BYKdb

Dataset for cluster tadcd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

253 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------MPGQTVGPVSIKREYRCSPQDRPDIPPIFTGFTYSQALPCFT
A0A1Z8N7H5      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      MPLYIDSQPTARLSVLSSILQALQRAQIPRMLCVSFLSRMTLSPWNIRREPVRRYFGTGY
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------MRRRGRGSQVFKKVGARNEPTGQE
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A7V4HWU2      ------------------------------------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A7V7MJI7      ------------------------------------------------------------
A0A5B1CIK7      ------------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      ------------------------------------------------------------
A0A5C5ZZN3      ------------------------------------------------------------
A0A5C5XS91      ------------------------------------------------------------
A0A5C6C4E6      ------------------------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A7V9G2R2      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A7X7U1J4      ------------------------------------------------------------
A0A7V8E5N8      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A7Y5LV28      ------------------------------------------------------------
A0A7Y5HFQ5      ------------------------------------------------------------
A0A7W1FMQ9      ------------------------------------------------------------
A0A7W1NA62      ------------------------------------------------------------
A0A7V9JTP9      ------------------------------------------------------------
A0A7W1FJ38      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      --------------------------------------------------MSRRPDLSHS
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7V2H881      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A7X7U4K9      ---------------------------------------------------------MDE
A0A2E0X4J3      ------------------------------------------------------------
A0A838QZ11      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A7V2UF66      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ----------------------------------------MSSDFVEIQDSRLGGLSDLA
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A2E3GWC6      -----------------------------------------------------MPADASR
F0SLB0          -----------------------------------------------------MPADAGR
A0A3L7NDH9      ------------------------------------------------------------
A0A7X8IIB9      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A7W0M4Y4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
A0A7W5H7D9      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A3E0MY27      --------------------------------------------MSNPIDPKKPSERPLD
A0A7V4M591      ------------------------------------------------------------
A0A7X7F3G7      ------------------------------------------------------------
A0A7Y4VQ32      --------------------------------------------------MQRDEGIISN
A0A2E0X9P6      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ----------------------------------------------------MNPTDPVS
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      --------------------------------------------------------MNTP
A0A7C4Z5R7      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ---------------------------------------------------MSESHPNSK
A0A286RGB6      ------------------------------------------------------------
A0A7V3TZQ6      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A847YFA1      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      --------------------------------MSAVRTLSRLTECRGNGRVLCGALFRLF
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A6M5Z0K7      -------------------------------------------------------MSLAL
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A7Y5SKC2      ------------------------------------------------------------
A0A7X7U104      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7V2UW16      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7V2XSV8      ------------------------------------------------------------
A0A847GXG1      ------------------------------------------------------------
A0A7C5BZF0      ------------------------------------------------------------
A0A847YGH5      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A7V3TX18      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      ------------------------------------------------------------
A0A7Y5SJZ4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A7C2KUQ9      ------------------------------------------------------MSLMAE
A0A7C5R0U3      ------------------------------------------------------------
A0A847YCQ7      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A7V3TUJ6      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      ---------------------MNKSEMNLPAFATSNPMLSSVTEEFRPEVDSEMSLLSYW
A0A533Q9U4      ------------------------------------------MLPFKGDESEEIHILDYV
A0A533Q6B7      ------------------MIPVDQRKPQSHTNRRENTEVHLL---------------DYL
A0A1U9NNE1      --------------------------MNQIDKYYESYLGSYAQEGTKQESENTLTLFKII
A0A2G2JCA2      -------------------------------MNMITNSTPNYRPAKPPAEKKPFISPQLV
A0A1G2XVR0      ---------------------------MLTESEIQP---------------KQLDIRKYL
A0A1G3B0P0      ---------------------------MLTESEIQP---------------KQLDIRKYL
A0A1E3X4X0      ---------------------------MLNNK-------------------EQTHLTDYI
A0A286U4B3      ---------------------------MNNDSFLNQTQDPSNYYSGKTSSLDEIHLRDYF
A0A5C6DDS2      ---------------------------MKNDSYQNQTED--SFYNGETAFLEEINLRDYF
A0A5S9IJB5      ------------------------------------------------MDKQEFNIHQYI
A0A2E3GW02      ----MKIRLSPEGEFSNVTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPPSSESGFDIR
A0A5B9QNZ7      DYFSGLNETDRGPVTTGTIVPPPAVDSPPPGRFPWQSYANESIPMSHEPTTSPEPVLDLW
A0A1Z8N7H5      ------MHLIDLLILGLALRRESRVSNEEGSLMSVETDNETYDAPLTNAAGAIHDGFQFL
A0A1U7CZ81      -----MDTTDSNDSLLPARLPSSSSSHLPAMSAAN--RHAYDL--TTVSSSVQISPQGVL
A0A142YNY8      -----MDTSDRHDSTLPAR-SHTPSSGVPARAATNFGGGSREL--AVGASTMQVNPTSIL
A0A1U7GLS6      -----MDTSDRPDSMLPAR-PTPPAPPVPSRGPASFGGGPRDLVPTSAAPALQVDPVSIL
A0A1G2YPI3      ------------METNNEFGQTEIVGHNMIDQQENNGHAGLANSHVGMPLPTQMMSESLV
A0A532UIN2      SDSISALIYAPKTFSEMTDQNRRRTRGSDVISQYENNRTFARDALQGGPRSAGITSESLV
A0A0S8KNX5      --------------------------MSDLEKYHDQVVGQQVVNFQIPPEPGRVGTSNLL
A0A3D3UVZ8      --------------------------MNELEKYHSQATGQEIVNLQIPPEQESEATSDLV
A0A517NFU9      ------------------------------MESSVSESASK----------ATVIEINLL
A0A5C5YWH4      ------------------------------MDSPTTESASK----------APVIEINLL
A0A3D2TNK4      --------------------MTDLNTSADIQSNFEASAESE----------LVPTIMRLL
A0A7C1Y4F0      ---------------------------------MDNGTIGNGSANTVLSEPDGPPQESLL
A0A6I0ENW6      --MFEINEDAPEGGQDRGSALIPAGGGVSTLARGGESGGYGLASYGPASGPAPHRGFSLR
A0A6L3A0B7      VNMFEINEDAPEGGQDRGSALIPAGGGVSTLARGGESGGYGLASYGPASGPAPHRGFSLR
A0A0J1B4A0      --------------MLFADQSIEFLKIMIRSNPSADDVNGD----------ELDIDLDLL
A0A142WSB9      --------------------------MTQPNPASANGNELAFAPPGLQASSLPGRSIDLV
M5SZR3          ---------------------------MNSNRKLVSRNANS----------QDEQLLDLK
M5TW92          ---------------------------MNSNRKLVSRNANS----------QDEQLLDLK
A0A2S8FKY2      ------------------MSNGNLVISSEKDRRRQGTNVPGTVVANRPQEEDGMQFGQVL
A0A517N8P6      -------------------------------MQPASHTQTSRSDIGMAPPMSGPSDVSVG
A0A432MJP4      ---------------------MRLPDPQGSEADSTMSDRPLASDTNPSAHLGAAELKHLI
M5UQ35          ------------------------------MTNQEDDIDGD----------DFELDLDVL
A0A0S8FY64      -------------------------------------MEDTLAAEAYPDEVREFDIRHHF
A0A1N6KFT7      --------------------------------MAIQQSITGPGSEGPPSRTLQNDLVALW
L0DFG4          --------------------------------MANQQSITGSVSEGYPSRTLQNDLIALW
A0A5C5XXG1      --------------------MRLVVDVVGVDDSSESPAVAESRIPPAIDTPSSEGVVESA
