLMLVPDAMMVA--GCVD
A0A350CI62      SCGP-RPV---NPAELLSSER-FAALLSWAETRYDQIIVDAPPVLAVSDPAIAG--RLVD
A0A4P5WQK6      SCGP-RPV---NPAELLSSER-FAALLSWAETRYDQIIVDAPPVLAVSDPAIAG--RLVD
A0A3C1X4W5      SCGP-RPV---NPAELLQSER-FAALLSWAETRYDQIVVDAPPVLAVSDPAIAG--RLVD
A0A3D3W3A7      SCGP-RPV---NPAELLQSER-FAALLSWAETRYDQIVVDAPPVLAVSDPAIAG--RLVD
A0A518DRX3      PCGP-KAF---DAAELLSGSR-IEELIAWAEIHYDQLLIDTPPILAASDAALAA--RHTD
A0A518DZF9      PCGP-KAF---DAAELLSGSR-IEELIAWAEIHYDQLLIDTPPILAASDAALAA--RHTD
A0A518AKT8      PAGL-RRP---NPAELLSSQE-FIELLAWADSQYDQVLVDCPPVLAVSDAQIVG--RLVD
A0A5C5ZR72      PAGK-SRS---DHQLLLQPQR-LSQLIESARDRFDTILIDTPPVLGASEALSLC--RSAD
A0A7C5R0U3      PAGR-KTA---DAAELLQRDA-LVRLLAWAEAQYDLVLVDCPPVMAASDAAIVG--DRVD
A0A517TY85      PAGK-LRG---SPHHIFEGVK-IEGVLKGLREKFNTIIIDTPPILAASESLVFA--KAAD
A0A5B9QEI7      PAGV-LKG---NPHHLIDQAK-IEKLLDKLRGSFDTILIDTPPVLSASDSLIYA--KAAD
F0SI78          TAGK-KNE---QYGELLHNPK-LASVLDALRDKYDVIFIDSPPVLAVADATAIA--PLAD
A0A517MDV3      PSGF-RPS---NPSELLMGKT-FFEMLETLRQKYEYILIDSTPLLAVSESTSLG--QKVD
A0A518IQ30      PAGP-RPQ---DPTELFSSSH-FGELLAWAEANYDQVLVDCPPVVAASDAAIIG--RFVD
A0A517LWP4      PAGP-RPQ---DPTELFSSSH-FGELLAWAEANYDQVLVDCPPVVAASDAAIIG--RFVD
A0A518JNW8      PAGP-RPQ---DPTELFSSSH-FGELLAWAEANYDQVLVDCPPVVAASDAAIIG--RFVD
A0A2E7ENQ5      PAGP-LPT---DPSGLLTNRR-FAEFVAWACDHYDQVLIDTPPILAASDASIVS--RLTG
A0A7C2KUQ9      PAGRLGAS---HDPELLANGM-IAASLKRWKSQYDVVLLDASPVLPVADARILA--RLVD
A0A7C5BZF0      PCGP-RPA---NPAELLSSQR-FSELLAWAESAYEQVFVDSPPALATSDAALIG--RITG
A0A1G3AQE9      ASGP-RPS---NPAELLSSQR-FSELLAWAESVYDQILIDSPPVLAASDTAVIG--RLTS
A0A3L7UQT9      PSGS-RPS---NPAELLASER-FSELLAWAETCYDQILVDAPPVLAVADPIIIG--RMVD
A0A4P5YBU2      PSGS-RPS---NPAELLASER-FSELLAWAETCYDQILVDAPPVLAVADPIIIG--RMVD
A0A7C7V5U8      PSGP-RPS---NPAELLASPR-LADLLAWAESVYDRVLVDSPPALAASDTAIIG--RLVD
                                                    :..*  *     .           

A0A5S9IPR9      GLLFAITVHRTPKRMVKQLIHRMQTLDIELSGLILNDVKG-----SYSSQLSYYNYYGLY
A0A533Q9U4      GAVFVIKSNKTTKDAARKAIDHFSDMRDKLLGVVINDVDF--------------SRDKYY
A0A1U9NNE1      ATILASFAGKTAADDLKEAYGRLHELNITVLGTVLNGVHT---------------AHSYN
A0A2G2JCA2      VSLVCAMRDVSRISQVQSVVERLESVGASPMGTVLNGVSA-------------SYYSYHY
A0A533Q6B7      GIVFVLRNKKTSIAIAQKGAGCISAVHDKILGVVINDL-------------------DFS
A0A5S9IJB5      TGLLVVKNFKTPAKAVHIAKDVLSSNQVKLSGIILNNMEV---------PKGRYYNSGY-
A0A1G2XVR0      GVVFVIKSGQTPKELTRRALLQYKNSKSDLLGIILNLVDV-------SKGGYYSYYYSHY
A0A1G3B0P0      GVVFVIKSGQTPKELTRRALLQYKNSKSDLLGIILNLVDV-------SKGGYYSYYYSHY
A0A1E3X4X0      ASLLLVKTGETNRDAVKRSIAQFNDINAKVLGVVMNNVDL-------SKGSYYYHYYQYY
A0A286U4B3      GIIYVIKSGKISKESARRSLHQFAGKKAEVLGVVINSVDA-------ARGDF------YG
A0A5C6DDS2      GIIYVIKSGVVAKEAAKRSLSQFAGKKGEVLGVVMNSVDV-------AKGGYYQYGYQYG
A0A2E3GW02      SLLLVIKNSKHSRPHAKQARESLDLVGAPLEGMVVNLVCE---ETSYRYEGGHYRRGMYG
A0A5B9QNZ7      GVVLALRTANTSRPEAERAVQRLQSVGVEPLGFVVNDIDYLSRQGD---------EGKYG
A0A1Z8N7H5      GMVLIVRPDKNRRKLVXRAXQNLTEMKIPLFGLVANGVGAENNK-----------GYSFG
A0A1G2YPI3      ITLLVLRAEKSTRRNCLQAKHGLLSVGAHVLGVVVNDVPK---------------KGHYG
A0A1U7CZ81      GAVLASRYDISRAPQVERARRQLTNAGIPVLGTVINGMKS---------------SDAYY
A0A142YNY8      GVVLTSRYDVSRAPQVERARRQLDLAGIPVLGTVINGMRT---------------SDSYY
A0A1U7GLS6      GVVLASRFDVSRAPQVERARRQLDLAGIPVLGTVINGMRT---------------SDSYY
A0A532UIN2      VTLLVLRAKKSTRKTSQQAKDGLSSVGAHILGALVNDVQG--------------------
A0A0S8KNX5      AVILTSFAGHTTMPDLKEATDRLAQINVRVLGTVLSSVQA--------------------
A0A3D3UVZ8      AVILVSYAGHTTMPDLKEAKERLLQINVKVLGTVLSSVQA--------------------
A0A517NFU9      SVVMTIRVSKNGRRPVEQATKILQDIGMQPSAVIVNGVDQDAKSYGYGN----------Y
A0A5C5YWH4      AVVLTVRVNKHARGPVEQASKILQDQGLAPAAIVVNGVDQSSKSYGYGS----------Y
A0A3D2TNK4      GAILVVRPEKNHRRSVMRAVESFHATGCHVFGVVANGLSSDSSGYGYGY--------GYG
A0A7C1Y4F0      ITVLVLRAEKSTRRQAQHARDSLLSVGARLLGAVVNDVQQKRGQ-----------YGYYS
A0A6I0ENW6      GTIMAVRASQTRRAEAMEALAELSAAGARLFGTVLIGTDP---------------RGGYY
A0A6L3A0B7      GTIMAVRASQTRRAEAMEALAELSAAGARLFGTVLIGTDP---------------RGGYY
A0A0J1B4A0      GVFLAVRIEKNNRTLVERATEVLTDKGIAIEGVIVNSRDSRSNHYAYSS------YDYYG
A0A142WSB9      AMLLVVRLEKNNRTVLRRACEQLDAHGIRLLGVIANDAAA---STQTEG-----------
M5SZR3          GLLLSVRLDKTTRKQAETAREILLSLDAPIVGIVANCVRT--------SELDALGRARYG
M5TW92          GLLLSVRLDKTTRKQAETAREILLSLDAPIIGIVANCVRT--------SELDALGRARYG
A0A2S8FKY2      GVILSIFKDVSQVAQVDDAKRILNSFGAPIIGTVLSGYSS--------------------
A0A517N8P6      GVMVVMRIGRNIKPMSKRAITMLRMLHVNIIGLVINAVGDSGYSATYSQAWSDSYGGQPG
A0A432MJP4      GVLLVLRPSEIRRAAMHRVAEVVQMMGTPLLGSVVNADGS--DDAQFLH------AGRY-
M5UQ35          GCLLAVRVAKNNRTIVQRAAEILDEHGSRAMGVVINTQSPRSGDYGYSS------YNYYG
A0A0S8FY64      GVVIVLKASKSRCKAADRARRQLAAVNGRIIGAVLNDVRP---KTLRRY------G----
A0A1N6KFT7      GVVLVVRPEATKRHDAERTVELLKTMESPVLGFIVNGIDR---QNASGY------GQGYG
L0DFG4          GVVLVVRPEATKRHDAERTVELLKTMESPVLGFIVNGMDR---QGTGSY------GQGYG
A0A5C5XXG1      GMVLVIRAASARRDEVMNSLKRVTDAGGNMVGCVLNTFGA---GKSFDL------GGGYY
A0A7C7YUM8      ALLMVYRSGVVPGRVLTSAVNKLRQADVNLFGVILNAVFV---SRA-ST------SYGYG
A0A7C2AHI6      AIVLLYRAGGVPREVFQAALRRLKTSRANLVGAILNAVRP---TRA-GS----------R
A0A518BJJ1      AVLLLYRSDGLPREAVSLATTRLRQAGAKLVGCVMNAHRA---DRS-SA------SDRYQ
A0A518D182      AIVLLYRAGGLPSRVVENTAKRMRASGAKIVGLVMNACRP---EKA-KG------AGAYS
A0A5C5WTY6      ASLLVSRVATNKRHQVINAAKRIDAAGGQWIGALLNIVQA---PKEFHE------QG---
A0A5C5Y033      GAVLVVRVARIRREQLANALQRLQSTGANLIGSMLNVVGA---DKEFDA------GVSQ-
A0A5C6G1Y2      GAVLVVRVARIRREQLANAMQRLQSTGANLIGSMLNVVGA---DKEFDA------GVSQ-
A0A354PDV6      GVVVVFRAVTARKSEVANTLRRLSSAGAVTVGSVLNTLGA---QKEFSS------DGGY-
A0A5C6FZ02      GMVLVIRAASARRDEVMNSLKRVTDAGGNMVGCVLNTFGA---GKSFDL------GGGY-
M5TIT3          GGILVVKIANVRRDEVVNTLHRVESAGGNFVGCMINAFGS---GKKFDS------DGGY-
A0A5M6CY44      GSVLVIRVSRARRDEVLNTMRRIRESGGNFVGWMLNSLGA---GTKFDS------AGGY-
F2AXG2          GGILVVKVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGA---GKKFDS------DGGY-
M2BB46          GGILVVKVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGA---GKKFDS------DGGY-
L7CLQ6          GGILVVKVANVRRDEVVNTLRRIDSSGGKMLGCMLNAFGA---GKKFDS------DGGY-
A0A0J1B719      GGILVVKVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGA---GKKFDS------DGGY-
Q7UF18          GGILVVKVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGA---GKKFDS------DGGY-
A0A2G1W1E0      GGILVVKVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGA---GKKFDS------DGGY-
K5E235          GGILVVKVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGA---GKKFDS------DGGY-
A0A5C6FFI9      GVILTVRIAKNGRRPVEQAGRILNDNGIVPLALIVNGVDAGKRSS--YG------YGGYR
A0A5C5WDJ1      SVLLTVRVIKNGRSIVEDAVRVLHDIQVEPTAVIVNGVDK--NALRSYQ------YGGYG
A0A5C5X547      GVILALTRDVSVVPDAISARDILRSHGATVIGTIVSGHPVRGRYDLYN------------
A0A353FIP5      AILLLVRFNLSSESEVAGACHRLKLAGAKTLGAVLNGQKG---GDEKDY-----------
A0A5B1CIK7      GGVLVVRVANVRRDEVINTMRRIAASGGNFVGCVLNAFGS---GQKFNV------QGGY-
A0A5C5WHS2      GGVLVVRVSRVRRDEVINTMRRIESSGGNFVGCMLNAFGA---GKKFNV------EGGY-
A0A5C6B6G8      GGVLVIRVARVRRDEVINTMRRIRSSGGNFVGCMLNALGA---GANFDG------AGGY-
A0A5C5ZZN3      SGILVVRVANVRRDEVINTIRRIESAGGQFAGCMLNAFGA---GKKFDG------GGGY-
A0A5C5XS91      GAILVVRVSKVRRDEVVNTLRRVETAGGNFVGCMLNTYGA---AKAFDA------DGGY-
A0A5C6C4E6      GAILVIRVSKVRRDEVVNTLRRVETAGGNFVGCMLNTYGA---SKAFDA------DGGY-
A0A2E1VVJ1      AIFLLCRSNLLPEAVIEQATHRLRVSGAPAIGAILNGHRPSRLQRDYSS------YGYG-
A0A3M2AEL0      ALFMLCRAGVVPEVVAASATKRIRLTGAKLMGCILNGVRAPRLGR-YSR------YGYS-
A0A2A2W9R6      GCLLTVRIEKNNRTLVERAAEILRDQRVPIDGVIVNGRDSRRRSYGYSS------YNYYG
A0A518HKC1      SCLLAVRIEKNNRTLVERATEILRDQCVPIDGVIVNGRDSRRRGYGYSS------YNYYG
A0A518L3P0      SCLLTVRIEKNNRTLVERAAEILRDQCVPIDGVIVNGRDSRRRGYGYSS------YNYYG
A0A255R1S0      CVLMGVRIEKNNRTLVERAADILREQSTPAEAVIVNGRAS-RRGYGYTG------YNYYS
A0A5B9MKP1      SCLLAVRIEKNSRTFVERAAEILRDHHVPIDGVIVNSRDSRRRGYGYSS------YNYYG
A0A0S8J591      CVVLVVQASKNRRGLVMRAKNQLASVNARLAGAVLNNVR------------------GTK
A0A351FYP6      LCVLVVQYRKYPQLMTQRAKDMVIKVGGDLVGVVLNNINI-------SQDSYYYYYSGYY
A0A532UT69      VTLLVLRADKSTREASRRACASLSSVGAHILGVVVNNVSK-KNS-----------YGYYG
A0A2D5AWU0      LCIFVTRLCVSTSPNAIRALGILRGVDARVVGTFVNDDSA-KKT---NAYAGGIAYGAFR
A0A1G2YQB7      GVIMTSLAGRTETPDLKESIERLKQININLIGIVLSNVSY-NKV---Y------------
A0A353P687      GVILTSLAGHTETPDLKDTIERLKQINVNLLGIVLSNVKY-NQI---Y------------
A0A356EME5      ASLVCAMQDVSRASQVRTACERLVAAGCRPVAAVLNGVSS-RRY---E-----------Y
M5RT57          GSLLCTRRNVSREGQVKIAHDRLTKAGIKPLGTVLNGV----PT---RSY-----AKTYG
A0A356KTN1      AVIQVVSARTSSRSAATQANTELSRLGAAPVGLIFNQQPQ-DEA---GAY-----FYYYS
A0A518HFS8      AALLSVLRLVSRAPDVGEAYERLATLGVRILGAVVSGVRD-DPN------------LSDD
L0DC26          AVIFSVMRDVSRIPTVHAAYERLSRLGIRMLGAIVTGEQT-DHY---G------------
A0A3L7P4E4      GVILVVRMNGRTRMGAVRAAETLRTLGANILGLIANGIDP-TKH---G------------
A0A3L7PEB5      GVILVVRMNGRTRMGAVRAAETLRTLGANILGLIANGIDP-TKH---G------------
A0A1U9NL64      VTLLVLRADSSTRNVSVAACEALAGVGARPLGVVVTA-PG-KKM---SKYGYGYGYGYGY
A0A2N1UCJ3      ITILVIRAEKSTRKLAQQAREALAGIGARVLGAVVNDVSP-KHS---R-------YGYYS
A0A7C4EK84      VTLLVIRSEKSSRRLARHALESLTSVGAKVLGVILNDVTR-SGE---P-------YGYAY
A0A7C3F0T2      QTILTVRAEKSHRKFAERACQGLNDVGAHILGVVINAVP--RKE---DRYYHYSGYGYYY
A0A2E0X4J3      ATLLVLRAERATRRLCQAARNELWQVRAKRLGVVVNGVPM-RGA---GSYGYGGGY-GYG
A0A5C5YU10      AVLLVLRAEKSTRRLSLAARDELWRVRAQRLGIVVNAVPQ-SKG---GSYGYGYGYG---
A0A517MPZ6      ATILVLRADCSTRRMSVAARDELWRVRAQRIGIVVNAVPG-RKQ---ANYSQGYGY-GYG
A0A5C6CNV7      ATILVLRADRSTRRMSVASRDELWKVHAQRIGVVVNAVPA-RQQ---SSYSSGYGYGGYG
A0A518K5H4      CSLLVLRAERSTRRISVGARDELLRVRTQRLGVVVNAAPI-HRS---N-------FGGYS
A0A5C6AA28      CSLLVLRAERSTRRISVSARDELLKVRTQRLGVIVNAAPL-HRA---S-------YGGYY
A0A2E7ESJ6      GVILTFRIHKRARPLALRARDALVTTGANVIGVVVNGVDH-ET----SSYYSEYKY-GYA
A0A2E9VK20      TVMLIVRLHKNRRPSVKRALEMFEAHEIPLLGVIANGLQD-------ASGDYQYRG-GYG
A0A3D4PJK1      TVMLIVRLHKNRRPSVKRALEMFEAHEIPLLGVIANGLQD-------ASGDYQYRG-GYG
A0A355AI52      GLMLVVRPEKNRRRVLIKAVETLRMLGVTLFGTIVNAVGL-------EEMGYGYGY-GY-
A0A354PCQ3      ATLLCVMRDVSRLDSIHQTTRRLEAAGASVIGTVFSGV---------TSRQYVYRYGDY-
A0A0S8GZ23      AVVLSSLAGQTESSDLKETLDLLSQINVKILGNVLCNVSP-------SSSHYRYRY----
A0A1I3DDV4      IAMLVVRPAIDTKRKVFESIRRLTSSKSNLRGCILNTYGS-SKEFTRDSGY--YSSYNY-
A0A2E0SMM6      TLILIMRPDKNRRGMVFRSIETLQMFGIHISGVVVNHLTP-------DQGGEYYGY----
A0A3L7SI46      GAVVVIRPDKNRRKLVLRAVESFRMSGVEVIGIVANHIGS-K-----SNSEYGYGY-GY-
A0A5B9PJZ8      LVYMVMRITNGVRSNSVRAKEVIDSMGVELSGVIINGLRR-RDQKTYDYKGGKYGYGGY-
A0A2S8G191      GVVMAVLRDISRGVKVEEARELLNVFNVPFLGAVVVGITK-E------------------
A0A2E7EGG1      ATLVCAMRDVSRENHVRMTYHRLLSVGARPVGTVLNGVPT-------------RQYARRY
A0A2E2N5A9      ALLFIVRSEVTSSTEVERGVAQLRQNATPVDWVILNQVDI-K-----KAERHGYRYSSYY
A0A7C8AGA2      GVILTSFVDRTSRPDLKEAIKRLERADAKILGTVVNNVKV-------AHSYHRYGY----
A0A7C2FXP7      SAILTSFAKHTSRPELREAITRLEQIGVTILGTVLHNVNM-------SNSYHQYGY-GYN
A0A2E3GWC6      AMMLVVRMQKNNRPSIKRTLELLGSHGVNLMGVIANGVEA-------TGGEYSYRG-GYG
F0SLB0          AMMLVVRMQKNNRPSIKRTLELLGSHGVNLMGVIANGVEA-------TGGEYSYRG-GYG
A0A3L7NDH9      GLVMVIRPEKNRRRIIVRSVQTLRAFGVNIFGAVINGV---------GIEADGYGY-GY-
A0A1N6DAJ8      AVLFSIMRDVSRIPKVQEAYERLAKLGIRMLGAIVTGEKS-D---------------HYG
A0A532UD06      VTLLVLRADKSTRRLSRQACDSLVSVGGHLLGAVVNDV---------KHKRGRYSYYNYS
A0A660URN1      VTIMVLRAEKSTRRLSRHARDNLLSVGGHLIGVVVNDV---------SQRSGRYGYGRYG
A0A517ZCB5      GAIMTVRPDKNRRRMVMRAVEALSELGCNVYGLIVNHVSP-Q-----SDSEYSYGY-GY-
A0A225EH48      GVVISILQDISQLPKVLTASEKLTQLNIPLLGAVVNGIKP-----------------DIH
A0A518INW8      SVLLVVRVQKNGRRPVERSRELLASNKVKVAGVIVNGG---------ERADKHFGYGEYV
A0A518JPH9      TVLMVVRVQKNGRRPVERSRELLTSNKIKVAGIIVNGA---------ERGDKNFGYGEYV
A0A5C5VEK8      AVLLVLRAEKSTRSLSLAARNELWRVRTQRLGVVVNAVPQ-S-----RGSSYGYGY-AYG
A0A532UTJ0      AAILVSFAGHTTMPDLKEAKDRLAEINVKVLGTVLSSVDA--------------------
A0A432MFP3      GAVIATRHDQSRFPAVERANGLLTGAGIPVLGVVVNGA---------RTSDRRFGT-GYA
A0A2E2CCW9      GVLLVVRIDKNRRGVIRKVQQIIQTNGIKVAGILANSVKS-G---------------KPG
A0A3C0AGX3      GVLLVVRIDKNRRGVIRKVQQIIQTNGIKVAGILANSVKS-G---------------KPG
A0A518AAQ5      GVLLVVRIDKNRRGIIRKVQQVIQTNGIRITGLIANNVIT-N---------------SLA
A0A517QBG9      GVLLVVRIDKNRRGIIRKVQQIIQTNGIRITGLIANNVIT-N---------------SLA
A0A518FTU3      GVLLVVRIDKNRRGIIRKVQQIIQTNGIRITGLIANNVIT-N---------------SLA
A0A517WHH5      GVLLVVRIDKNRRGVIRKVQQIIQTNGIKITGLIANNVIT-N---------------SLV
A0A5A8BGT3      GVLLVVRIDKNRRGVIRKVQQIIQTNGIKITGLIANNVII-N---------------SLV
A0A2E7K7A9      GVLLVVRIDKNRRGVIRKVQQIIQTNGIKITGLIANNVIT-N---------------SLV
A0A517PTS5      GVLLVVRIDKNRRGVIRKVQQIIQTNGIKITGLIANNVIT-N---------------SLV
A0A6I6AH34      GVLLVVRIDKNRRGVIRKVQQIIQTNGIKITGLIANNVIT-N---------------SLV
A0A517VTK3      GVLLVVRVDKNRRGVIRKVQQIIQTNGINVTGILANGIYN-G---------------KSG
A0A517WQT4      GVLLVVRVDKNRRGVIRKVQQIIQTNRINVTGILANGIYN-G---------------KSG
A0A517VID8      GVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTGILANGVQS-G---------------KLG
A0A517RK10      GVLLVVRLDKNRHGVIRKVQQIIQTNGIKVTGVLANGIFS-G---------------RYG
A0A518IH18      GVLLVVRLDKNRRGVMRKVQQVIQTNGIKVTGILANGIFS-G---------------RYG
A0A5C5XLF4      TVMLIVRLHKNRRPSVKRALEIFEAHEIPLLGVIANGLQD-------GSGDYQYRG-GY-
A0A2D5NDU9      ATVLAVSGGSTSTKNVSAAYDALTQVNATVLGIVLNNMPK-------MKGEVAYSY----
A0A1P8WP26      GVVLVVRPDKDRRRMVIRAAEALHNVGSNLLGVVVNHLS--------GSEAEGYGY-GY-
A0A3L7V1F3      AVILVVRPDKDRRRMVIRATETLQTLGCTLLGVVINHLT--------TTDTDGYGY-GY-
D5SZ21          GVVLVVRPDKNQRRSVIRAAETLRMWGNNLLGLALNNMSS-D-----RAGGYGYGY-GY-
A0A286RGB6      GVVLSVVRDISRAPQLRAARQVLESFHVRVLGAVMTGSAE-D---------------VYY
A0A518CHE5      TLVLVMRPDKNRRGLVYRSVETLQMFGIHISGIVVNHLTP-------DQGSDYYGY-GY-
A0A1V5N3W2      AVVLSSLAGHSNLTDFQETFHRLSQLHVRILGNVLANVAA-------RHSYNRYGY-GY-
A0A3E0MY27      GAIVSVVRRVSQISNVYETCQRLQGTGIRLLGSVVNGV---------SGSQVSVGYYGY-
A0A7C4Z5R7      GVLFSVLRDVSRIPLVTAASQRLERLGVRLLGAVFVGAKG-D---------------VY-
A0A2E0X9P6      AVVLCLLSDVSQSQQVRRAARCLDATGSRIAGAVLSGVPM-R---------------RY-
A0A286RLF2      GVILVLQPEKNKRRAVIRAAEYLALLKIPLLGIVINRLSN-------EKEK---DYSGY-
A0A517NSK8      VTLLALRIVKNGRRIAHRAITLLRQHDANVVGLVINGYQS-SNKNYGYIEK--YDSDSY-
A0A5C5Z0D6      AVLLTVRIVKNGRRSAKRARDILRQTGASIAAIVVNGYQT-KDRSYGYTGG--YDAEAY-
M5UE94          NVLLAVRIIKNGRKSAIRACDILQRSGSEVGAIIVNGYQS-KDKKYGYTGG--YDADAY-
A0A2E8FLY0      GGLLVVRPDKNRRRMVIRAAESMAAVEATLIGAVINHIAD-------TAGSEYYGC-GY-
A0A3D2U1E1      GGLLVVRPDKNRRRMVVRATESLAAVGSTMLGAVINHVTA-------EAGGDYYGY-GY-
E8R3W3          AALFVVMRNQSRRDRVYDAYERLHRFGIPVLGTVVTAATS-PKR---------YGYDPYG
A0A5C5ZM48      ASILCAMRDKSRGEQVREAGQRLQAAGVRLAGVVLNGVPA-K------------------
A0A5B9WF77      GALLATRFEVSRSPQVERARRQLDNAGIPVLGTVINGL---------RSSDSYYGRYTY-
A0A518BBX8      GVLLVLRLSKSGRHPAERAKELLSRHGVNVIGVVVNN----------SDRGTRYGYGGY-
A0A1P8WN28      SMLFLMNPDKTHRRSVARAVDQLRSMGLKIVGIVANTSLS-EDT---S------SY-GY-
A0A3B9CTT0      GLLYLMNPATTHRSMISRTVDTLRSLDLTPVGVVVNMGLS-SEK---EGQGYGYGY-GY-
A0A518ALT3      LVVYCSLSDVSRARQVRLATEKLEATGARIAGTVLSGVST-K---------------SY-
A0A3M1QRP3      GTIMVVRDGHSDRRDVLDAIQTLRSAGGTILGSVFNGVPS-------RGGY--YYHGSY-
A0A517TMV0      GVVLVVTPEKNHRRLVSRACDSFLTSGTPLLGVVANRITE-------QAGK------GY-
A0A3E0MY88      GLVLVINPAKNRRRLVTRAYESLRTMGVTVLGIVANRIDQ-------DQSK------GY-
A0A5B9QF68      GAILVVRPEKNHRRSVIRAFESFQSVGCNVLGVVANALSD-------ESQS--YGYGGY-
A0A5B9QGF0      GAILVVRPEKNHRRSVIRAVESFQSVGCNVLGVVANALSD-------ESQT--YGYGGY-
A0A5C6CK24      GAILVVRPEKNHRRSVIRAVESFQSVGCNVLGVVANALSD-------ESQT--YGYGGY-
A0A2E3RCU8      GMVIVVRPEKNRRKVVFRAAQNLSEMKIPVYGLVANCIKA-------ENGK-GYNF-GE-
A0A1C3E6N1      GVVLVVRPDKNQRRSVIRAAETLRMWGNNLLGLALNNMSS-------DRAG------GY-