A0A7C7YUM8      --------------------MTASTTTEVHAESRHGYGQSPSNGAAGMFADPTVRIGELL
A0A7C2AHI6      -------------------------------MSEHGYGGHGPEEP----REESLRLGDLL
A0A518BJJ1      ---------------------------------MFRHDQNTAGGV----RDAVPELRAIL
A0A518D182      --------------------------------MPLTHEGTDRNGS----PDPAAGLRHVL
A0A7V4HWU2      ----------------------MEPRMEQRVDWAVPEGPEG----------AAGGGVNPL
A0A5C5WTY6      MNSSNGPSSKGMTSRLSKVEAAKAHYADESPATAPQSRRGASYYGYGYEQPKWGETINPL
A0A5C5Y033      --------------------MTGSTSVTQHQPNGRGGSTGSPRSGLGLPLRNSVEAINLP
A0A5C6G1Y2      --------------------MTGSTSVTQHQPNRRGGSTGSPRSGLGLPLRNSVEAINLP
A0A354PDV6      ------------------------MNREITSTGTDRQFNLN----------DQELSIDIL
A0A5C6FZ02      ----------------------MTENNAKPSAPAKSESRVT----------EDVVTLDVL
M5TIT3          ---------------------------------------ME----------ELSDSIDVL
A0A5M6CY44      --------------------MRQLPMPAAKSSSTRPRRPVA----------PEPDSLDLL
F2AXG2          --------------------MAESAKPTNRLPSRSPSNSTS----------DGEETLDVL
M2BB46          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDVL
L7CLQ6          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDVL
A0A0J1B719      --------------------MAESAKPTNRLPARGPSSASS----------DGEETLDVL
Q7UF18          --------------------MAESAKPTNRLPSRSPSSSTS----------DGEETLDVL
A0A2G1W1E0      --------------------MAESAKPTNRLPARGPSSSTS----------DGEETLDVL
K5E235          --------------------MAESAKPTNRLPARGPSSSTS----------DGEETLDVL
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      --------------------------------MTESTKSFS----------FASGEIDPL
A0A5C5X547      --MSTDVGKPLAANGRSSRGLNNPQAPYLVQNTVSTAPAEE----------GSGIQLSAI
A0A353FIP5      -------------------------------MPIPTSNAPE----------PKVDFNEAI
A0A7V7MJI7      --------------------MAVPGKYPTEAVPRQSLESPM----------AELSIQEFI
A0A5B1CIK7      --------------------MANTNEISASRVRQNARPSVE----------EEQDSLDVF
A0A5C5WHS2      --------------------MATSTENTSLRTQLSNRLSSD----------EDNDGLEIF
A0A5C6B6G8      ------------------MAPTNSQNPNNN-PRRRSAKTTS----------ENADSLDVL
A0A5C5ZZN3      ------------------MNKAENVEPVNRIARRPASSAME----------DPSETLDVL
A0A5C5XS91      ------------------MIMAEPNEPKNRIQALTRPKSDD----------DQADSLDVL
A0A5C6C4E6      ------------------MIMAEPNEPKNRIQSLTRPKPDD----------DQADSLDVL
A0A2E1VVJ1      -----------------------MSTVSGSPPTGPDANTGA----------KQIDVLELL
A0A3M2AEL0      -----------------------MDTFAAPPPEHDDQ---A----------VTLSLPRLL
A0A2A2W9R6      ----------------------------MKRYQDETLEADD----------AAELSIDLL
A0A518HKC1      ----------------------------MKRYQDEALDADD----------GAELNIDLL
A0A518L3P0      ----------------------------MKRYQDEALDADD----------GPELNIDLL
A0A255R1S0      ----------------------------MSSHSDEA--QSD----------GMEFDIDVV
A0A5B9MKP1      ----------------------------MKRYEDEAFEADD----------GAELNIDLL
A0A351FYP6      -------------------------MEPTSRKENSSDKLHIL---------------DYW
A0A0S8J591      -----------------------------MAVKRPERKMHLT---------------DYL
A0A532UT69      --------MTSDMTDKNTDLKMVGVARSIANTPPTSGFMPES----------------LI
A0A7V9G2R2      ---------------MSDTPPGTTGSHPFTVRDGRDSRDGRDSSSRSDGDRPNLLIGDLV
A0A2D5AWU0      -------------MSEIRIPQIEQSSSGGGESVDAGR---------------------LF
L0DC26          -------------MMLNSNPGPGADSVNLPAVVPPHRAEVLSVTPAHFESSASLDPITLL
M5RT57          ------------------------------------MGPRYL----------------IH
D5SZ21          ------------------------------------MQTLMR----------------FW
A0A7X7U1J4      -------------METAIDRTSSHPAEGLPVIQSL-ESLSGS----------------MF
A0A7V8E5N8      -----------------MRPANPDSDSSEASPAQAESASLVR----------------VL
A0A356KTN1      -------------MQAPQTGLESDFGRSPTISDPLDAEDLRE----------------TL
A0A7Y5LV28      -------------------------MPAPASQGPS-A---QQ----------------LL
A0A7Y5HFQ5      --------------MNGNEKGGIAPGAGAAPPEPE-SGDLRD----------------VL
A0A7W1FMQ9      ---------------------------MPASPLPL-S--LGE----------------LI
A0A7W1NA62      ---------------------MSTAPASTPTAKPL-T--FQE----------------LA
A0A7V9JTP9      --------------MANILGPGAQPAPQAPAAAPL-T--LGD----------------LL
A0A7W1FJ38      ----------------------MSDSPHASDSHPL-T--LTD----------------LL
A0A1G2YQB7      ----------MNSLTKFTENQIIMQKSNMIEPDNESETA--N----------------LI
A0A353P687      ----------MNTLTKYSDNHNLAQSGGMVYPTNEDGDPALN----------------IL
A0A356EME5      SLTERSAERAGPPAVSTSGMRPLNAPGVRKRTAGSSQEMSPR----------------FL
A0A3L7P4E4      ----------------------MSEFVPPSNPNVEPEEAGFD----------------LW
A0A3L7PEB5      ----------------------MSEFV-TNSPNAEAEEAGFD----------------FW
A0A1U9NL64      -----------MNESFKTPQVNSSHEEANGDFEGREEGFQRS----------------LF
A0A2N1UCJ3      -----------------MTDKKTNIENEAGSVEQMMSGTHRT----------------FA
A0A7V2H881      ---------MSDTPRPVADAATPPAGDLAATAFGAVQDLRNN----------------PV
A0A7C4EK84      -------------MSSQTERHRRPETVPLQPRDGQEDSAHQN----------------LL
A0A7C3F0T2      -------MGEPANAGSAIGRFEGPLPVQGISADHGRPS--------------------LL
A0A7X7U4K9      QRIEFLRQASMGSRAITRGTASDRAPRRSVSSLAGSLSGPDD----------------LL
A0A2E0X4J3      ---------MSPNSLVETDPFA--PPVESRPGPPSAAGSEVN----------------LL
A0A838QZ11      -----------MSSLVETDPFAFDEPAHGLRAAQPAHGREVN----------------LL
A0A5C5YU10      ----------MNPLVTTPHGALDSEPIGQMQSSAAAPPQSTD----------------LL
A0A517MPZ6      ----------MSSLVEYEDDYSLDADPQPNAGKGDDSALQTN----------------LL
A0A5C6CNV7      ----------MSSLIEYDSNTQL--EPSGMAHDHAAGAGQTN----------------LL
A0A518K5H4      ---MASSPANPYAPTPVAMSHVSPLATAAMSVDQEDDSDGVN----------------VL
A0A5C6AA28      MALPPSAPASTYAMTPSSAS----LPAPGMIIDQDEDAGGVN----------------VA
A0A2E7ESJ6      --------MRHQTELHQPNQSSTDSPAHWGATSMDTVSSQGV---------------DVG
A0A2E9VK20      --------------MKPSSDKNSRNVDTVHGHPLVKADEPAI---------------DLV
A0A3D4PJK1      --------------MKPSSDKNSRNVDTVHGHPLVKADEPAI---------------DLV
A0A355AI52      ----------------------MLDHEKQELDSTAQSMRQAV---------------RFL
A0A354PCQ3      -----------------------------MPSSSAAQFDPWI---------------LWV
A0A0S8GZ23      -----------MDKLEKYQPQEITPNIDYLEADSAPKDSSIL---------------HLF
A0A1I3DDV4      ----------MSDMPQKPDSQMPVKPMMDTRPMLDPNATGSF---------------DVV
A0A7V2UF66      ----------MEESLLPDRVPVQAPAAVPAAGYPTPVAQPELPQG------------SLL
A0A2E0SMM6      -------------MNPYLDQSSTNEKSGGHDNSTSAMMARVM---------------RFL
A0A3L7SI46      DDKVSAKLHFISHWLFRMNTNERLTSDLDSTANGPNLLGEAV---------------RFL
A0A5B9PJZ8      ----------MSGLRPVQNNNNNYGIPQPQGSGSMPSSGGGL---------SELYNFDVF
A0A2S8G191      --------MSLNNANLPQESSKRDIRVDAPVELVTGHANDFLSNNDVESEELGGGGIGVS
A0A2E7EGG1      -------------------MSASTKRRRIENLTQFEHDFSLR---------------MFT
A0A2E2N5A9      ---------------MTSKPPSIEHHLTAVPHGPAEAELDLR---------------KLW
A0A7C8AGA2      -----------MDELQKYQSQPLSQEVVQFEGPVEEQSDSTM---------------NIV
A0A7C2FXP7      ----------MNDQRRFDAVNQRQYLASFERPAVDHANQNTS---------------VMV
A0A1P8WP26      ---------------MTTSQRQVNTVGAGGQDALAMTLHAIA---------------RFL
A0A3L7V1F3      ---------------MSGPENQILGMQEQGQNTAASTLHLMF---------------RFL
A0A2E3GWC6      SGFERNIAMRQNETMNQPTVESKNNPAPFPSHQMMQTPEPTV---------------DLV
F0SLB0          SGFERHIAMRQNETMNQPTVESKNNPAPFPSHQIMQTPEPTV---------------DLV
A0A3L7NDH9      ---------------MQENMSYSGSADGPHVDAMAQIVQNSM---------------RFL
A0A7X8IIB9      ---------MQDLEKYPVPPVQGEVIDYVDAAEDSQSSEDLA---------------QLI
A0A532UD06      ---------------MDHEALANGSQDLMSEQGHSQPQEGLF---------------QIA
A0A660URN1      --MRTDNISNPGAQMDKDSPVDNGAYNIAPAAGADHLQSSLL---------------QIA
A0A517ZCB5      ----------------MNKLVLEGAGDATGRGESLDFVRGVV---------------RFG
A0A225EH48      ---------MQRSSASEAQMPIPLTPAQPSGQQYASGFQPSVPGQTLAPTAAARAWPTLP
A0A518INW8      -------------------MQTNHPMNEMTLPAEGITDSQPG---------------DMT
A0A518JPH9      -------------------MQTNHSTKEIAFPADGMLDSPPS---------------DVT
A0A5C5VEK8      ----------MTSLVSSQQGQFDPVPNDQFGPGPSSQAPQST---------------DLL
A0A532UTJ0      -----------MNEIKKLNEPVAGQELVNLQIPPEQSSEPTS---------------DLV