A0A518GJT2      GVVLVVRPDKNQRRSVIRAAETLRMWGNNLLGLALNNMSS-------DRAG------GY-
A0A2E8B0L9      GIMLVVQPEKNHRRLVLRAAEQLLSMGVNLIGVVPNRVGD-------DSSGYYGGY-GY-
A0A5Q4GFE7      GLIVVIQPEKNHRRLVLRAIAGMSSMGVGLIGIVANRIRH-------ESGGGYFGYGGY-
A0A257WS34      AALVIIRPDKNRRRMVVRAVKSFIGAGVQVVGIAANHLAN-------SPSQ---DY-GY-
A0A7C4LP10      GAVIVIRPDKNRRKMVVRAVEAYRNTGVRVLGAVINHLGD-------VGQE--YGY-GY-
A0A517MLW3      GLVLVVRPEKNSRRHVLRAIERLERFQTNVLGMVINAMDA-------STADGA--Y-GY-
A0A5B9QVD0      GLVLVVRPEKNSRRHVLRAIERLARFNTNVYGLVINGLDS-------ASSDRAYGY-GY-
A0A3A0DET7      ATLLVLRAERSTRRSAIGARNELWRVHANRLGVVLNSVPL-R-----KQAAYGYGD-PY-
A0A3B8PNV4      GVLLVVRPGTNRRRMVLRAAESITAIDADLLGVVINNVDS-------DTGGDYDGY-GY-
A0A3D1DR40      GVLLVVRPGTNRRRMVLRAAESITAIDADLLGVVINNVDS-------DTGGDYDGY-GY-
A0A2E7RYU8      GVLLVVRPGTNRRRMVLRAAESITAIDADLLGVVINNVDS-------DTGSDYDGY-GY-
A0A3B8LXG8      GVLLVVRPGTNRRRMVLRAAESITAIDADLLGVVINNVDS-------DTGSDYDGY-GY-
A0A286RD13      SVVLSVIQDKSRLPRVFEAVQRLRSVDLPLLGIVLHGTAP-SR----------YRS-YYR
A0A2E3GWX1      GVILTVRPDRNRRRMILRAAESLQSLGANLLGVVVNRLSD-------SSGE--YSY-GY-
F0SG60          GVILTVRPDRNRRRMILRAAESLQSLGANLLGVVVNRLSD-------SSGE--YSY-GY-
A0A2E9VST2      GIILTVRPDRNKRRMIIRAAESVTSLGGNLLGVVVNGLSD-------SRGE--YGY-GY-
A0A356A6X2      GIILTVRPDRNKRRMILRAAESVTSLGGTLLGVVVNGLSD-------SRGE--YGY-GY-
A0A5C5XLM3      GIILTVRPDRNKRRMILRAAESVTSLGGTLLGVVVNGLSD-------SRGE--YGY-GY-
A0A7C5FXU1      GVVLVTRRDVSRLPKVIDAYEILRALRVKMLGTVFLGSKE-------D------GY-YY-
A0A3M1VCL4      GALLVIRPDKNRRKMVIRAAEAFRAVDVPLLGIVVNNVSA-------EDGDGYYGY-GY-
A0A5C5V7Z9      GVVVVVTPEKNHRRLVVRACDSFLHAGCHVHGVVANRISN-------KSEG---GY-GY-
A0A5C5YT05      GVVVVVTPEKNHRRLVVRACDSFLHAGCHVHGVVANRISN-------KSEG---GY-GY-
A0A518D7F9      GVVLVVSPEKNHRRLVSRACESFLSAGVHVLGVVANRITQ-------GGGH---GY-GY-
A0A5C5ZIP0      GVVLVVSPEKNHRRLVARAYNSFLTAGVNMVGVVANRISE-------QAGK---GY-GY-
A0A518KBK3      GVVLVVSPEKNHRRLVNRACGHFTSGGAPLVGVVVNRVSD-------QIGK---GY-GY-
A0A5C6AKF9      GVVLVVTPEKNHRRLVTRACSHFSTGGAPLLGVVANRISE-------QAGK---GY-GY-
A0A6M5Z0K7      GLLYSVRPGISRVAEVHAGYERLREHRMPFLGVVVNGVPQ--------------SH-AY-
A0A350CI62      AVVLVVRPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLNV-D-----DAGG--YGY-GY-
A0A4P5WQK6      AVVLVVRPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLNV-D-----DAGG--YGY-GY-
A0A3C1X4W5      AVVLVVRPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLNL-D-----DAGG--YGY-GY-
A0A3D3W3A7      AVVLVVRPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLNL-D-----DAGG--YGY-GY-
A0A518DRX3      GILMVVQPVKNNRRLVMRAVDEIRALDLNLIGVIANRIDV-A-----QAGY--YGY-GY-
A0A518DZF9      GILMVVQPVKNNRRLVMRAVDEIRALDLNLIGVIANRIDV-A-----QAGY--YGY-GY-
A0A518AKT8      GAILVVRPDKNHRRLVARACESFRNTGSQVLGVVANDVSD-M-----HGSG--YGY-GY-
A0A5C5ZR72      MTTLCALRGVSRSRQVKMAAEKLDSAGANLAGAALSGVAP---------MG--YGS-VY-
A0A7C5R0U3      ATMVVVQPGKNRRRPVARAVDRLRALGVHLVGVVANRVTP-E-----PGDD--YGY-GY-
A0A517TY85      LTVVCSLADVSRAKQVRVAVERLHATGANVAGAVLSGVSP---------SH--YVY-NY-
A0A5B9QEI7      LVLFSSLADISRAKQVRCAVERLQTTGANLAGVVLSGVSV---------NR--YVY-HY-
F0SI78          SLLLVIKNSKHSRPHAKQARESLDLVGAPLEGMVVNLVCE-ETSYRYEGGH--YRR-GMY
A0A517MDV3      GVVVALRTSNSSRPETERAVQRLQGVGVQAVGFVVNDIDR-LAK---QGDE--VDA-GY-
A0A518IQ30      GLLMVVQPAKNHRKLVIRSVEQLAQLGVQLTGIILNRVDD--ST---AGSQ--FGY-GY-
A0A517LWP4      GLMMVVQPAKNHRKLVIRSVEQLGQLGVQLTGIILNRVDD--SV---SGGQ--FGY-GY-
A0A518JNW8      GLMMVVQPAKNHRKLVIRSVEQLGQLGVQLTGIILNRVDD--SV---SGGQ--FGY-GY-
A0A2E7ENQ5      GLVLIIQPSKNHRRLVHRAVDEIRAANLELIGVVINRISD--DG---DSAY---GY-SY-
A0A7C2KUQ9      GALLVVREGRCRRGDVADALALLWASGTKPLGTVI--FAS--RN---RIGY--PSY-TV-
A0A7C5BZF0      AVLLVVQPAKSTRRMVLRTIEQFQLLRIPVVGIVLNRVGL---K---EADY--YGY-GYY
A0A1G3AQE9      GVVLVVQPAKNRRRAVMRCVENLSVLKIPLLGIVLNRIGS--EK---EGGY--YGY-GYG
A0A3L7UQT9      AAVLVVRPDKNRRRMVIRAAEAFSAVEVNLMGVVVNHLSS--DS---SGDY--YGY-GY-
A0A4P5YBU2      AAVLVVRPDKNRRHMVIRAAEAFAAVEVNLLGVVVNHLSS--DS---SGDY--YGY-GY-
A0A7C7V5U8      GAMLVVQPEKNRRRLVMRAAESLTSLKINLLGVVINRLAP--DK---DGGY--YGY-DA-
                                                                            

A0A5S9IPR9      YSKSYYTRGLNKNPLGRNSKINPLVDNTKKS-----------------------------
A0A533Q9U4      YQYYYQYYYHYGEKEAKEA-----------------------------------------
A0A1U9NNE1      K-YGYRYYKASSSPADKNGPTRNRPLLLTSGN----------------------------
A0A2G2JCA2      GHYGYNHA----------------------------------------------------
A0A533Q6B7      DEYRYHYYDKKERYYQKA------------------------------------------
A0A5S9IJB5      --YNYGYYGNDGLTT---------------------------------------------
A0A1G2XVR0      YKYGYGYGAEPPKEKRKREKR-----EKKEINV---------------------------
A0A1G3B0P0      YKYGYGYGAEPPKEKRKREKR-----EKKEINV---------------------------
A0A1E3X4X0      YRYGYGEEEEKKGRKKRRSKG---------------------------------------
A0A286U4B3      YGYGYGYGVEEKGKKGIIERMKWTKGKEKVENT---------------------------
A0A5C6DDS2      YQYGYGYGEDTGKKKGLIERM---KGKIKLKNV---------------------------
A0A2E3GW02      SNYNYGTNYSYHQRRYRYYYEGTDA-----------------------------------
A0A5B9QNZ7      YGYHYGAGGKAEKYFRPTASAK--------------------------------------
A0A1Z8N7H5      EGEGYGYGYGYGDDENNDEDEGEIEQQGNRDSYQGISFQSKTFDQSENXQEKLPAKFRKT
A0A1G2YPI3      YYGSYGY---YYGDDRKKKKTGDRRPDGVVKDSALDAKAID-------------------
A0A1U7CZ81      GRYSYSR---GRSGYGEP-DASPTT-----------------------------------
A0A142YNY8      GRYSYSRPGASTTDRERPADATSAG-----------------------------------
A0A1U7GLS6      GRYTYSR---QQSDRERPAGATPAD-----------------------------------
A0A532UIN2      -NGRYGY---YNGYGRNGKKKTGNREPAAGVRRTVVSPSRMAKDSRWRTPLMKT------
A0A0S8KNX5      ---EHSY---YRHGHSYYAQSAQSRESARRSRRKLMFSVDGGVDHSSGLETSVAERSADN
A0A3D3UVZ8      ---EHSY---YRHGHSYYAQSAQTRESARVSRRKLMFSMEEGADNTYDSKIPESDKPGEG
A0A517NFU9      QRDRYGY---VGHYHNQYAATNTENLPSVRTVPSPKGELGPKGEAGLSGELGPKGRSSRS
A0A5C5YWH4      SAGKYAY---VGDYHSQYEATDIES------------------------TIPQRSPRILA
A0A3D2TNK4      YSYDGGY---SHEEEQDMVDTADTMMTPMPEIVQLPSIASEEHLPSASPQEHQSHETPFQ
A0A7C1Y4F0      SYGNYGY---YGKREKKTG-----------------------------------------
A0A6I0ENW6      RGYDYGS---LARRPVEVSGV---------------------------------------
A0A6L3A0B7      RGYDYGS---LARRPVEVSGV---------------------------------------
A0A0J1B4A0      KK-QYGY---VANYRRYYEANDDDDAGSAPRRKRSSSKRTAAASTRSLPIPEAASSNGHV
A0A142WSB9      ---SYGN---YEEYYSTAPATSGGAARSKAAAGKLW------------------------
M5SZR3          YGAYEGY---HQSRNGTTSKSPNRLTSNNGHANGALVTSTGDVEVNGHGDKHSSNPLEER
M5TW92          YGAYEGY---HQSRNGTTSKSPSRLTSNNGHANGALVTSTGDVEVNGHGDTHSSNPLEER
A0A2S8FKY2      -----GM---YYSYTNRSTSTVEVE-----------------------------------
A0A517N8P6      GEYGHSY---YRYGSDRYLDASKGQTITVRSQRSRNADPARAATLSEPVKTTE-------
A0A432MJP4      ----YGR---YGRSYGSVDGSGPRTGSVWPSGTAAGEGASASWAPASLLRRLRTGGPGPG
M5UQ35          KK-ENGY---VASYRRYYAASDVADEETPVSSSARLSAAKLRGVSGLPAQEGRPSRIDVF
A0A0S8FY64      ---SYGY---YYYDYHRYYKDYQEDEGDELEMPASVPVAVEDERPDDGPDEEGSAERFEP
A0A1N6KFT7      Y--GYGY---GYGTYGRGDDGLDQITPSTKEITTSVSSSESTNGLPQPLLKD--------
L0DFG4          YGQGYGY---GYGTYGR--DEVSPIVSDGKEIAAFGPPSKPTNGLPQGILKD--------
A0A5C5XXG1      G--YYES---GYSRPT---NRTKPVTSARIVEVDNDA-----------------------
A0A7C7YUM8      E--EY-------------------------------------------------------
A0A7C2AHI6      S--YYGY---GYENDE---D----------------------------------------
A0A518BJJ1      G--DYGY---GYTDAG---GDGGPPALEGVEAALPSELEREVASASARDERF--------
A0A518D182      D--YYKA---RSAYYQ---DDRSP--------------DRQAA-----------------
A0A5C5WTY6      ----YGY---QSDSYRSRIPVKSQPSKMAAIRSFAAEESVI-------------------
A0A5C5Y033      ----YGY---YRNDYTRSSSQRKRG--RAAATPGSV----------------NNAA----
A0A5C6G1Y2      ----YGY---YRNDYTRSSSQRKRG--RAASATGSV----------------NNAA----
A0A354PDV6      ----YGY---YRSGYSEVSVPQRSL-----QNGAIP----------------SYNGRVGS