A0A2E2CCW9      ----------MNTDFQPLDQQSDFAIDGMEENAEINSSGPGV---------------DIV
A0A3C0AGX3      ----------MNTDFQPLDQQSDFAIDGMEENAEINSSGPGV---------------DIV
A0A518AAQ5      ----------MNTEFQPLEPHSDLDFDGMEESN-MNSSGPGV---------------DIV
A0A517QBG9      ----------MNTEFQPLDPHSDLDFDGMEESN-MNSSGPGV---------------DIV
A0A518FTU3      ----------MNTEFQPLDPHTDLDFDGMEESN-MNSSGPGV---------------DIV
A0A517WHH5      ----------MNTEFQPLEPHSDLDFDGMEDST-TNASAPGV---------------DIV
A0A5A8BGT3      ----------MNTEFQPLEPHSDLDFDGMEDST-TNASAPGV---------------DIV
A0A2E7K7A9      ----------MNTEFQPLEPHSDLDFDGMEDST-TNASAPGV---------------DIV
A0A517PTS5      ----------MNTEFQPLEPHSDLDFDGMEDST-TNTSAPGV---------------DIV
A0A6I6AH34      ----------MNTEFQPLEPHSDLDFDGMEDSI-TNTSAPGV---------------DIV
A0A517VTK3      ----------MNTEFQPLENHSDFEFDGMEGHTQSNTSGPGV---------------DIV
A0A517WQT4      ----------MNTEFQPLENHSDFEFDGMEGNTPSNTSGPGV---------------DIV
A0A517VID8      ----------MNTDFQPLDQQSDFALDGMEENAEFDSSGPGV---------------DIV
A0A517RK10      ----------MNNEFQPLDQQSDFAIDGMEEHAPINSSGPGV---------------DIV
A0A518IH18      ----------MSTEFQPLDQQSDFAIDGMEEHAPTNSSGPGV---------------DIV
A0A7W0M4Y4      --------------------MQQGRHLDAFAAASAANNDGGP---------------PMS
A0A2D5NDU9      -----------------------------------------------------MSFGQVL
A0A5C5XLF4      ---------------MPSSDKNSNNADAVHGHPLIKADEPAI---------------DLV
A0A518CHE5      --------------MNPYLDQSNSNESSNHDNSTSAMMARVM---------------RFL
A0A1V5N3W2      -----------MDSVVKYKPQPHPQEFVYTDVPPEAAPAAPL---------------GLF
A0A517NSK8      ---------------------MTQVDPNLNNQ--TADDSEAL---------------DLI
A0A5C5Z0D6      ---------------------MNDTTISSPNE--SAGDTDIL---------------DLL
A0A7W5H7D9      ---------------------MNDTAALAPAQ--ANQETDLL---------------DLL
M5UE94          ---------------------MNDTAAPQPRSYPEQQETDLL---------------DLL
A0A3E0MY27      VVSERPGEGALPVPTSGKDAVFDAIQTSTPARVRPEILTAPP---------------KPM
A0A7V4M591      ----------MMQDETRATCDGGAGGDPSSA----MLAQNLL---------------RFL
A0A7X7F3G7      ----MRLASHETPDDLPMIQDTQPLSTPPEAQSGRLMIHVML---------------QFL
A0A7Y4VQ32      TSGEPVTGAITRPGRSEFSPLAAHSEEALIPGDGGMDLASHF---------------SLS
A0A2E0X9P6      -----------MSHSAKEDHDYQLPAPRPPTEWTRQAVTASRPSRRADDSEGMPPDFVRR
A0A1N6DAJ8      ------------MMSNSNSGPRSDSANLPAVVPPYRTAEVFSIAPAPVGTAAGLDPIALL
A0A2E8FLY0      ------------------MSRPTDTPIDTSGEPRTATLTAIA---------------RFL
A0A3D2U1E1      ---------------MSTDQSHPNRPLDETA-PQAATLTRIV---------------RFL
E8R3W3          APPRDSHPSSPRPGTAMTRVAVDARPAKPALPPREEALATTL---------------ELG
A0A5C5ZM48      -------MNKMITPPTQDLTGAAIPAPMVIDAEGDDQSHSAL---------------SGQ
A0A5B9WF77      DRSDANLPARLTSSPRYPAQVSAMRREMDVAGAPSVTIDTRQ---------------LFR
A0A7C4Z5R7      ------------MNTLPARIEQNPRPGQASQTVPGNIGSGSPIQPPGSPASAPPSAWAML
A0A1P8WN28      ---------------------MDPYTLEQLDSTEPQGFHALL---------------RFL
A0A3B9CTT0      ---------------------MELEQPEQSASSQGNSLQGLL---------------RFL
A0A518ALT3      DSRHQLTTTHEELAISRRRNITHARQGSGSKQPTQSGITPLF---------------VWR
A0A286RGB6      ------MTPEREAGMSEHQHLPAPVGQDRTGAARPSAPAPLYLDAEWQPIPAAEAGQGFG
A0A7V3TZQ6      --------------MSEHQHLPAPVGQDRTGAARPSAPAPLYLDAEWQPIPAAEAGQGFG
A0A3M1QRP3      ------MSDKPSRAQDESHALAAGEPLTPAAPFAATDAIDVFAADSGEEREPQKLSLSPA
A0A517TMV0      -----------MGTAIEEYSNRQDALAEPALGGGGDAFESLV---------------RLV
A0A3E0MY88      -------------MSHAPDKLDLEAIGTLDDPSVSHIVHHVV---------------QFL
A0A518BBX8      ------------------MDRQEPFDPNASDDSPIIAMPDLT---------------RLV
A0A5B9QF68      ----------------MTNTDCKHNLREDAFMPAVDAVSAIA---------------RFL
A0A5B9QGF0      ----------------MINSDFNQNQADADFMPSVDAVSAVA---------------RFV
A0A5C6CK24      ----------------MTSTDFNQNQNDAEFMPSVDAVSAIA---------------RFV
A0A7C5FXU1      ------MSEQLPANRDERHMVAPVVYRPLDMRDWEGHFGGGWGGSPPQ--GGSPLGAYWH
A0A847YFA1      ------MSDSNVSAGSTAAVPAGTGSVAVLNSRSPFYIDAEWQSPEREHAQGGGMGVYLH
A0A1C3E6N1      ------------------------------MMPEANTMQTLM---------------RFW
A0A518GJT2      -------------------------------------MQTLM---------------RFW
A0A2E8B0L9      ---MSQTPELRAVSPPHSFDELHDPQD-----GAAEAVQAVA---------------KFL
A0A5Q4GFE7      ----------------MMQHEQHSSADESMLPSSADSIHALI---------------RFL
A0A257WS34      ----------------------------MQQAHHSTVLSELM---------------RFL
A0A7C4LP10      ------------------MSIDADPTAPADVPHHSGALGELV---------------RFL
A0A2E3RCU8      -----------------MSVETDDGAYELPLTNAAGAIHDVF---------------QFL
A0A517MLW3      -------------------MNQIENLSGPQHLTAADAIQALL---------------RFG
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      GDGKPDGLPLPRHLATPSAKDPPPPMSSLIESDSFSVGEPTSYGAPHGRAARTGREVSPL
A0A3B8PNV4      -----------------MSQSPDDRPIAAPNEPQTATLAAIV---------------RFL
A0A3D1DR40      -----------------MSQSPDDRPIAAPNEPQTATLAAIV---------------RFL
A0A2E7RYU8      -----------------MSPSPDDRPIAAPNEPQTATLAAIV---------------RFL
A0A3B8LXG8      -----------------MSPSPDDRPIAAPNEPQTATLAAIV---------------RFL
A0A6M5Z0K7      PPSGSEQPRGTLSPAAQADRLLPALGVGGPPVAEPPALKQTI---------------TPG
A0A350CI62      ----------------MTDQDRILAGSQDGTNAAATTLHLLF---------------RFL
A0A4P5WQK6      ----------------MTDQDRILAGSQDGANAAATTLHLLF---------------RFL
A0A3C1X4W5      ----------------MTEQDRILTGSQDGQNAAATTLHLIF---------------RFL
A0A3D3W3A7      ----------------MTEQDRILTGSQDGQNAAATTLHLIF---------------RFL
A0A7Y5SKC2      -----------------MMADTPAVDSESDDLASAHFVHSLM---------------QFA
A0A7X7U104      ---------------MNGTNNPSLPEQQADPVQAGDFFEGFS--------------ESLF
F0SI78          --MTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPTSSESGF---------------DIR
A0A517MDV3      -----------------------------MSGDNTVSPQPNL---------------DFW
A0A518IQ30      -------------MQRESAPRLSETEQGSDEFQAADAIHAAL---------------RFL
A0A517LWP4      -------------MQRESAPRLSETEHGSDEFQAADAIHAAL---------------RFL
A0A518JNW8      -------------MQRESAPRLSETEHGNDEFQAADAIHAAL---------------RFL
A0A2E3GWX1      ----------------MVSPEQYDLAAMPLPQETVNPLTTVI---------------RFL
F0SG60          ----------------MVSPEQYDLAAMPLPQETVNPLTTVI---------------RFL
A0A2E9VST2      ----------------MPAPENYDPQMNMHLQENHNPLQTIL---------------RFV
A0A356A6X2      ----------------MPAPENYDPQMNIQLQDNHNALQTIL---------------RFL
A0A5C5XLM3      ----------------MPAPENYDPQMNIQLQDNHNPLQTIL---------------RFL
A0A7V2UW16      ---MSESRLNAQDPLRRGAAGSGGYPVPGGDPAVEENAVPWR---------------LWL
A0A518DRX3      -----------------MTTELSLVSPDAEGSSPRDIMQAAL---------------RFL
A0A518DZF9      -----------------MTTELSLVSPDAEGSSPRDIMQAAL---------------RFL
A0A2E7ENQ5      --------------------MNERRALPPTAGSQTHLVHTAM---------------RLF
A0A7V2XSV8      ----MPESPDVKNDALRGASPTNGAPPAGGPHGPDDPAVPWR---------------MYW
A0A847GXG1      -----------------MTHEQQSATDEFAPTSSADSILALM---------------RFL
A0A7C5BZF0      -------------------MGDSV--------SAAQMVHSLA---------------RFW
A0A847YGH5      -------------------MPDSFSPATILPDSTTHLVHAAM---------------QFA
A0A286RLF2      -------------------MNESSWIQWAVPDSASHILHAIA---------------QFL
A0A7V3TX18      -------------------MNESSWIQWAVPDSASHILHAIA---------------QFL
A0A1G3AQE9      ------------------MQEPAVVRDELESESTAHMVHRLV---------------QFA
A0A3L7UQT9      ------------------MNSDVQQPAPAPILNTANVVAGMI---------------RFL
A0A4P5YBU2      ------------------MNSDVQQPAPAPILNTANVVAGMI---------------RFL
A0A7C7V5U8      ------------------MQEPTVVYHEPEKQSTTHMVHVLM---------------QFA
A0A3M1VCL4      ---------MTQDVPSLVLQQEASRAADLAAVPAINPLASLL---------------RFA
A0A518AKT8      -------------MLKTPESNNLSSMEQSDDISTSDMIHAGL---------------RIW
A0A5C5ZR72      ------------MNEDQKSKQSQLTHRTAGSEGARGGSAHARHALKPSRAEAAQPQIGPM
A0A7Y5SJZ4      ---------------MSRNEQSPTAPSAVGAFSELHALQNLM---------------HLL
A0A5C5V7Z9      --------------MTAADHQPGFQDEGVQEGSLAESLHGLV---------------RLL
A0A5C5YT05      --------------MTAVDQQGGFPEEAAHEGSLADSLHGLV---------------RLL
A0A518D7F9      ------------MKQSPTAALAREEEWQDDSGAAGAALEGVL---------------RFL
A0A5C5ZIP0      --------------MTQNQEHFHEPEITVSSAGPNEALQGVL---------------RLV