A0A5C6FZ02      ----YGY---YESGYSRPTNRTKPV--TSARI-VEV----------------DNDA----
M5TIT3          ----YGY---YKSDYTRAASSNGRKPRVGESSASAA----------------TVNGRASH
A0A5M6CY44      ----SGY---YESDYTRKSSRNGKA--VNGRAKAGR----------------QLSARKTD
F2AXG2          ----YGY---YKSDYTRPSSSTTRQ--AAPKA-ATI----------------SSNGRVAE
M2BB46          ----YGY---YKSDYTRPSSSTTRQ--AAPKA-ATI----------------SSNGRVAE
L7CLQ6          ----YGY---YKSDYTRPSSSTTRQ--AAPKA-ATI----------------SSNGRVAE
A0A0J1B719      ----YGY---YKSDYTRPTSSATRQ--AAPKA-ATI----------------SANGQPKS
Q7UF18          ----YGY---YKSDYTRPSSSTTRQ--AAPKA-ATI----------------SSNGRVAE
A0A2G1W1E0      ----YGY---YKSDYTRPSSSTTRQ--SAPKA-ATI----------------SSNGQPKP
K5E235          ----YGY---YKSDYTRPSSSTTRQ--AAPKA-ATI----------------SSNGRVAE
A0A5C6FFI9      AN-EYAY---VGKYHNEYAASEPSSISTLPRVKGATK--SATSSGSPNASRAVVLGSATP
A0A5C5WDJ1      QN-KYGY---VGRYHHQYGSKPVTKDDSNTTTLEDTWENRLRHSDDLGSRLHHNIDRLNE
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------Y---YEEGRSR-------------------------------------------
A0A5B1CIK7      ----YGY---YQSDYTKSPKKNGAV---------------------------KPL--PAR
A0A5C5WHS2      ----YGY---YRSDYSRPASKNGSS---------------------------KRIASPAR
A0A5C6B6G8      ----YGY---YRSDYTRKKKNGRAEAA-------------------------RPIGSLPA
A0A5C5ZZN3      ----HGY---YKSDYTRPTNAG--SKPARSG---------------------SLNGFSAA
A0A5C5XS91      ----YGY---YRSDYTRPTSKS--ASAERTSRVATVQVNGKSQANGKA----QANGKASA
A0A5C6C4E6      ----YGY---YRSDYTRPKSKSAAAAAERSNRVATAQVNGKAHTNGHANGTSQTNGTSQT
A0A2E1VVJ1      ----YGY------SYKQEGRSSGSEL----------------------------------
A0A3M2AEL0      ----YGY------AYGY-GYGDGSK-----------------------------------
A0A2A2W9R6      KG-EYGY---VDSYRQYYESE----EEDS-SPTSKRS------QKRINGEAAKLNGRS-A
A0A518HKC1      KG-QYGY---VDGYRRYYESD----EEEA-VISNGRS------RKRVNGEAVKMNGRG-A
A0A518L3P0      KD-QYGY---VDGYRRYYESD----DEDAPTSSNGRS------RKRVNGKAAKMNGHA-A
A0A255R1S0      KK-EYGY---VSTYRRYYEADADGQDEDRPIRSARAATSSRVVNGKVNGHAKHASDVAEA
A0A5B9MKP1      KG-QYGY---VDSYRRYYEAE----EEDEPARVNGRS------HKRINGQVAKVNGRTAT
A0A0S8J591      GDYYYYRQRYQPVAEMMEEAGV--------------------------------------
A0A351FYP6      YDYYYKSRETEEEPVEDKKDGKEEKLIAQADAAGEDVNP---------------------
A0A532UT69      G-YKV-------------------------------------------------------
A0A2D5AWU0      K-VEALEAPLPPRSDAGV------------------------------------------
A0A1G2YQB7      --YRYGHDYYGKPATVKELKQNLPSENTSEKVKQQV------------------------
A0A353P687      --YPYGYGYYGKTNVIKDVKQEPADNIVIPEVK---------------------------
A0A356EME5      S-YGYYESVEE-------------------------------------------------
M5RT57          S-YDYARRFE--------------------------------------------------
A0A356KTN1      R-YGYGGEPKDEES----------------------------------------------
A0A518HFS8      R-YHYLSGVKR-------------------------------------------------
L0DC26          -------SSYPSVSRTDKR-----------------------------------------
A0A3L7P4E4      G-YGYQYGVYGAGGRASKYYAEAPNKR---------------------------------
A0A3L7PEB5      G-YGYQYGVYGAGGRASKYYAEAPNKR---------------------------------
A0A1U9NL64      G-YSYEEDDKSSAKSA--------------------------------------------
A0A2N1UCJ3      H-YSYYGYGYG---YGRKKE----------------------------------------
A0A7C4EK84      A-YGYAPLKRTAPGNGNGRASHTASHA---------------------------------
A0A7C3F0T2      K-HGY--------GYGHERRRRKTARGDKEHVGNPEGQLPTVSQR---------------
A0A2E0X4J3      G-YGY--GGYGDPVADEPLPSGRRKKSRVIEPVAAETE----------------------
A0A5C5YU10      --YGY--GNYGEVAYGHEDQRSLGNRKKRLIQARPETPAVVEQT----------------
A0A517MPZ6      N-YGHSSGTYGDLAYGEPEPPVDISRRKKSRARSQQLPSPEATSEAMEPLDI--------
A0A5C6CNV7      A-YGHAGGSYGESAYQLDAYPAN-GRRQKGLAISAKAETPSTDPAETSEIST--------
A0A518K5H4      G-YGY--GSYGQVAYGHEDAAEARPAVRRRLKSMADEDLTSIDG----------------
A0A5C6AA28      A-YGY--GSNGQVAYGGEVAPEPAPSRRRLLKQDLEPELGAVDS----------------
A0A2E7ESJ6      G-YRYGYNSRYGEYSSDAQEQ----------------------------------KAISK
A0A2E9VK20      G--GYDKKSPYQ------------------------------------------------
A0A3D4PJK1      G--GYDKKSPYQ------------------------------------------------
A0A355AI52      G-YGYGYGDEYG----------------------------------------------LD
A0A354PCQ3      Q-YALSGGDIHDDEFSDDNVSLGKGG----------------------------------
A0A0S8GZ23      G-YGYGYGRRRG-------------------------------------------DGNND
A0A1I3DDV4      --YGYGYGYGYG-----------------------------------NRGYGRRVKDNGS
A0A2E0SMM6      G-YGYGYNEDYG---HEDTQAEQGYGDDGYGDDGYVGDGHADDGYRHAPATLEYANYDQQ
A0A3L7SI46      S-YGYGH------------------------------------------------DDRSD
A0A5B9PJZ8      T-YGGGYGSSYGKNYSGNAPTPAA-------------------------------NTPSH
A0A2S8G191      DVYNYTSQRNRKKQLVHVES----------------------------------------
A0A2E7EGG1      GTYGYETASSYS------------------------------------------------
A0A2E2N5A9      DYYQYGSGSPS-------------------------------------------------
A0A7C8AGA2      G-YGYGHASDGGQKRESKSH-----------------------------------KRAET
A0A7C2FXP7      A-AGNNKSHGHT-------------------------------------------QNRRK
A0A2E3GWC6      GGYARQQP----------------------------------------------------
F0SLB0          GGYARQQS----------------------------------------------------
A0A3L7NDH9      G-YGYGYGTPYG-----DEVEEESIDDAFVTDDALADHEDSNVDDGSDPGVEDRVLPMNP
A0A1N6DAJ8      SKYEYSAR----------------------------------------------------
A0A532UD06      G-YGYDSGYDYGGYYDDDISAESRDQDEANVHVHV-------------------------
A0A660URN1      Q-YGYYGYCSYYGHYGYGRDERQRQYA---------------------------------
A0A517ZCB5      G-YGYGEHDNDA-------------------------------------------DEDAQ
A0A225EH48      A-YGYNYV----------------------------------------------------
A0A518INW8      KPYEYGYATQYTRSYASKPNERPVASSSV-------------------------------
A0A518JPH9      KPYEYGYATQYTKSYSSKPQPRPVSSASV-------------------------------
A0A5C5VEK8      G-YGAYGEIAYGHEEDATLS-----------------------------------SRKKR
A0A532UTJ0      G-HGYYRHHGYYTQSAQSREAAVGHKRKLMF------------------------SMEEG
A0A432MFP3      T-YTYRSDRISDPGGGVSGS----------------------------------------
A0A2E2CCW9      D-YDYGSGPGYSDYYIVPPQAQ--------------------------------------
A0A3C0AGX3      D-YDYGSGPGYSDYYIVPPQAQ--------------------------------------
A0A518AAQ5      G-YDYIDSEGYQEYFQGPAQKT--------------------------------------
A0A517QBG9      G-YDYIDSEGYQEYFQNPAQKT--------------------------------------
A0A518FTU3      G-YDYIDSEGYQEYFQNPAQKT--------------------------------------
A0A517WHH5      G-YDYIDSEGYQAYFEKPEPQT--------------------------------------
A0A5A8BGT3      G-YDYIDSQGYQAYFEKPAAQD--------------------------------------
A0A2E7K7A9      G-YDYIDNEGYQAYFEKPAPEP--------------------------------------
A0A517PTS5      G-YDYIDNEGYQAYFEKPAPEP--------------------------------------
A0A6I6AH34      G-YDYIDSEGYQAYFEKPATQT--------------------------------------
A0A517VTK3      K-YRYRGGEGYHDYYLTPQQNN--------------------------------------
A0A517WQT4      K-YRYRGSEGYHDYYLAPQQNN--------------------------------------
A0A517VID8      D-YDYGSGPGYSDYYIVPSQVQ--------------------------------------
A0A517RK10      E-YDYGAGEGYQEYFEAQPKKK--------------------------------------
A0A518IH18      E-YDYGAGEGYQEYFEAQPKKK--------------------------------------
A0A5C5XLF4      G-GGYDKKSPYQ------------------------------------------------
A0A2D5NDU9      G-YGYGGGVQARQPYAFTAAGPEVEVTRQP-------------------------TSGPS
A0A1P8WP26      G-YGYGYE--ENDTHPTDERRQPSHNQADVA------------------------VSLSM
A0A3L7V1F3      G-YGYGYG--YGHENEHEEQPER-----DVA------------------------SGLSA
D5SZ21          G-YGYGHTDTDG--------------------------------------------DHDD
A0A286RGB6      A-YPYHSPIVEGDSQRQEAPERG-------------------------------------
A0A518CHE5      G-YGYSEDYGHEESTGEDGYDEDGYGDGNYQKEPAILGYT---------------SPDSG
A0A1V5N3W2      G-YGYGHK--HNPPDGKQIDMKQ--------------------------------LMLLL
A0A3E0MY27      G-YGYEDG------YGREELSHEVAES---------------------------------
A0A7C4Z5R7      G-HSYQYT----------------------------------------------------
A0A2E0X9P6      T-YAYDYRPRAAADYGSGEAF---------------------------------------
A0A286RLF2      ----------SGDYYGQPDESHE--------------------------------EKEVP
A0A517NSK8      G-YGYGPT--SGGYYRSADA-----------------------------------TAETV
A0A5C5Z0D6      G-YGYGET--HKAYYRESKK-----------------------------------GSRPL
M5UE94          G-YGYGES--HKAYYGE-KS-----------------------------------APFDL
A0A2E8FLY0      E-YDSKED----------------------------------------------------
A0A3D2U1E1      G-FEYGSG----------------------------------------------------
E8R3W3          Y-YSYGYTYYYQ------------------------------------------------
A0A5C5ZM48      Q-YATRYGQPYG-----------------------------------------------D
A0A5B9WF77      ------------------------------------------------------------
A0A518BBX8      G-YAYSYG----------------------------------------------------
A0A1P8WN28      Q-YGYGYGNDYG--YGHD-------------------------------------DEEDD
A0A3B9CTT0      G-YGYGYESQYG--YGHD-------------------------------------EDDDE
A0A518ALT3      V-YAYGR---YASLQGQA------------------------------------------
A0A3M1QRP3      G-YGSAARNVYG------------------------------------------------
A0A517TMV0      G-YGYGYG------YGHDD-----------------------------------------
A0A3E0MY88      G-YGYGYTYSYN--YGGSDEETHHVEEPLPHAESPELAAPGSVSFELDST-----APWPP
A0A5B9QF68      G-YGYGYGSDYGSDYGNDEEAFEEEVSDADEPQESIPDPA---------------TKRSR
A0A5B9QGF0      G-YGYGYG--YG--YGHDEEEFGDE--VADEPLETIPHPS---------------TKMSV
A0A5C6CK24      G-YGYGYG--YG--YGHDEQDFEDV--DADSEELIVPHPA---------------TQVGV
A0A2E3RCU8      G-EGYGYG--YG--YGDDDSGSLDEADGTTLNAEDNYADINF-------------QMRPL
A0A1C3E6N1      G-YGYGYG--YG--YGHTDTD----------------------------------GDHDD
A0A518GJT2      G-YGYGYG--YG--YGHTDTD----------------------------------GDHDD
A0A2E8B0L9      G-YGYGYG--YD--DGYGM-------------------------------------DEED
A0A5Q4GFE7      G-YGYGYG--YR--DGYGQPADEARIDQDRFASGETD------------------WSDEE
A0A257WS34      G-YGYGYG--YG--YGHDDAI----------------------------------EDPAL
A0A7C4LP10      G-YGYGYG--YG--YGHDDAT----------------------------------DPQTG
A0A517MLW3      G-YGYGYG--YG--DELTDEKQAVVMPSQNAVSQSELV-----------------VHTDS
A0A5B9QVD0      G-YGYGYG--YG--DDNQDEKIHLI---------AEPT-----------------ADQPP
A0A3A0DET7      G-YGYGHQ--YG--YGEYAAIEEASAP----------------------------DRGRK
A0A3B8PNV4      E-YG--------------------------------------------------------
A0A3D1DR40      E-YG--------------------------------------------------------
A0A2E7RYU8      E-YG--------------------------------------------------------
A0A3B8LXG8      E-YG--------------------------------------------------------
A0A286RD13      S-YTID------------------------------------------------------
A0A2E3GWX1      G-YGY--G--YG--YGHEDPVQDQPAAWSDFYDA---------------------EPERQ
F0SG60          G-YGY--G--YG--YGHEDPVQDQSAAWSDFYDA---------------------EPERQ
A0A2E9VST2      G-YGYGEG--YG--EGHDDPTHDDE---EEAIPM---------------------TQSNS
A0A356A6X2      G-YGYGEG--YG--EGHDDPTNEVE---EEAIPI---------------------SNNNS
A0A5C5XLM3      G-YGYGEG--YG--EGHDDPAYEGE---EEAIPI---------------------SNNNS
A0A7C5FXU1      H-HYRR----YY--LAPAAVED--------------------------------------
A0A3M1VCL4      G-YGYGYG--YG--YGYAESDD------------------------------------EE
A0A5C5V7Z9      G-YGYGQQ--YG--YGHTEEEE-LAPVAAPPTSP---------------------VDPDP
A0A5C5YT05      G-YGYG----YG--YGHSDEEERVEEKVEHDLSP---------------------VEPAA
A0A518D7F9      G-YGYG----YG--YGHDEPDT--------------------------------------
A0A5C5ZIP0      G-YGYG----YG--YGHTETND--------------------------------------
A0A518KBK3      G-YGYG----YG--YGHEEEEH--------------------------------------
A0A5C6AKF9      G-YGYG----YG--YGVDEADH--------------------------------------
A0A6M5Z0K7      A-PGYGR-----------------------------------------------------
A0A350CI62      G-YGYGYG--YG--YGHDQEPEEQSGSGGHSG------SPEQPVAAGHS------VSAGL
A0A4P5WQK6      G-YGYGYG--YG--YGHDQEPEEQSGSGGHSG------SPEQPVAAGHS------VSAGL
A0A3C1X4W5      G-YGYGYG--YG--YGHDQEPDEQSGAGSQPS----------------------------
A0A3D3W3A7      G-YGYGYG--YG--YGHDQEPDEQSGAGSQPSLSGYGMTSGQSATAGQS------VSAGL
A0A518DRX3      G-YGYGEN--DS--DDDHISPTSTTATSTPQHSPVVRRPDRSTSSQPTSTPTTPTRRRPA
A0A518DZF9      G-YGYGEN--DS--DDDHISPTSTTATSTPQHSPVVRRPDR-TSSQPTSTPTTPTRRRPA
A0A518AKT8      G-YSYHS------------------------------------------------EDEEE
A0A5C5ZR72      A-YGYGF------------------------------------------------PEQEE
A0A7C5R0U3      G-YGYGD------------------------------------------------SRDGD
A0A517TY85      G--AYGA------------------------------------------------HR---
A0A5B9QEI7      G--SYGQ------------------------------------------------HE---
F0SI78          G-SNYNYG--TN--YSYHQRRYRYYYEGTDA-----------------------------
A0A517MDV3      G-YEYG------------------------------------------------------
A0A518IQ30      G-YGYGYG--YG--YGDEE------------------------------------QDDVV
A0A517LWP4      G-YGYGYG--YG--YGDEE------------------------------------QDDTV
A0A518JNW8      G-YGYGYG--YG--YGDEE------------------------------------HDDAV
A0A2E7ENQ5      G-YGQGYG--HG--YHEDANVDDDPTTL---------------------------PIQDP
A0A7C2KUQ9      -------------------------------------------------------LPSPR
A0A7C5BZF0      G-YEYEES--DG--PADEELQQDLADDAVKKEISP-------PTVAAEETAGELGGEDNR
A0A1G3AQE9      G-YGYGYI--YK--YGADADSKDESELAEAAAIGK-------DAAGAQGNGVSRWKEAD-
A0A3L7UQT9      G-YGYGYG--YG--YGYGHDDANAAAE------------------SEHEAG----DEEP-
A0A4P5YBU2      G-YGYGYG--YG--YGYGHDDANAAAE------------------SEHEAG----DEEP-
A0A7C7V5U8      G-YDYQYA---G--QPDGLDETDGPPGGHPSLVAE-------NTLAGHTCG----QPDS-
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      A-----------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      YSYTQSSESRKDTGRK--RKKPRLSVEDGAD-------KTDDPETPRTS-----------
A0A3D3UVZ8      FSYSQSVESRKSVMRKRTRKKPPVSNEDIADADNTDTSETDSENRPTEA-----------
A0A517NFU9      SERASL------------------------------------------------------
A0A5C5YWH4      AERSVG------------------------------------------------------
A0A3D2TNK4      TKSANSTTPLKPRRVA--------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ANGSTVNGSSNGHPTT--------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          GNPNS-------------------------------------------------------
M5TW92          GNPNS-------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      FGNGGRGVNGNGKLG---------------------------------------------
M5UQ35          ADGPVMEEQSVNGHSHENVKSGGLNGVASTEARLSDR-----------------------
A0A0S8FY64      GTVSFVVRGGQDFSFSFELEDGQQTVVGRSSAECDIGLPSASVSPQHCRIANSGGRIVVE
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      VITTRASDIGSRD-----------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          D-----------------------------------------------------------
A0A5M6CY44      S-----------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      K-----------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      E-----------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      TLPGMASQKAALE-----------------------------------------------
A0A5C5WDJ1      IVKN--------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A5B1CIK7      SAAISSDIAGRDG-----------------------------------------------
A0A5C5WHS2      ASSIPTDMN---------------------------------------------------
A0A5C6B6G8      AAKTENESDA--------------------------------------------------