A0A518KBK3      --------------MSLDTVNDRGEPWGNELDAGGHALEAVV---------------RLT
A0A5C6AKF9      --------------MSLESANEHGEPWRDDNDASEHALEALV---------------RLA
A0A7C2KUQ9      NEGSGESGGLLPVARRGEPVEAHRGLLTGPIAAPAPLVGVPA--------------GRTV
A0A7C5R0U3      --------------------MNDSGHGRDEGARSPHGVAELV--------------FLAA
A0A847YCQ7      ------MSMTLSINPGLQPTAKTPGPVIPAA--VRDTLQGPP---------------KPV
A0A286RD13      ------MSDLVRVLGTSPPSTLASGNSVAPTPLQRETLHGPP---------------KPS
A0A7V3TUJ6      ------MSDLVRVLGTSPPSTLASGNSVAPTPLQRETLHGPP---------------KPS
A0A517TY85      ------------MNLPPEPTREPTNLVVRPTQSRAPALANMTPAGG-SDAAAAMQGITPA
A0A5B9QEI7      -----------MNNSPNPPEHESTGSGLPARIPVAHALRRPMPAAARQNSTPNEQGITPA
                                                                            

A0A5S9IPR9      AILRKHLILV-----AFCG-VVGAITAV------FYTSRLPNMYRAGASVA--VIKPTKN
A0A533Q9U4      KIIRKRMWMV-----IIFF-VVIVAIVT------IKTFKTTPVYQATARVV--LEQNKLN
A0A533Q6B7      KIIQKRMWIC-----VIVF-IAIVAVVV------VYTLRTQPLYQTTASIM--LEQKEFN
A0A1U9NNE1      KALLRRWYIV-----LLTV-VVLCAIGIP-----AIFYMFKPSYETVGAIR--VSPILPN
A0A2G2JCA2      LHALRRWWMI-----VIPIGMVLGSAGAA-----GLWSRYEPVYKASAWLQ--IEEVSPY
A0A1G2XVR0      TTVLRRKWII-----IAFL-VISGTYST------YKELTKIPYYTASTQVI--ITQNTPK
A0A1G3B0P0      TTVLRRKWII-----IAFL-VISGTYST------YKELTKIPYYTASTQVI--ITQNTPK
A0A1E3X4X0      KIIQKRQWVV-----ILVF-VVLVATVT------ISTIRMTPVYQAKARVL--IEKEERV
A0A286U4B3      RVVMHRKWVI-----VAIF-TITVLLVT------LYTFKQKPIFQAVTTIR--IFKEAPK
A0A5C6DDS2      RVVMHRKWVI-----MAIF-SITVLLVT------LYTFKQKPVFQAVTTIR--IYKDAPK
A0A5S9IJB5      EIITSRWYII-----FLSI-TLFVGMAF------YYAKTTKRIYQSTGTIA--ILPKNLN
A0A2E3GW02      SIVWERKWLL-----IFFA-ALGAAIGY------LEFTKQPPVYRSSASIL--VDRYQPR
A0A5B9QNZ7      GVLRRRWIIV-----FLGL-ALGISLAV------FYAVVAPKIYSSQVEVL--VMRKDPG
A0A1Z8N7H5      KVVWYRKNSM-----IMVG-FILAIIAG------WYAATATRYYQSSASIL--IVRNGMS
A0A1U7CZ81      RGLARNWWRI-----LLLWAVVSAPLDY------LIYSQIQPTYEAVSTIR--AEPTQLS
A0A142YNY8      RGLLRNWWKI-----LGLWLIASLPLVY------GIYTQVKPTYIAYSVIR--IEPTQPE
A0A1U7GLS6      RGLLRNWWKI-----LGLWLILSAPLAY------LVYSQVKPKYMAYSRIM--VQLTQPD
A0A1G2YPI3      LILWRSRWIV-----LLTT-VAVLAAAL------IYVTKVTPVYTSTSRIY--VEQSGPK
A0A532UIN2      QIMWRGRWLI-----LLAT-ILAVAAAV------VYLVKATPIYSSTSRIY--VEQSGPK
A0A0S8KNX5      AGIFRRWYIV-----LLILFVMCAAGLP------AIWFLIDPVYEVTGAVT--IAPIMAD
A0A3D3UVZ8      AGILRRWYIV-----LLILILICGSGLP------AVWFMVKPIYDVTGAVR--VAPILAD
A0A517NFU9      GMLRRRWPHI-----AFGI-FVGLSLAG------FYYFSTDRMYESKIEIL--VGQRSSE
A0A5C5YWH4      GMLRRRWPLI-----VFGI-LVGVSLAA------FYYAATTRMYESKIEIL--VGQRSSE
A0A3D2TNK4      RMLMIRKKTI-----IISL-YLFAVCGV------IYYYFAVRLYESSAKIL--IDEKNQD
A0A7C1Y4F0      FIVLRHRWTI-----LITT-LVALVAAF------AYILKATPIYESESRLY--VEQSGPR
A0A6I0ENW6      SMLRYKWMVL-----GITLAGAAVSVPP------VWMLIKPKYYANTLIQL--KPTMQRQ
A0A6L3A0B7      SMLRYKWMVL-----GITLAGAAVSVPP------VWMLIKPKYYANTLIQL--KPTMQRQ
A0A0J1B4A0      GIVRRRYHLI-----ALGI-FVGVTLAT------IYFVNQVPIYESKLAVL--VGQRSGE
A0A142WSB9      RFVLSIWKWL-----ALGL-FAGLTLGV------VSYLIMGPVYRASTRVQ--VSKKASL
M5SZR3          KVALRHKSLI-----ALGI-AIGLVIGA------LYYAQSTPVFRSSAQVL--IVRKTPN
M5TW92          KVALRHKALI-----ALGI-AIGLVIGA------LYYAQSTPVFRSSAQVL--IVRKTPN
A0A2S8FKY2      HSLRRQWLAS-----IVLGLLVAVPVAI------AAWVLQSPTYTSSAYLR--ISSNDQP
A0A517N8P6      GVLWRRKGVI-----LLLI-LCGLGAGY------WFFTTQDETFRAAATIE--VYSQNV-
A0A432MJP4      RVVRREWRWS-----AVGL-AVCLTAAA------IYLVRTPRMYQATARVL--VLETGRQ
M5UQ35          GILRRRYHLI-----ALGV-FVGALLAC------LFYVKQVPVYQSNLAVL--VGHRSAD
A0A0S8FY64      GVIRSRFWTI-----VACA-VVLFTVAV------LYTFQATPIYEASARLL--IERRAPQ
A0A1N6KFT7      DVLKRGWKFV-----SLGL-LVGLTLAS------IYLAKTKRIYQASTSLL--VIQHGGR
L0DFG4          EVMKRGWKLV-----IFGL-LVCLTLAS------IYLAKTKRAYQASTSLL--VIQHGGR
A0A5C5XXG1      PWIARRRAA--------------------------WVILSGPAGHSS--------HHEGC
A0A7C7YUM8      HILLRHKSLI-----AGAA-FFVTVCTV------LWVSTRQPRYEASAVLL--LEKDEST
A0A7C2AHI6      SLVERRMKLI-----LATA-ALVVVGTF------VYLGMRPPTYRASATLM--LLDNGGE
A0A518BJJ1      DLIRKRWLAI-----GACA-AATVAAGI------GWLSLQPPVYRATATIL--LDQSQPT
A0A518D182      DLALRRRLAL-----ALFA-VAGLGLAL------GWIGAQAPVYRATATVL--IDEQDGA
A0A7V4HWU2      WVFWRHKWLI-----VLFT-AVGCGLGY------LYFLQQPPVFQSSGQVL--IVRNEAR
A0A5C5WTY6      SIVRRRWKWI-----AGFA-CLGILATA------IYLSQTPPTFRSQAKIL--VNPNRVE
A0A5C5Y033      QLIARQRWLI-----LFLG-SCGLAMGV------AYATHAEVLYESQAKVL--VAQRSAG
A0A5C6G1Y2      QLIARQRWLI-----LFLG-SCGLAMGV------AYATHAEVLYESQAKVL--VAQRSAG
A0A354PDV6      QVLSRQRWLI-----VFCS-LMGMAAGV------LYSIQSTVWYRSTAAIL--VNSKNAG
A0A5C6FZ02      QILFRQRWLI-----AFLT-LAGLAAGV------AYALQARVWYESTARVL--INEKSSG
M5TIT3          EILSRQRWAI-----VFLT-LCGFTAGV------AYAMYSQEWFESHAKIL--INQKSAG
A0A5M6CY44      DIFRRQRWMI-----IFLA-VLGLAAGI------LYALNATVWFESRAKLL--ISERTAG
F2AXG2          QILSRQRWLI-----AFLS-IAGLAAGV------AYALNAQVWYESNAKVL--INQASAG
M2BB46          QILSRQRWLI-----AFLS-IAGLAAGV------AYALNAQVWYESNAKVL--INQASAG
L7CLQ6          QILSRQRWLI-----AFLS-IAGLAAGV------AYALNAQVWYESNAKVL--INQKSAG
A0A0J1B719      QILSRQRWLI-----AFLS-IAGLAAGV------AYALNAQVWYESNAKVL--INQKSAG
Q7UF18          QILSRQRWLI-----AFLS-IAGLAAGV------AYALNAQVWYESNAKVL--INQKSAG
A0A2G1W1E0      QILSRQRWLI-----AFLS-IAGLAAGV------AYALNAQVWYESNAKVL--INQKSAG
K5E235          QILSRQRWLI-----AFLS-IAGLAAGV------AYALNAQVWYESNAKVL--INQKSAG
A0A5C6FFI9      -MLRRRWFHL-----VLGT-CLGIAFAL------LYFYATKPTYESHIEIL--VGQRSSE
A0A5C5WDJ1      GMIRRRWRLL-----VFGV-FVGIALSA------LYYTTATQQYQSSIEVL--VGQRSSE
A0A5C5X547      WHAFRRRWAL-----GLLIGILLTPLAI------VPWLLMEPQSTAVVQLH--LHQDDPM
A0A353FIP5      GILWRRKVQI-----ALIT-VIAACVAF------LVAVTRTPSFEAEGRVL--LE-----
A0A7V7MJI7      GRLLRQKGSV-----ISVA-FLVVLAAA------AYSLTRPPEFTAEARIL--LE-----
A0A5B1CIK7      AILGRQRWLI-----AALS-LAGLAAGI------AYALTAEVWYSSQAKVL--INERSAG
A0A5C5WHS2      AILSRQRWLI-----GLLT-LAGLAVGL------IYALNAEVWYRSQAKVL--INEKSAG
A0A5C6B6G8      ETITRQRWLL-----AFFA-MLGLVVGV------AYSLNAQIWYKSNAKVL--IAEKTAG
A0A5C5ZZN3      EILSRQRWLI-----IFLC-LCGLTAGI------AYALYAPVWYETNATVL--INQKSAG
A0A5C5XS91      QILQRQRWII-----LFLC-ICGLTAGV------AYSLYAPVWYQSSATVL--INQKSAG
A0A5C6C4E6      QLLHRQRWII-----IFLC-ICGLTAGV------AYAKYATVWYQSSATVL--INQKSAG
A0A2E1VVJ1      SAILRHKALI-----VLCT-LLSSAAVM------FYSATKEPVFNAEGRVA--LD-----
A0A3M2AEL0      GIFWHQRLLV-----TSLL-ILGAVLGF------FLSMLVPPRFAAEATVL--LR-----
A0A2A2W9R6      GIVRRRFHLI-----MLGV-LVSVTGAT------VYFVQQKPVYESKLAVL--VGQLSSE
A0A518HKC1      GIVRRRFHLI-----MLGV-LVGATCAT------IYFVKQKPVYESSLAVL--VGQLSSE
A0A518L3P0      GIVRRRFHLI-----MLGV-LVGATCAT------IYFVKQKPVYESQLAVL--VGQLSSE
A0A255R1S0      GILRRRYHLI-----ALGL-LVGATLAT------IFYVKQKPVYQSSLAVL--VGQRSSQ
A0A5B9MKP1      GIVRRRFHLI-----MLGL-LVGSTCAT------IFFVKQKPVYQSSLAVL--VGQLSTK
A0A351FYP6      RIIRVRIVTI-----LLVF-LLTAITTT------VVTFLIPKTYMSLSRIA--VEKDTSD
A0A0S8J591      WVLKRRVLLI-----LFFW-GLVFASVV------VATFMQQPLYRAYARIEIERSVDTPD
A0A532UT69      RIIWRSRGIV-----LLTT-FVSLAAAA------VYVTTITPVYKSTSKIF--VEQSGPK
A0A7V9G2R2      DNLKRHRFAA-----IASF-VIVAAFVL------GMSLITSPLYEAKATLSLERTRQAVE
A0A2D5AWU0      QALWRGKWYF-----LLFP-AIAGGGMY------YFLHGQKNLYRSTAQVQVAPREVDPL
L0DC26          RALRRRWALA-----FGTG-LLGAAVIA------TLTFYLVPPAKYMARAMLHVNSVKPR
M5RT57          SLTTYWYLTI-----PLAI-VLAGLSAT------AVLMTFTPVYRATAVMK--IASYAPF
D5SZ21          RSVQYRKGLI-----ILAV-LAASALGA------AYYIVSTRYYESKAELL-ILQTGSKV
A0A7X7U1J4      EILWRRRWTI-----LLVC-LLASAGGL------LYLQNATPRYTSTSRLC--VEQAGPQ
A0A7V8E5N8      IVLRRRWRIA-----LVVF-ALTLTCGA------LYTFSQKKVYRPQASLE--IRPERNT
A0A356KTN1      LGFKRRLPLV-----IGVT-LFFGVAAG------VRSSNLPTVYASTARLQLAKEAPDPT
A0A7Y5LV28      LILRRRWRLL-----AIVW-LVTAGGVA------VWTFTQTRQYRPQVTLE--IRPEQSV
A0A7Y5HFQ5      AVLYRHRWSS-----LLAF-VVVAAAGT------LHTLRTTPIYQCAPALVEITSQNSGI
A0A7W1FMQ9      AAVQRRWLFG-----LVAG-ALAAAAIL------LLAFRSVPLYEANATLT--INRERKP
A0A7W1NA62      AIAWRRRFAT-----AIAA-TAVIVVVL------IVTARITPLYEAEARLA--VDRGRQT
A0A7V9JTP9      SIIWRRRVWA-----ISAA-IVVAAAVV------LGSFRMTPLFEAKASLA--VDRGRQA