A0A5C5ZZN3      PAEAPVNGKAH-------------------------------------------------
A0A5C5XS91      GGNASANGKAKTK-----------------------------------------------
A0A5C6C4E6      SGKAKTNGKVKSK-----------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      RDRLISGKR---------------------------------------------------
A0A518HKC1      SDRLITGKR---------------------------------------------------
A0A518L3P0      SDRLITGKR---------------------------------------------------
A0A255R1S0      AHPVTLDRK---------------------------------------------------
A0A5B9MKP1      SDRLISGKR---------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      YYDDESSQTLQHESPYQS------------------------------------------
A0A2E9VK20      QTNDIPEFLAPTQAVIPS------------------------------------------
A0A3D4PJK1      QTNDIPEFLAPTQAVIPS------------------------------------------
A0A355AI52      DDGEYGDEEEEENYMRAA------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      KRKRPKPKTLLISGPGSK------------------------------------------
A0A1I3DDV4      AETENGHSLAGSTPAGRK------------------------------------------
A0A2E0SMM6      YESGYEDDDYEANPYHAA------------------------------------------
A0A3L7SI46      TTTEATDDEYEVKTPMAA------------------------------------------
A0A5B9PJZ8      QPPIPNLVDAKSSSKSRN------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      -----------ADQEEVT------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      LLLTSEPRDETGDESGSS------------------------------------------
A0A7C2FXP7      MLLLTAKVAKINAAAVKV------------------------------------------
A0A2E3GWC6      -----AKPTTPPPILTKQ------------------------------------------
F0SLB0          -----AKPTTPPPILTKQ------------------------------------------
A0A3L7NDH9      RSGTSSRSRGASNPRAVA------------------------------------------
A0A1N6DAJ8      -------------TRESV------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      TLPAGPKFVSPEQLRKSA------------------------------------------
A0A225EH48      -------------KQLPA------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      LIKSRPAPAESATVVEQT------------------------------------------
A0A532UTJ0      ADDGKDSETPDGGVTTDV------------------------------------------
A0A432MFP3      ------------------------------------------------------------
A0A2E2CCW9      ----AKQADVPAKTKITH------------------------------------------
A0A3C0AGX3      ----AKQADVPAKTKITH------------------------------------------
A0A518AAQ5      ----ASPVAKPARTEVTS------------------------------------------
A0A517QBG9      ----ETPVEKPARTEVTS------------------------------------------
A0A518FTU3      ----ATPVEKPARTEVTS------------------------------------------
A0A517WHH5      ----TKPAANPAKTEVTS------------------------------------------
A0A5A8BGT3      ----KKSAVNPVKTEVTS------------------------------------------
A0A2E7K7A9      ----AKPAANPAKTEVTS------------------------------------------
A0A517PTS5      ----AKPAANPAKTEVTS------------------------------------------
A0A6I6AH34      ----SKPAANPAKTEVTS------------------------------------------
A0A517VTK3      ----SPEPTVSVHTEVPG------------------------------------------
A0A517WQT4      ----SPEPTVSVHTEVPG------------------------------------------
A0A517VID8      ----AKQADATAKTKITQ------------------------------------------
A0A517RK10      ----IRQPAVPVNSDITG------------------------------------------
A0A518IH18      ----TTQPVVPANTEITS------------------------------------------
A0A5C5XLF4      QTNDMPEFLAPTQAVIPS------------------------------------------
A0A2D5NDU9      RDSSAADDGHADERPSAD------------------------------------------
A0A1P8WP26      IGSGPEPEDS--ADKKAA------------------------------------------
A0A3L7V1F3      LASGKSREADLRERNRAA------------------------------------------
D5SZ21          LLDDHASSHSSYSSRTAA------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A518CHE5      QDAGYEDDDYETNPYQAA------------------------------------------
A0A1V5N3W2      RPDEKKKDTSPSEESSKN------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7C4Z5R7      -------------ASAAN------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A286RLF2      EITESISTPERTVPRRVA------------------------------------------
A0A517NSK8      KVSSRDAEEAPVAAGSRV------------------------------------------
A0A5C5Z0D6      QSTSS-------------------------------------------------------
M5UE94          QSVS--------------------------------------------------------
A0A2E8FLY0      -------EE----LKQAA------------------------------------------
A0A3D2U1E1      -------EESSDGLKQAA------------------------------------------
E8R3W3          --------HQRASEDGAA------------------------------------------
A0A5C5ZM48      EGAEPVGAESYAANETSV------------------------------------------
A0A5B9WF77      ----SRQRATQTPSADAV------------------------------------------
A0A518BBX8      NEKYLDESPLSSDSQDAT------------------------------------------
A0A1P8WN28      LDSVDFPPPPSSDLGKVA------------------------------------------
A0A3B9CTT0      YDQM-------TDGELAA------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A3M1QRP3      -----PATDNDPLDVRVI------------------------------------------
A0A517TMV0      ------TAEALEEKPLAA------------------------------------------
A0A3E0MY88      QTQQQVVHDGTTVPRKVA------------------------------------------
A0A5B9QF68      TPRRKQGPTEPIRPRRAA------------------------------------------
A0A5B9QGF0      TPRRKTSPTDPIRPRRAA------------------------------------------
A0A5C6CK24      SLRRKETSTDPIRPRRAA------------------------------------------
A0A2E3RCU8      DQKVSEIENASIHFRKSA------------------------------------------
A0A1C3E6N1      LLDDHASSHSSYSSRTAA------------------------------------------
A0A518GJT2      LLDDHASSHSSSSSRTAA------------------------------------------
A0A2E8B0L9      EDDIQTSASDSIQPRRAA------------------------------------------
A0A5Q4GFE7      DSDVPPGAP---HPRNAA------------------------------------------
A0A257WS34      AAMEDDDGYRIAA-----------------------------------------------
A0A7C4LP10      GDDGGDDAHELQPVRRAA------------------------------------------
A0A517MLW3      AAPKTAPVRRSTPRRRAA------------------------------------------
A0A5B9QVD0      AAPQAP--RRAAPRRRVA------------------------------------------
A0A3A0DET7      KSRALVKAATEPAITSQE------------------------------------------
A0A3B8PNV4      ----GEDEPASSPHRLAA------------------------------------------
A0A3D1DR40      ----GEDEPASSPHRLAA------------------------------------------
A0A2E7RYU8      ----GEDEPASSPHRLAA------------------------------------------
A0A3B8LXG8      ----GEDEPASSPHRLAA------------------------------------------
A0A286RD13      -----------VESRAAE------------------------------------------
A0A2E3GWX1      KKERKRFSRKAA------------------------------------------------
F0SG60          KKERKRFSRKAA------------------------------------------------
A0A2E9VST2      HRPRKRFSRDESSDRYAA------------------------------------------
A0A356A6X2      QRPRKRFSRDQSSDRYAA------------------------------------------
A0A5C5XLM3      QRPRKRFSRDQSSDRYAA------------------------------------------
A0A7C5FXU1      -------------KETK-------------------------------------------
A0A3M1VCL4      HDGKRRSGRGKRAKKAA-------------------------------------------
A0A5C5V7Z9      RDWRRLGGDDADPARAA-------------------------------------------
A0A5C5YT05      ASWRRPTEGPADADRAA-------------------------------------------
A0A518D7F9      -----EDDTPIAPLRAA-------------------------------------------
A0A5C5ZIP0      -----EILENNAPGKAA-------------------------------------------
A0A518KBK3      -----VSHADENRPMAA-------------------------------------------
A0A5C6AKF9      -----DEPNDRSLPVAA-------------------------------------------