A0A7W1FJ38      ATCWRRRWLC-----LAVF-VVVAATVI------LITFRITPLYEATATLA--VERGRKA
A0A1G2YQB7      AIM-RKRWKILTVTAIIIC-GIGLPLIW------LLV---KPYYLATAAIR--VAPVISS
A0A353P687      TAV-RKRWKILLFTMIIIC-SIGLPAVW------MFI---KPFYLATAAIR--VAPVISS
A0A356EME5      LNALLHWWKVAMPVGLILA-AVAVAGVW------WFF---EPVFLSRALIQ--IRENPPA
A0A3L7P4E4      GFLCRRAWLG-----FFFG-TIGATAAY------YYYLRQPVVFKATSQIL--ITKQQAE
A0A3L7PEB5      GFLWRRAWLG-----FLFG-TIGATAAY------YYYLRQPVVYKATSQVL--VIKQQAD
A0A1U9NL64      EVAWANRWLI-----LATT-ILSLTAAF------IYLAKATPIFTSSSRVY--VEQSGPK
A0A2N1UCJ3      VTLQRRRLSI-----LITA-VLFVAAAI------LYLIKAEPLYTSTARLY--VEQTGPK
A0A7V2H881      KTLWRRRWST-----LACM-LAGLVAGY------VVFALSDPVYEGKARLF--ISQSGPK
A0A7C4EK84      GVVWRRRWTV-----LAVT-AASLLAAV------VYLAQAEPIYQSSARVY--IEQTGPR
A0A7C3F0T2      HTLWRRRVII-----AAAM-VISLALGW------LQLNNTTPLYTSTSRLY--VERSTPK
A0A7X7U4K9      KIMWRGRWIL-----LLCV-GLALGAGT------IYLRVAVPMYESRAKLY--VQQGIPS
A0A2E0X4J3      AIAWRSRWLI-----LLFM-ILGGAVSW------VLLQRATPRYTSFSKLY--VERNMPQ
A0A838QZ11      GLAWRSRWLL-----LLMI-LVGGGAAW------TLLQRVTPRYTSVSRIY--VERNLPR
A0A5C5YU10      ALAWQGRWLI-----LIGV-LIGGSAAW------VHLQRVTPLYQSTSRVY--VERSLPK
A0A517MPZ6      SIAWQARWLL-----LLTV-LLGVGCAW------LYLQRVVPRYTSVSRIY--VERSLPQ
A0A5C6CNV7      ELAWQARWLL-----LLTV-LTGLGAAW------ILLQRVEPRFTSVSRLY--IERNMPR
A0A518K5H4      AVAWQSRWLI-----LLFT-LLGGVAAW------AYLQQATPRYTSLSRIF--VEQKLPS
A0A5C6AA28      AIAWQSRWLI-----LLFT-LLGGLASW------LYLQRVVPRYTSLARVF--VEQNLPR
A0A2E7ESJ6      GILSRRKWLV-----ILGF-MLGLGLGY------VYMLQATPRYESVAQIL--IEDKQPP
A0A2E9VK20      KLALKNVVTL-----GIAA-AAGIGLGI------FAYKILGPKYTASSQIL--VKLKSPI
A0A3D4PJK1      KLALKNVVTL-----GIAA-AAGIGLGI------FAYKILGPKYTASSQIL--VKLKSPI
A0A355AI52      RVLWHRRIII-----MSTL-ALCGMLGG------LYYATAARIYEAKAQLL--IVDTSRE
A0A354PCQ3      TFRRCWAWAL-----PIGA-LLAGLAAFFVLRNFVPIYRASSLLEANQDYV--VFQGVMP
A0A0S8GZ23      QPVLRRWYWV-----LVIF-ILVSAVGAP-----IIWHVKRPIYTTSGTIH--IRPLVAD
A0A1I3DDV4      EIFRRQLPLI-----ACCT-VLGLLMAV------IYWANAEKWYESSAKML--VTLKDMR
A0A7V2UF66      RVVWRRRWVV-----LLAL-AVCLGGGF------AHLWRATPLYTSTSRLY--VEQRGPK
A0A2E0SMM6      RVIMLRKKII-----VVCV-ILTSIAGA------YWYSTQTPMYQSTAQLL--VLSNGGF
A0A3L7SI46      QVIRRKLPTL-----LVCT-ILGGVIGT------AWYVTATRKYESVSEIM--VLKTDGN
A0A5B9PJZ8      DMVRRKIWLI-----LFFT-LLGIAAAL------LFFFQAPKTYRSTAKVF--VDEKSAP
A0A2S8G191      QILHALRRRW-----LPAF-SIGIVLATAGVA--LAWVLDVPEYTTRAMLR--ISSSQGS
A0A2E7EGG1      SVLIQWWRIL-----IPVT-LFALLISTV-----FVFWSFRPQYRASAWLQ--INGVQPY
A0A2E2N5A9      MSVWLRKWLI-----LGVM-LFAALAAA------WATSWMTPLYRAGATLL--VESERAK
A0A7C8AGA2      AAILRRWPVL-----VATF-VIVCVLGVP-----AILFLIEEKYDTEGAIR--ISPIVSP
A0A7C2FXP7      PIMRRWKLVF-----FVFI-FLCAATIP------FIWSFVKPTFEVTGAIR--VAPILTN
A0A1P8WP26      RTVRHRSGIL-----LLCL-VVSGALGT------LYYVTAPRIYQSKASLF--VVQIGSG
A0A3L7V1F3      RTVRLRSGIL-----VATL-VISSIAGA------TYFITAQRIYQSNASLY--IVRKGGN
A0A2E3GWC6      QLALRNIIWL-----IIAG-AVGLGLGI------AAYKALGPSYVAKSQIL--VKLKTSV
F0SLB0          QLALRNIIWL-----IIAG-AVGLGLGI------AAYKALGPSYVAKSQIL--VKLKTSV
A0A3L7NDH9      QVLWRRKHLL-----VASC-AAAGLLGG------LYYTTSKRTFEAEASIL--IVGSQGD
A0A7X8IIB9      PAIFRRWYII-----LLCT-ILIGGGGAA-----AIWFFMPEKYETQGSVL--ISSVVVP
A0A532UD06      LIVLQHRWTI-----LLTT-VGFLVVGF------AYIMKATPIYTSASRLY--VEQSGPK
A0A660URN1      ---LRHRWVI-----LAAV-LVSLIAAF------GYILKATPIYTSASKLY--VEQSGPK
A0A517ZCB5      RVVRNRLHIV-----LGIL-VSVSILGG------ISYVLSPPVYESAAELL--VLQTGSS
A0A225EH48      ELVNALKRRL-----VLAT-FLGMLVGMAAAAA-VWLALPSGKHTAMALIQ--LKPIVSA
A0A518INW8      RILRRRWPLL-----MFGL-VVGLGIAF------AYHQNAKDVFESSMEIL--VSQRATE
A0A518JPH9      RILRRRWPLL-----LFGL-VVGLGIAY------AYHKNTKVVYQSSMDIL--VSQRASE
A0A5C5VEK8      ALAWRGRWLI-----LLGV-LIGGTASW------VYLQRVTPLFLSQSRIY--VERSLPN
A0A532UTJ0      AGIFRRWYIV-----LLVF-LLICGAGLP-----ATLFLVKPIYSVTGAIK--VAPIIAD
A0A2E2CCW9      RLLLRNKYLL-----VLGL-AAGLLLGQ------AAYMKLGPIFSADTKIQ--VSQKNPV
A0A3C0AGX3      RLLLRNKYLL-----VLGL-AAGLLLGQ------AAYMKLGPIFSADTKIQ--VSQKNPV
A0A518AAQ5      RLLFRNKYLI-----VGGL-VAGLLLGQ------AAYMKLGPVFSANTKIQ--VSQKNPV
A0A517QBG9      RLLFRNKYLI-----VGGL-IAGLLLGQ------AAYMKLGPIFSATTKIQ--VSQKNPV
A0A518FTU3      RLLFRNKYLI-----VGGL-IAGLLLGQ------AAYMKLGPIFSATTKIQ--VSQKNPV
A0A517WHH5      RLLFRNKYLI-----VGGL-LAGLLLGQ------AAYMKLGPVFSANTKIQ--VSQKNPV
A0A5A8BGT3      RLLFRNKYLI-----VGGL-LAGLLLGQ------AAYMKLGPVFSANTKIQ--VSQKNPV
A0A2E7K7A9      RLLFRNKYLI-----VGGL-LAGLLLGQ------AAYMKLGPVFSANTKIQ--VSQKNPV
A0A517PTS5      RLLFRNKYLI-----VGGL-LAGLLLGQ------AAYMKLGPVFSANTKIQ--VSQKNPV
A0A6I6AH34      RLLFRNKYLI-----VGGL-LAGLLLGQ------AAYMKLGPVFSANTKIQ--VSQKNPV
A0A517VTK3      RLLFRNKFLL-----ISGL-AVGLILGQ------AAYMKLGPIYSASTKVQ--VSQKNPV
A0A517WQT4      RLLFRNKFLL-----ISGL-AVGLILGQ------AAYMKLGPIYSASTKVQ--VSQKNPV
A0A517VID8      RLLLRNKYLL-----VIGL-VAGLILGQ------AAYVKLGPIFSATTKIQ--VSQKNPV
A0A517RK10      RLLFRNKFLL-----VTGL-VAGLLLGQ------VAYMKLGPIYSASTKVQ--VSQKNPV
A0A518IH18      RLLFRNKFLL-----ITGL-IAGLMLGQ------VAYIKLGPIFSASTKIQ--VSQKNAV
A0A7W0M4Y4      QLVLRRKWLL-----LFGL-AVGVGLGY------LYFTQQAPVFRSVAQIL--VTPNRAP
A0A2D5NDU9      AMLWRGRWTI-----LATT-LVVTLAAF------IYGEVTGSRWRAESRLF--INAGVNA
A0A5C5XLF4      KLALKNVVIL-----GIAA-VAGIGLGI------FAYKILGPKYTASSQIL--VKLKNPV
A0A518CHE5      RVIMLRKKII-----VVCV-ILSSVAGA------YRYSTQIPMFQSTAQLL--ILSNGGF
A0A1V5N3W2      RALRRRWYIV-----FLVF-VLLAGAGLP-----AVWFLVKPKYQAAAAIR--VAPIIPS
A0A517NSK8      GVLRRRIGFI-----VLGV-TLGLIAAG------LYLLLTTPTYRAEMEIL--VGQKSAD
A0A5C5Z0D6      GMLRRRKGFI-----ALGL-FLGVAAAV------LYFFLTPPTYRAKMEIL--VGQKSGD
A0A7W5H7D9      GILRRRKGLI-----ALGL-FLGVAAAA------LYYFLTPPTFRAEMEIL--VGQKSGD
M5UE94          GILRRRKGLI-----ALGL-FIGVAAAV------LYYVLTPPTFRAEMEIL--VGQKSGD
A0A3E0MY27      DLLRALQRRW-----LLAF-VLGCMLGIPAAV--ITWFVVPIEYTAEAFLQ--FNDEEVI
A0A7V4M591      MAVRYRKKVV-----AMTL-VVAALLGA------LYYVTTPRLYSSKAAIL--VTQVGRD
A0A7X7F3G7      AAVRYRIRIV-----ILAL-TATGLLGA------AYFVTATRYYSATAGML--MIQSGVG
A0A7Y4VQ32      AILRRKWTII-----GLFI-LVAGTAIP------GVWLMTIPKYRATAMVR--VAPVVPR
A0A2E0X9P6      VLRNSWKWAI-----PLGL-LLAAAAGC------AVMYLHVPKYQASALIQ--IESKVPF
A0A1N6DAJ8      KALRRRWPLA-----VGAG-LLGGVVLAVV----TYFVVPPAKYTARSMLH--VNSTQPR
A0A2E8FLY0      QVVRIRKGIL-----FSTL-FISTILGG------LYFATATRLYESKARLY--VLQMGSN
A0A3D2U1E1      HVVRVRKGLL-----FASV-FVAVLLAG------LYYATAPRLYESSSRLY--VLQMGSN
E8R3W3          DLLRALRRRW-----LMAA-IVAPLTAVLAMVV-AYPLVIKERYSSEATLQ--LALFGRS
A0A5C5ZM48      AIVGAVRRWW-----VVAT-PVGLFLSVAAVV--AICLMSQPVYRASAWLK--IKAESPY
A0A5B9WF77      GLARNWWRIL-----LVWL-VVSAPLVY------VIYTLVEPTYQASSLVL--VESNQND
A0A7C4Z5R7      NALRRRWWLA-----LLLA-IPASAAAAA-----AVWFVYPPSYTAQTLLH--LSAIPPR
A0A1P8WN28      RVVNRHRMIL-----VGLV-AAAAFLAV------VRHKQIPKQYESTARLM--VRQVSAD
A0A3B9CTT0      RVVNRHKLII-----VGFV-AAACFLAV------VKHNRQPQIYEAGTKML--VRQTGSD
A0A518ALT3      VFRNWWKFLV-----PCSL-LLAVAAAA------LVLWLHVPQYEARALIK--IESNIPY
A0A286RGB6      AYLHAFRRRW-----LAVA-FLGMLCGAAAAA--AAWFLFIPQYTATALIR--VSSSVQS
A0A7V3TZQ6      AYLHAFRRRW-----LAVA-FLGMLCGAAAAA--AAWFLFIPQYTATALIR--VSSSVQS
A0A3M1QRP3      RILRFKWTIL-----VVFA-AVCASALA------GVWIFVEPQYRSIAQIE--VRPQRDM
A0A517TMV0      RIVRYRHQAV-----LWIV-AGCLALGL------TYYAMAPRYYRSEARLQ--VIDQSGE
A0A3E0MY88      RVVRSRINIL-----IIAI-VVSSLLGG------LYYATATRYFQANASVL--IIRNGGS
A0A518BBX8      QIVWERRWTF-----LVGP-VVFLALAT------LYYVQATPRFESEAKVL--VINKKPT
A0A5B9QF68      SLVRRRKQVV-----ITSV-VISGLLGM------TYYLLATRKYASTAELL--IIQQKQD
A0A5B9QGF0      GIVRRRKQVV-----IASV-VISGLLGM------TYFMLATRKYASTAELL--IIQQKQD
A0A5C6CK24      GIVRRRKQVV-----ITAI-IIHVLLGT------TYYMLATRKYASTAELL--IIQQKQD
A0A7C5FXU1      AFRRYWALAT-----ILGL-LVGAAAGL------SVWFLIPQKYTATALLR--VAANPEA
A0A847YFA1      AFRRRWPAVI-----FLGL-VAAAVCAG------GAWFLVVPQYTATALIR--VSAANQA
A0A1C3E6N1      RSVQYRKGLI-----ILAV-LAASALGA------AYYIVSTRYYESKAELL--ILQTGSK
A0A518GJT2      RSVQYRKGLI-----ILAV-LAAIALGA------AYYIVSTRYYESKAELL--ILQTGSK
A0A2E8B0L9      RVVYYRRSYV-----ITCV-VVSALLGG------LYYYRASRVYAATASLL--ITQTGTD
A0A5Q4GFE7      QVVYHRKIYV-----VSAV-VVASLLGG------LYYTTATPIYQATSQLL--ILSTGPD
A0A257WS34      HIVRLQMWTL-----ILTV-AVTGILGG------IYYMTADRVYDSSADVL--VLQTNGN
A0A7C4LP10      QVVRLRKWTL-----VACL-LVAGAGGA------VYYATATRIYESSAEVL--VLQTGGN
A0A2E3RCU8      KIVWYRRNSM-----LVVG-IVCAIVAA------WYAATATRYYQSSTSVL--IVQNGSA
A0A517MLW3      NGMMRRQRMV-----ASVF-LLVGLFAG------IYYVTADRVYQASAQLL--VEEPSIG
A0A5B9QVD0      --MYRRQRLV-----VGVF-AVVGMLAG------LFYVTADRVYQADAQLL--VEEPGLG
A0A3A0DET7      ALAWRNRWLL-----LLTT-LVGGGAAW------ATVQRVTPRYTSVSRLY--VERALPR
A0A3B8PNV4      QVVRIRRGIL-----FCTL-FISIVLGG------LYFATATRLYESKARLY--VLQMGSN
A0A3D1DR40      QVVRIRRGIL-----FCTL-FISIVLGG------LYFATATRLYESKARLY--VLQMGSN
A0A2E7RYU8      QVVRIRRGIL-----FCTL-FISTVLGG------LYFATATRLYESKARLY--VLQMGSN
A0A3B8LXG8      QVVRIRRGIL-----FCTL-FISTVLGG------LYFATATRLYESKARLY--VLQMGSN
A0A6M5Z0K7      ALLAALRRRW-----QTAL-GVALVLGAGFAA--AVWVLRPDKYTSVALLQ--VSSAELK
A0A350CI62      RTVRFRKGIL-----VASL-VMSTILGM------TYYITAERIYESTASLY--VVRKGSG
A0A4P5WQK6      RTVRFRKGIL-----VASL-VMSTILGM------TYYITAERIYESTASLY--VVRKGSG
A0A3C1X4W5      RTVRLRKGIL-----VAAL-VMSTILGM------TYYITAERIYESTASLY--VVRKGSG
A0A3D3W3A7      RTVRLRKGIL-----VAAL-VMSTILGM------TYYITAERIYESTASLY--VVRKGSG
A0A7Y5SKC2      MAVRHRKNIV-----IVCL-AVALLLGA------LYYATATRYYSAEAGLL--VLQVGSQ
A0A7X7U104      EIAWRRRWTI-----LLTV-VAALAGAI------VYLQKATPLYKSTSRVY--VEQSTPR
F0SI78          SIVWERKWLL-----IFFA-ALGAAIGY------LEFTKQPPVYRSSASIL--VDRYQPR
A0A517MDV3      GILRRRWLIL-----FLGL-AFGISLAV------FYAFVAPKVYASRVEVL--VMRKDPG
A0A518IQ30      RMLRRKKQYV-----AFSL-LVTSALGA------FYYLTADKVYEARAQLL--VTQTSPD
A0A517LWP4      RMLRRKKQYI-----AFSL-LVTCALGA------FYYLTADKVYEAKAQLL--VTQTSPD
A0A518JNW8      RMLRRKKQYI-----AFSL-LVTCALGA------FYYLTADKVYEAKAQLL--VTQTSPD
A0A2E3GWX1      QSMLRRKWIV-----MGWL-TITVGLGI------TYFVLAPRLYESSAELL--ILHTGEG
F0SG60          QSMLRRKWIV-----MGWL-TITVGLGI------TYFVLAPRLYESSAELL--ILHTGEG
A0A2E9VST2      QSLIRRKWTV-----MAWL-TLTISLGM------TYFALATRKYESSAELL--VLHTGEG
A0A356A6X2      QSLLRRKWTV-----MAWL-TFTVSLGM------TYFALAPRKYESSAELL--VLHTGDG
A0A5C5XLM3      QSLLRRKWTV-----MAWL-TFTVSLGM------TYFALAPRKYESSAELL--VLHTGDG
A0A7V2UW16      GIVLARKWIL-----LGVA-ATVFAAAA------VYTYRLPPVYSAGARLL--IERDTPK
A0A518DRX3      QVLRRRKGYV-----LAML-AGAAVLGA------AYYVAAPRMYEAKASLL--ITQTGPD
A0A518DZF9      QVLRRRKGYV-----LAML-AGAAVLGA------AYYVAAPRMYEAKASLL--ITQTGPD
A0A2E7ENQ5      RIIRHRRIQV-----VSCL-VATALLGA------LYYCTAAPLYSARVSLM--MMYHGGE
A0A7V2XSV8      AVVSGRRWVV-----LGTL-AAVLLATV------VYTYRVMPLYRASSRLL--IEREGPK
A0A847GXG1      RVVWHRRVYL-----ASAL-VVAGLLGG------LYYFTALRIYQATAQLL--ILQAGAE
A0A7C5BZF0      LAIRYRRNLL-----LGAI-AASVAIGI------LYLLFATRYYGATAQVL--VVEADDE
A0A847YGH5      AAVRRRRRVL-----AAAL-LAAALLGA------LYYATAQRIYSAKAELL--ILQTGEN
A0A286RLF2      VAVRRRWQIM-----LGAF-LAVALLGA------LYYATAPRIYSAKAELL--ILQTGDN
A0A7V3TX18      VAVRRRWQIM-----LGAF-LAVALLGA------LYYATAPRIYSAKAELL--ILQTGDN
A0A1G3AQE9      VTVRHRKNVV-----ILAL-AVAAFLGA------LSYMTATRYYSASAGVW--VL-----
A0A3L7UQT9      HAVRVRRGTL-----LAAL-LISASLGA------AYYLTATRMYDAHAQVR--IVQSERN
A0A4P5YBU2      HAVRVRRGTL-----LAAL-LISASLGA------AYYLTATRMYDAHAQVR--IVQSERD
A0A7C7V5U8      LAVRYRKHVL-----LVTL-LVAALLGG------LYYATATRYYAARASLL--VQHSGSD
A0A3M1VCL4      HAVRMRKAIL-----LGTL-LIAAVFGA------LYYLTATRYYASNARLL--VLQTNAS
A0A518AKT8      RTLSYRRYYV-----IASL-VVCCVLGF------AYYLAAPRYYQSTAKLL--INERKAD
A0A5C5ZR72      FFWWVFTMSW-----RTVV-PIGLLLAIPVAA--VIYLTYTPMYEATGLIR--IEDSPQY
A0A7Y5SJZ4      RLIEQHKGFV-----TAAV-VVSCLLGG------LYYATATRLYQSNASVL--VIQTGAD
A0A5C5V7Z9      RLMQRNQSTI-----AWCV-AGCVALAM------AYYVAAPRIYRSTAKLL--LIEQDSD
A0A5C5YT05      RLMQRNQATL-----AWCV-AGCTVIAM------AYYVAAPRFYSSTAKLL--LIEQDPD
A0A518D7F9      RVVQRRQKLV-----ALIV-AGHLAVGA------AYYFTATRYYESTAKLL--VIEQNPD
A0A5C5ZIP0      RLAEQRHQTL-----LWIV-AGCLGIGA------LYYGFAPRYYRSEAKLM--VIQQVAD
A0A518KBK3      RVVQYRRNTV-----LWTL-AGCLAIGA------VYYVTAKRYYRSTAKLL--VVDQSAG
A0A5C6AKF9      RVIRYRQQTV-----LWTL-AACLVVGA------AYYATAPRYYRSTAKLL--VVDQSGG
A0A7C2KUQ9      TLSMMLRHKW--------L-ALGLFVGLAVVLGGGVWWTTVPLYKATAVIE--VSPIIQR
A0A7C5R0U3      ATVRLVRRRW-----P-VL-AAAVVIALLVAI--VQFSTAPRIYESRATVL--VSPRTAD
A0A847YCQ7      DVLHALRRRW-----LWIA-VLGTILPGIAMF--VADRKIPVEYTAAAWLR--VSLQRPK
A0A286RD13      DVLHAVRRRW-----WLIL-IMGVLASAGVMV--FAWRTIPVEYTATAWLQ--VSLERPR
A0A7V3TUJ6      DVLHAVRRRW-----WLIL-IMGVLASAGVMV--FAWRTIPVEYTATAWLQ--VSLERPR
A0A517TY85      LVLKVLRGRW-----PVVI-PLGLVLAAAAAA--IVLLLYVPKYRASALIK--IEAQPTF
A0A5B9QEI7      FVWRVFTGWW-----KWVV-PLGLILAAGAGA--IVLMFYVPKYEASALVK--IEAETPF
                                                                            

A0A5S9IPR9      TQ----------------------------GLPVNQTYYSKRLSTQ--------VAILQS
A0A533Q9U4      VGFQQ-------------------------VISESQFTPLDFYTNQ--------CEIIKS
A0A533Q6B7      VGIQ--------------------------QILSEDKNIYNFYTDQ--------CEIIKS
A0A1U9NNE1      VLFDDA------------------------ETQDVMPNYQGFMNTQ--------AELMSS
A0A2G2JCA2      LAFQDRSDSRK------------------------------FVANQ--------VALMRS
A0A1G2XVR0      GLTFQA--------------------------FSFEGNNSSSFTTN--------ERILRS
A0A1G3B0P0      GLTFQA--------------------------FSFEGNNSSSFTTN--------ERILRS
A0A1E3X4X0      NVTGKDIQEV--------------------VTYDPYATRGEFYKNQ--------HEILKS
A0A286U4B3      VLSFEEV-------------------------MSTEGGRTDFYKTE--------CEVLKS
A0A5C6DDS2      VLSFEDV-------------------------VNTGGGLADFYKTE--------CEVLQS
A0A5S9IJB5      LARDR-------------------------IDLSMFRNMQNYLQTQ--------YDLIVS
A0A2E3GW02      MPIEGIDPL---------------------------SGQTDPLSTH--------IALFNT
A0A5B9QNZ7      LPMMAQNQ----------------------QGAPQQEIGDSLLATH--------MEIIRS
A0A1Z8N7H5      QEDS--------------------------ALGIN-RNSQHLMPTH--------QQLIVS
A0A1U7CZ81      LYGQQ-------------------------NSNAQAQPIERFIGTQ--------IAFITT
A0A142YNY8      LFGSS-------------------------SRGDGSSSIERIIETA--------RAALIS
A0A1U7GLS6      LFGGI-------------------------APGQANERTV-AIETE--------MGRIRT
A0A1G2YPI3      IFAE--------------------------TQEGVMTQSKNYLYTQ--------AELLKS
A0A532UIN2      IFSE--------------------------TETSVMTQSKNYLYTQ--------SELLKS
A0A0S8KNX5      ILTDV-------------------------PDSGEISNYSSFMNTQ--------AEMITS
A0A3D3UVZ8      ILSGE-------------------------QDRGEISNYESFMNTQ--------AEKITS
A0A517NFU9      VTNNGTITG---------------------ANASGDNIQEDQLATH--------LRLFVG
A0A5C5YWH4      VTSSGTLSG---------------------AAASGDSIQDDQLATH--------MRLFVS
A0A3D2TNK4      RVA---------------------------TVGDQ-SIVSNILDTH--------SDLVTS
A0A7C1Y4F0      IINE--------------------------YEGVM-ARSGNYLYTQ--------GELLRS
A0A6I0ENW6      IYKIE-------------------------ETGVM-PLYQQFVNTN--------VMLIRG
A0A6L3A0B7      IYKIE-------------------------ETGVM-PLYQQFVNTN--------VMLIRG
A0A0J1B4A0      VANTGVNN----------------------GAKDMASMQEDVLSTH--------MELFAS
A0A142WSB9      ------------------------------PINSQEARRYSDRSQH--------VHFLTS
M5SZR3          TE----------------------------IKGQN-AFYNDYMSTH--------QALIKS
M5TW92          TE----------------------------IKGQN-AFYNDYMSTH--------QALIKS
A0A2S8FKY2      LAFKTIEQTNRNDYRTFKNTQRQLMVTPFVLNSA--LSREDIMSLDIVREEENPLEWLQE
A0A517N8P6      ------------------------------PTNTG-SASEIVVETA------PNLAFIQA
A0A432MJP4      PLKVTEA-----------------------DAGGG-EGGVDRFPTY--------AAILSS
M5UQ35          LNRASSSSL---------------------LEGAT-TIEDVILSTH--------MELFRS
A0A0S8FY64      VSPFEDMQ--------------------------E-RRDKEYFATQ--------VSLITS
A0A1N6KFT7      PLNVSAYT---------------------DPNRIS-EGSEDPVPTH--------MVLIRS
L0DFG4          PLNVTAYT---------------------DPNRIN-EGSEDPVPTH--------MVLIRS
A0A5C5XXG1      QGCKRSTCQSKRFHVDDKSYRPVRLAKPVEPRQVL-TPPPPGRRDK--------LAAVKG
A0A7C7YUM8      GGVLSEIA--------------------------S-LTSDPAAEAE--------IALIQS
A0A7C2AHI6      SGLLANLS--------------------------L-LESTPAAARE--------MALLSS
A0A518BJJ1      GGVLGELA--------------------------A-LSSAPAAASE--------IALLRS