A0A6M5Z0K7      ---SIVPVATVVETGQPL------------------------------------------
A0A350CI62      YSISVGGSRSSGDSSRAA------------------------------------------
A0A4P5WQK6      YSISVGGSRSSGDSSRAA------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      YSISVGGSRGSGDSSRAA------------------------------------------
A0A518DRX3      ATQSDDHQPQVTRRRAA-------------------------------------------
A0A518DZF9      ATQSDNHQPQVTRRRRAA------------------------------------------
A0A518AKT8      PLPGEASLPHDDDSRRAA------------------------------------------
A0A5C5ZR72      RPEGLVGVPGGV------------------------------------------------
A0A7C5R0U3      GDDASATLPLRGSRAA--------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      --GQRKVNAYFRAPQSNG------------------------------------------
A0A518IQ30      ESLPLQQAPTQAPHRKVA------------------------------------------
A0A517LWP4      DALPMQQAPTQPPHRKAA------------------------------------------
A0A518JNW8      EALPMEQTPTQSPHRKAA------------------------------------------
A0A2E7ENQ5      QVFQRPADDASEPRRRAA------------------------------------------
A0A7C2KUQ9      PANSADSALETPSLPASQ------------------------------------------
A0A7C5BZF0      EFGGEIVPSNLRKVRRVA------------------------------------------
A0A1G3AQE9      ------PPPGLVP-RRVA------------------------------------------
A0A3L7UQT9      ------ASDEVQPLRRAA------------------------------------------
A0A4P5YBU2      ------ASDEVQPLRRAA------------------------------------------
A0A7C7V5U8      ------SPPGIVPQRRVG------------------------------------------
                                                                            

A0A5S9IPR9      --------------------------------------------
A0A533Q9U4      --------------------------------------------
A0A1U9NNE1      --------------------------------------------
A0A2G2JCA2      --------------------------------------------
A0A533Q6B7      --------------------------------------------
A0A5S9IJB5      --------------------------------------------
A0A1G2XVR0      --------------------------------------------
A0A1G3B0P0      --------------------------------------------
A0A1E3X4X0      --------------------------------------------
A0A286U4B3      --------------------------------------------
A0A5C6DDS2      --------------------------------------------
A0A2E3GW02      --------------------------------------------
A0A5B9QNZ7      --------------------------------------------
A0A1Z8N7H5      --------------------------------------------
A0A1G2YPI3      --------------------------------------------
A0A1U7CZ81      --------------------------------------------
A0A142YNY8      --------------------------------------------
A0A1U7GLS6      --------------------------------------------
A0A532UIN2      --------------------------------------------
A0A0S8KNX5      --------------------------------------------
A0A3D3UVZ8      --------------------------------------------
A0A517NFU9      --------------------------------------------
A0A5C5YWH4      --------------------------------------------
A0A3D2TNK4      --------------------------------------------
A0A7C1Y4F0      --------------------------------------------
A0A6I0ENW6      --------------------------------------------
A0A6L3A0B7      --------------------------------------------
A0A0J1B4A0      --------------------------------------------
A0A142WSB9      --------------------------------------------
M5SZR3          --------------------------------------------
M5TW92          --------------------------------------------
A0A2S8FKY2      --------------------------------------------
A0A517N8P6      --------------------------------------------
A0A432MJP4      --------------------------------------------
M5UQ35          --------------------------------------------
A0A0S8FY64      DLGSANGTFVGYRRVRRATVGPGDVIRISPYTISVEGPTGNRAG
A0A1N6KFT7      --------------------------------------------
L0DFG4          --------------------------------------------
A0A5C5XXG1      --------------------------------------------
A0A7C7YUM8      --------------------------------------------
A0A7C2AHI6      --------------------------------------------
A0A518BJJ1      --------------------------------------------
A0A518D182      --------------------------------------------
A0A5C5WTY6      --------------------------------------------
A0A5C5Y033      --------------------------------------------
A0A5C6G1Y2      --------------------------------------------
A0A354PDV6      --------------------------------------------
A0A5C6FZ02      --------------------------------------------
M5TIT3          --------------------------------------------
A0A5M6CY44      --------------------------------------------
F2AXG2          --------------------------------------------
M2BB46          --------------------------------------------
L7CLQ6          --------------------------------------------
A0A0J1B719      --------------------------------------------
Q7UF18          --------------------------------------------
A0A2G1W1E0      --------------------------------------------
K5E235          --------------------------------------------
A0A5C6FFI9      --------------------------------------------
A0A5C5WDJ1      --------------------------------------------
A0A5C5X547      --------------------------------------------
A0A353FIP5      --------------------------------------------
A0A5B1CIK7      --------------------------------------------
A0A5C5WHS2      --------------------------------------------
A0A5C6B6G8      --------------------------------------------
A0A5C5ZZN3      --------------------------------------------
A0A5C5XS91      --------------------------------------------
A0A5C6C4E6      --------------------------------------------
A0A2E1VVJ1      --------------------------------------------
A0A3M2AEL0      --------------------------------------------
A0A2A2W9R6      --------------------------------------------
A0A518HKC1      --------------------------------------------
A0A518L3P0      --------------------------------------------
A0A255R1S0      --------------------------------------------
A0A5B9MKP1      --------------------------------------------
A0A0S8J591      --------------------------------------------
A0A351FYP6      --------------------------------------------
A0A532UT69      --------------------------------------------
A0A2D5AWU0      --------------------------------------------
A0A1G2YQB7      --------------------------------------------
A0A353P687      --------------------------------------------
A0A356EME5      --------------------------------------------
M5RT57          --------------------------------------------
A0A356KTN1      --------------------------------------------
A0A518HFS8      --------------------------------------------
L0DC26          --------------------------------------------
A0A3L7P4E4      --------------------------------------------
A0A3L7PEB5      --------------------------------------------
A0A1U9NL64      --------------------------------------------
A0A2N1UCJ3      --------------------------------------------
A0A7C4EK84      --------------------------------------------
A0A7C3F0T2      --------------------------------------------
A0A2E0X4J3      --------------------------------------------
A0A5C5YU10      --------------------------------------------
A0A517MPZ6      --------------------------------------------
A0A5C6CNV7      --------------------------------------------
A0A518K5H4      --------------------------------------------
A0A5C6AA28      --------------------------------------------
A0A2E7ESJ6      --------------------------------------------