A0A518D182      SATLSELS--------------------------L-FGSAPRASAE--------IALLSS
A0A7V4HWU2      LPVQ--------------------------GVDSQ-RAADDSFSMH--------SVLLKS
A0A5C5WTY6      VGDS--------------------------DTSND-VVDEDVLANH--------VELIRS
A0A5C5Y033      LNNS--------------------------GTGTD-VVDEDVLANH--------MGLIRS
A0A5C6G1Y2      LNNS--------------------------GTGTD-VVDEDVLANH--------MGLIRS
A0A354PDV6      L--E--------------------------SNATN-VVEEDILANH--------MQMLRS
A0A5C6FZ02      L-AS--------------------------SSSNE-MVEEDILANH--------IELLLS
M5TIT3          LEGD--------------------------STGQA-IVDEDILANH--------IELIQS
A0A5M6CY44      LGGT--------------------------GTGTG-MVEEDTLANH--------IELISS
F2AXG2          LGGD--------------------------STGTD-MVDEDILANH--------MELLLS
M2BB46          LGGD--------------------------STGAD-MVDEDILANH--------MELLLS
L7CLQ6          LGGD--------------------------TTGTD-MVDEDILANH--------MELIQS
A0A0J1B719      LGGN--------------------------STGTD-MVDEDILANH--------MELIQS
Q7UF18          LGGN--------------------------STGTD-MVDEDILANH--------MELIQS
A0A2G1W1E0      LGGN--------------------------STGTD-MVDEDILANH--------MELIQS
K5E235          LGGN--------------------------STGTD-MVDEDILANH--------MELIQS
A0A5C6FFI9      LTTSGTMS---------------------NSQASGDTIQEDLLATH--------VQLLTS
A0A5C5WDJ1      MTSRGTIN---------------------GNSGSGESIRDDQLATH--------MRLFIA
A0A5C5X547      LI----------------------------FNTAD-QVQTSAITYK--------LFQSTQ
A0A353FIP5      ---EG-------------------------SAVGG-ILGDLSMLSS-APPATAELEVLQS
A0A7V7MJI7      ---EN-------------------------TMSGG-ILGELSMLTQ-APPAEAEMEVIHS
A0A5B1CIK7      LG-SE-------------------------GNATN-VVDEDILANH--------IELLQS
A0A5C5WHS2      LG-AG-------------------------SAATD-IIDEDILANH--------MELLQS
A0A5C6B6G8      LGEGS-------------------------ATGQG-MVEEDTLANH--------MELIAS
A0A5C5ZZN3      LG-GD-------------------------STGQS-IVDEDILANH--------IELIQS
A0A5C5XS91      LD-SD-------------------------GTGQE-MVEEDILANH--------IQLIKS
A0A5C6C4E6      LD-KD-------------------------GTGQE-MVEEDILANH--------IQLIKS
A0A2E1VVJ1      ---SG-------------------------GFQSG-FLSEVAVLSPVQPPESKEAEILGS
A0A3M2AEL0      ---PE-------------------------GSEQS-LLREFTLFEQ-SPATLAEMEVLGS
A0A2A2W9R6      MASTGVRG---------------------TSDGAV-TMQDEILSTH--------IELFGS
A0A518HKC1      MASTGVRG---------------------TSDGAV-TMQDEVLSTH--------IELFSS
A0A518L3P0      MASTGVRS---------------------TSDGAV-TMQDEILSTH--------IELFGS
A0A255R1S0      LATTGVRE---------------------ASDNAV-TIQDKILSTH--------IALMTS
A0A5B9MKP1      VAATGVRD---------------------ASDGAV-TMQEEILSTH--------VELFGS
A0A351FYP6      IAPLLGMQAT--------------------QSSFDPY----FISTE--------FEKIQS
A0A0S8J591      VIEAGARRMA--------------------TEE--------FYNSQ--------VENLRS
A0A532UT69      IITETEQG-----------------------VLTQSKN---YLYNQ--------AALLKS
A0A7V9G2R2      LNPRLQSENY--------------------SAGNYEFD---FLNTQ--------RDIMLS
A0A2D5AWU0      NGNAG--------------------------STGKART---LLKQQ--------QILVKS
L0DC26          ILLQTGE------------------------VQSDYGS---YQRTQ--------LALLES
M5RT57          IAYTTPE------------------------PQMNPED---FTETQ--------IELIRS
D5SZ21          LDGAP--------------------------EGAAMKD---LMPTY--------ERIMQG
A0A7X7U1J4      VFERDTSG-----------------------MITRWDN---YIYTQ--------AERLQS
A0A7V8E5N8      VATVHDQAQY--------------------VDTYLWES---YYRTQ--------QNILSS
A0A356KTN1      RARYEMYS-----------------------SDYVATE---YLNTQ--------MRILES
A0A7Y5LV28      LQGTDDPTLG--------------------ASGSMWEN---YYRTQ--------ENILTS
A0A7Y5HFQ5      ATLQTLFD-----------------------QEYVSSQ---NFETQ--------LALLKS
A0A7W1FMQ9      VEFQVDRD-----------------------SGVVQDS---LINTY--------RELLLA
A0A7W1NA62      VPFQVDGE-----------------------IGTIDFS---LLNTQ--------RELLLS
A0A7V9JTP9      VDFERDPD-----------------------AARVEYS---LLNTQ--------RDFLLS
A0A7W1FJ38      VDFQYDPS-----------------------SNSVEFG---FLNTH--------RDMLTA
A0A1G2YQB7      ILFGGEEA-----------------------IPMYR-S---YMYTQ--------ADLIIS
A0A353P687      ILFGGEEG-----------------------IPMYR-N---YMYTQ--------ADLITS
A0A356EME5      LVFAIEDK-----------------------S-----SG--YVETQ--------KEMIRS
A0A3L7P4E4      MPVNTVNG-----------------------LAPNGRSD--PLASD--------IQTIMS
A0A3L7PEB5      MPVNSVNG-----------------------FDPSGQSD--PLASD--------VRLILS
A0A1U9NL64      I-LDETQG-----------------------VMTQSKN---YLYTQ--------AELMKS
A0A2N1UCJ3      L-IADYEG-----------------------TMTQSKN---YLYTQ--------SEIIKS
A0A7V2H881      V-VQQDFP-----------------------GTISSGSR--WLDTQ--------CDIIRS
A0A7C4EK84      I-LSDSPW-----------------------DRTSF-N---YLNTQ--------AELMRS
A0A7C3F0T2      I-IPGTEE-----------------------LTFGPWN---YLNTQ--------CALFKS
A0A7X7U4K9      V-LRLDSV-----------------------APQRY-N----LYTQ--------AALLSS
A0A2E0X4J3      I-IDSGMG-----------------------LSQSK-G---FLYTQ--------AEMLRS
A0A838QZ11      L-LDAELQ-----------------------VGQSA-T---YLYTQ--------AELIRS
A0A5C5YU10      L-LSSDMQ-----------------------LGHSN-S---YLFTQ--------KELIKS
A0A517MPZ6      I-FASDAQ-----------------------RGTSS-S---YLYTQ--------AELITS
A0A5C6CNV7      I-LEQEVQ-----------------------LGNSA-S---YLYTQ--------AELIRS
A0A518K5H4      V-LAGESL-----------------------GAFST-K---HLYTQ--------AQLICS
A0A5C6AA28      A-LNGDAL-----------------------GTFSN-K---YLFTQ--------AELIRS
A0A2E7ESJ6      TIPLTGVESQ--------------------YITTS------AEAKH--------AIVIVS
A0A2E9VK20      EIREEGNRII--------------------AG---------ERSAH--------VEIIRS
A0A3D4PJK1      EIREEGNRII--------------------AG---------ERSAH--------VEIIRS
A0A355AI52      NNPTSMTGSH--------------------NDVA-------AMATY--------EKLVSS
A0A354PCQ3      VVKN-------------------------------------LAQTE--------KALFLN
A0A0S8GZ23      LLTGAHESGG--------------------ISNYDI-----YVNTQ--------AQIIRD
A0A1I3DDV4      ASDKGESSWA--------------------ADGVQDE----ILANH--------MEIVSS
A0A7V2UF66      ILSEGEGVLT--------------------RGYN-------YVQTQ--------SELLKS
A0A2E0SMM6      DTDDVSGQAL--------------------LKN--------QMPTY--------TRLLSS
A0A3L7SI46      VLDTTNQSNQ--------------------RSIQD------IMPTY--------QKVLTS
A0A5B9PJZ8      SISEEDGYAQ--------------------D----------TVEKY--------IEILRS
A0A2S8G191      LLKQDGEKTG--------------------DFDV-------YKLTH--------RQLLRG
A0A2E7EGG1      VAFPDREVRD--------------------RDSNRK-----FVHTQ--------VELLRS
A0A2E2N5A9      LLAIEQANQN--------------------ETLNND-----FLQTE--------IELLKS
A0A7C8AGA2      ILFETEDRLP--------------------NYQN-------FMNTQ--------AELIRS
A0A7C2FXP7      IMSGEHDRGE--------------------ISNYHS-----FMNTQ--------AVMITS
A0A1P8WP26      VTQDSVQGAS--------------------DPSR-------SMPTF--------RRLMAD
A0A3L7V1F3      VTEETPNSGS--------------------SANS-------DMPTF--------IELMSR
A0A2E3GWC6      PLGDDDNRPT--------------------AG---------ERSAH--------VEIIRS
F0SLB0          PLGDDDNRPT--------------------AG---------ERSAH--------VEIIRS
A0A3L7NDH9      SLDTSLTGGR--------------------NDPT-------AMATY--------EKLIAS
A0A7X8IIB9      IMYETTPHGG--------------------IGAYQT-----FKNTQ--------AGVMTS
A0A532UD06      IINEYEGVMT--------------------QSHN-------YLYTQ--------SELIRS
A0A660URN1      IITEYKGVMT--------------------QSKN-------YLYTQ--------GELIKS
A0A517ZCB5      VLDSERNPQG--------------------TLSD-------QMPNF--------ERVLRS
A0A225EH48      GKQSMGEDFE--------------------S----------FKQTQ--------MRLLKT
A0A518INW8      LMTSSGPDGR--------------------SFDANVVQAD-LLATH--------IALLES
A0A518JPH9      LMTSNSPNGR--------------------SFDASVVRAD-LLATH--------IALLKS
A0A5C5VEK8      LLGAEYQVGR--------------------SNS--------YLFTQ--------AELIRS
A0A532UTJ0      IMTDEGDHGG--------------------ISNYES-----FMNTQ--------AEKVTS
A0A2E2CCW9      PIKEGEIQTF--------------------G----------ELTAH--------IDVIKS
A0A3C0AGX3      PIKEGEIQTF--------------------G----------ELTAH--------IDVIKS