A0A2E9VK20      --------------------------------------------
A0A3D4PJK1      --------------------------------------------
A0A355AI52      --------------------------------------------
A0A354PCQ3      --------------------------------------------
A0A0S8GZ23      --------------------------------------------
A0A1I3DDV4      --------------------------------------------
A0A2E0SMM6      --------------------------------------------
A0A3L7SI46      --------------------------------------------
A0A5B9PJZ8      --------------------------------------------
A0A2S8G191      --------------------------------------------
A0A2E7EGG1      --------------------------------------------
A0A2E2N5A9      --------------------------------------------
A0A7C8AGA2      --------------------------------------------
A0A7C2FXP7      --------------------------------------------
A0A2E3GWC6      --------------------------------------------
F0SLB0          --------------------------------------------
A0A3L7NDH9      --------------------------------------------
A0A1N6DAJ8      --------------------------------------------
A0A532UD06      --------------------------------------------
A0A660URN1      --------------------------------------------
A0A517ZCB5      --------------------------------------------
A0A225EH48      --------------------------------------------
A0A518INW8      --------------------------------------------
A0A518JPH9      --------------------------------------------
A0A5C5VEK8      --------------------------------------------
A0A532UTJ0      --------------------------------------------
A0A432MFP3      --------------------------------------------
A0A2E2CCW9      --------------------------------------------
A0A3C0AGX3      --------------------------------------------
A0A518AAQ5      --------------------------------------------
A0A517QBG9      --------------------------------------------
A0A518FTU3      --------------------------------------------
A0A517WHH5      --------------------------------------------
A0A5A8BGT3      --------------------------------------------
A0A2E7K7A9      --------------------------------------------
A0A517PTS5      --------------------------------------------
A0A6I6AH34      --------------------------------------------
A0A517VTK3      --------------------------------------------
A0A517WQT4      --------------------------------------------
A0A517VID8      --------------------------------------------
A0A517RK10      --------------------------------------------
A0A518IH18      --------------------------------------------
A0A5C5XLF4      --------------------------------------------
A0A2D5NDU9      --------------------------------------------
A0A1P8WP26      --------------------------------------------
A0A3L7V1F3      --------------------------------------------
D5SZ21          --------------------------------------------
A0A286RGB6      --------------------------------------------
A0A518CHE5      --------------------------------------------
A0A1V5N3W2      --------------------------------------------
A0A3E0MY27      --------------------------------------------
A0A7C4Z5R7      --------------------------------------------
A0A2E0X9P6      --------------------------------------------
A0A286RLF2      --------------------------------------------
A0A517NSK8      --------------------------------------------
A0A5C5Z0D6      --------------------------------------------
M5UE94          --------------------------------------------
A0A2E8FLY0      --------------------------------------------
A0A3D2U1E1      --------------------------------------------
E8R3W3          --------------------------------------------
A0A5C5ZM48      --------------------------------------------
A0A5B9WF77      --------------------------------------------
A0A518BBX8      --------------------------------------------
A0A1P8WN28      --------------------------------------------
A0A3B9CTT0      --------------------------------------------
A0A518ALT3      --------------------------------------------
A0A3M1QRP3      --------------------------------------------
A0A517TMV0      --------------------------------------------
A0A3E0MY88      --------------------------------------------
A0A5B9QF68      --------------------------------------------
A0A5B9QGF0      --------------------------------------------
A0A5C6CK24      --------------------------------------------
A0A2E3RCU8      --------------------------------------------
A0A1C3E6N1      --------------------------------------------
A0A518GJT2      --------------------------------------------
A0A2E8B0L9      --------------------------------------------
A0A5Q4GFE7      --------------------------------------------
A0A257WS34      --------------------------------------------
A0A7C4LP10      --------------------------------------------
A0A517MLW3      --------------------------------------------
A0A5B9QVD0      --------------------------------------------
A0A3A0DET7      --------------------------------------------
A0A3B8PNV4      --------------------------------------------
A0A3D1DR40      --------------------------------------------
A0A2E7RYU8      --------------------------------------------
A0A3B8LXG8      --------------------------------------------
A0A286RD13      --------------------------------------------
A0A2E3GWX1      --------------------------------------------
F0SG60          --------------------------------------------
A0A2E9VST2      --------------------------------------------
A0A356A6X2      --------------------------------------------
A0A5C5XLM3      --------------------------------------------
A0A7C5FXU1      --------------------------------------------
A0A3M1VCL4      --------------------------------------------
A0A5C5V7Z9      --------------------------------------------
A0A5C5YT05      --------------------------------------------
A0A518D7F9      --------------------------------------------
A0A5C5ZIP0      --------------------------------------------
A0A518KBK3      --------------------------------------------
A0A5C6AKF9      --------------------------------------------
A0A6M5Z0K7      --------------------------------------------
A0A350CI62      --------------------------------------------
A0A4P5WQK6      --------------------------------------------
A0A3C1X4W5      --------------------------------------------
A0A3D3W3A7      --------------------------------------------
A0A518DRX3      --------------------------------------------
A0A518DZF9      --------------------------------------------
A0A518AKT8      --------------------------------------------
A0A5C5ZR72      --------------------------------------------
A0A7C5R0U3      --------------------------------------------
A0A517TY85      --------------------------------------------
A0A5B9QEI7      --------------------------------------------
F0SI78          --------------------------------------------
A0A517MDV3      --------------------------------------------
A0A518IQ30      --------------------------------------------
A0A517LWP4      --------------------------------------------
A0A518JNW8      --------------------------------------------
A0A2E7ENQ5      --------------------------------------------
A0A7C2KUQ9      --------------------------------------------
A0A7C5BZF0      --------------------------------------------
A0A1G3AQE9      --------------------------------------------
A0A3L7UQT9      --------------------------------------------
A0A4P5YBU2      --------------------------------------------
A0A7C7V5U8      --------------------------------------------
                                                            

© 1998-2021Legal notice