A0A518AAQ5      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A517QBG9      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A518FTU3      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A517WHH5      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A5A8BGT3      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A2E7K7A9      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A517PTS5      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A6I6AH34      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A517VTK3      PIKEGEIQTF--------------------G----------ELTAH--------IDVIKS
A0A517WQT4      PIKEGEIQTF--------------------G----------ELTAH--------IDVIKS
A0A517VID8      PIKEGEIQTF--------------------G----------ELTAH--------IDVIKS
A0A517RK10      PIKEGEVQTF--------------------G----------ELTAH--------IDVIKS
A0A518IH18      PIKEGEAQTF--------------------G----------ELTAH--------IDVIKS
A0A7W0M4Y4      MLNEQSQRDN--------------------ALAD-------AIETQ--------CQIVMS
A0A2D5NDU9      KAGPEVMALG--------------------FGATN------YAQTQ--------AEVIVS
A0A5C5XLF4      EIREGGNRVI--------------------VG---------ERSAH--------VEIIRS
A0A518CHE5      QTDDVSGQSL--------------------LKN--------QMPTY--------TRLLSS
A0A1V5N3W2      ILFSDKDSEG--------------------VIPMYES----FMNTQ--------ADIIVS
A0A517NSK8      MVNGASSNTS--------------------VEGANTDGD--VLSTH--------IQLMTS
A0A5C5Z0D6      LVKGATSDSS--------------------VEGAEAAED--VLSTH--------IELMTS
A0A7W5H7D9      LVKGASSGSS--------------------VEGVDTEED--VLSTH--------IQLMTS
M5UE94          LVRGANSSSS--------------------VEGVDTKED--VLSTH--------IQLFSS
A0A3E0MY27      IDAQSRSDGR--------------------RIDD-------PLQTH--------IQLIKS
A0A7V4M591      QLNTSMTGEE--------------------SLRRN------TMPTF--------ENMIRS
A0A7X7F3G7      NLETSMTDSI--------------------SSQRN------LMKTF--------ETVLRS
A0A7Y4VQ32      LLYKTEDNGL--------------------LPLYTS-----FLSTQ--------IQIVRS
A0A2E0X9P6      VAFEQPSTVR--------------------DEAR-------YFNTQ--------IELLRG
A0A1N6DAJ8      ILLKVGENES--------------------DYVA-------YQRTQ--------LALLKS
A0A2E8FLY0      VLKTEQENQG--------------------GVQE-------NMATN--------QGVLTS
A0A3D2U1E1      VLQESMESQG--------------------GVRE-------NMANY--------QGVLTS
E8R3W3          IVFNNGVSMG--------------------DAHA-------YMRTQ--------SQLLRS
A0A5C5ZM48      VVFKDEETAL--------------------DAKR-------FVETQ--------VELIRS
A0A5B9WF77      PFSAFSNPAL--------------------SGQAPT-----YLKTQ--------LVSVTS
A0A7C4Z5R7      GVLTESTPAS--------------------DIAA-------FQRTT--------LASIKT
A0A1P8WN28      PKSQSNSATE--------------------G----------LLASY--------RQLLLS
A0A3B9CTT0      -MANFGAPLE--------------------A----------AMAGY--------KHLMLS
A0A518ALT3      IAFDSNNSNS--------------------RDSDR------YVQTQ--------IETMKS
A0A286RGB6      VLFPTQQGAG--------------------PSFDI------YKATQ--------LEYLRS
A0A7V3TZQ6      VLFPTQQGAG--------------------PSFDI------YKATQ--------LEYLRS
A0A3M1QRP3      IAFKTDNDGI--------------------THFYQQ-----FLTTQ--------IHKITS
A0A517TMV0      DLASISEQSG--------------------TDS--------LMATQ--------REVVRS
A0A3E0MY88      EGSSSMGIDG--------------------ENRR-------YMPTH--------EQLLKS
A0A518BBX8      LMTDRAGLPV--------------------SHFED------YVETH--------QVLIES
A0A5B9QF68      QLATVGDHES--------------------SED--------TMATH--------QKLIAS
A0A5B9QGF0      HLATVGDHES--------------------SED--------TMATN--------RKLISS
A0A5C6CK24      HLATVGDHES--------------------SED--------TMATN--------QKLIAS
A0A7C5FXU1      ILFSNAFQSA--------------------TFDI-------YRSTQ--------QQYLVS
A0A847YFA1      VLFESSGDAR--------------------NFEV-------YKSTQ--------LEYLRS
A0A1C3E6N1      VLDG-APEGA--------------------AMKD-------LMPTY--------ERIMQG
A0A518GJT2      VLDGAAPEGA--------------------AMKD-------LMPTY--------ERIMQG
A0A2E8B0L9      ILNSTMMPNA--------------------QQDA-------LIPTY--------ERLFSS
A0A5Q4GFE7      ILSPTLTAES--------------------SRQA-------LIPTY--------ERLFTT
A0A257WS34      ALDGKDNNQQ--------------------SIQN-------LMPTY--------QKVLLS
A0A7C4LP10      VLDQRDATPK--------------------TIQD-------QMPTY--------QRLMLS
A0A2E3RCU8      DHGNVLGVNR--------------------NDQQ-------LMPTH--------QQLIVS
A0A517MLW3      VFPGASPTAQ--------------------SN---------KLPTQ--------EKIIRS
A0A5B9QVD0      MLPGSGVMAQ--------------------PN---------KLPTQ--------EKILRS
A0A3A0DET7      VLESEAPVVQ--------------------SAT--------YLYTQ--------AELIRS
A0A3B8PNV4      VLQNDQENQG--------------------GVQE-------NMATN--------QGVLTS
A0A3D1DR40      VLQNDQENQG--------------------GVQE-------NMATN--------QGVLTS
A0A2E7RYU8      VLQNDQENQG--------------------GVQE-------NMATN--------QGVLTS
A0A3B8LXG8      VLQNDQENQG--------------------GVQE-------NMATN--------QGVLTS
A0A6M5Z0K7      VIQEGSRSND--------------------GGI--------YMRTQ--------LALIKS
A0A350CI62      VTSDATSNSA--------------------NPVT-------EMPTY--------IALMSE
A0A4P5WQK6      VTSDATSNSA--------------------NPVT-------EMPTY--------IALMSE
A0A3C1X4W5      VTADATSTSA--------------------NPVT-------EMPTY--------IALMSE
A0A3D3W3A7      VTADATSTSA--------------------NPVT-------EMPTY--------IALMSE
A0A7Y5SKC2      TWSAESTQRS--------------------LEKT-------VLPTY--------EGLIVS
A0A7X7U104      IFRDSDEGML--------------------SRSTN------YLYTQ--------AELLES
F0SI78          MPIEGIDPLS--------------------GQTD-------PLSTH--------IALFNT
A0A517MDV3      LPQMSDSQTG--------------------AAPQQEVGDA-LLATH--------MEIIRS
A0A518IQ30      MLNAGVSSSV--------------------TNDT-------LVATH--------ERLIES
A0A517LWP4      MLNAGVSSNL--------------------NNDA-------LVATH--------ERLIES
A0A518JNW8      MLNAGVSSNL--------------------NNDA-------LVATH--------ERLIES
A0A2E3GWX1      NMDETQQSQR--------------------TLQD-------HLPTY--------TKVLSS
F0SG60          NMDETQQSQR--------------------TLQD-------HLPTY--------TKVLSS
A0A2E9VST2      NVDQTQQSQR--------------------TLQD-------YLPTY--------TKVLAS
A0A356A6X2      NVDQTQQSQR--------------------TLQD-------YLPTY--------TKVLAS
A0A5C5XLM3      NVDQTQQSQR--------------------TLQD-------YLPTY--------TKVLAS
A0A7V2UW16      VLDVEEILAA--------------------TDGWEND----YYNTQ--------VQLIAS
A0A518DRX3      VMSGS--TPA--------------------ASGGDS-----LIPTY--------EKLFTS
A0A518DZF9      VMSSG--TAS--------------------AASGDS-----LIPTY--------EKLFTS
A0A2E7ENQ5      DS-----LTG--------------------SDTYRRG----MLPTY--------ERLFYS
A0A7V2XSV8      LLDVQEVFQV--------------------TEGWQNE----YYQTQ--------CKLLES
A0A847GXG1      MLSPA--MGG--------------------AANREA-----LIPTY--------ERLFGS
A0A7C5BZF0      RGTPN--FAS--------------------EDRWQRT----LMPTH--------RSILCS
A0A847YGH5      SLSPT--IEV--------------------QSNRDDS----LMPTF--------VNLISS
A0A286RLF2      ALSPT--IEA--------------------QGSRENS----LIPTF--------VNLITS
A0A7V3TX18      ALSPT--IEA--------------------QGTRENS----LIPTF--------VNLITS
A0A1G3AQE9      --ELG--SSS--------------------AGSVEDNLHQTQLPTQ--------VDIVRS
A0A3L7UQT9      HDSLT--SSP--------------------QSSQANSDVFQMMATY--------QRIMSG
A0A4P5YBU2      HNSLT--SSP--------------------QSSQANSDVFQMMATY--------QRIMSG
A0A7C7V5U8      ITETS--LRP--------------------EGNRNQG----LMPTF--------EKLVTE
A0A3M1VCL4      VLQEQQSTPR--------------------AVL------D-QLPTL--------QEVVVS
A0A518AKT8      ELTSVGDQIA--------------------NDD--------LMANQ--------RDLVTS
A0A5C5ZR72      VAFRSGSVDA--------------------GGR------K-FIQTQ--------IELMRN
A0A7Y5SJZ4      SLSMATGGAG--------------------VIK------D-MIPTY--------RSLLRS
A0A5C5V7Z9      KVSGVADAGR--------------------A-D------D-VMATH--------RELVKS
A0A5C5YT05      SVSSVAEGGR--------------------A-D------D-LMATH--------RELVKS
A0A518D7F9      QLSSMGDQAG--------------------S-D------N-VTANH--------QQIVRS
A0A5C5ZIP0      ELSSMSDQIG--------------------S-D------N-LMTTH--------KDLVRS
A0A518KBK3      ELTTMNDQAG--------------------A-D------N-LMATH--------RELVKS
A0A5C6AKF9      EMVSLNEQAG--------------------A-D------N-LMATH--------RELVKS
A0A7C2KUQ9      ILYR----TD--------------------DNGPIQWYTE-YLNMQ--------TAIIRS
A0A7C5R0U3      ASEQGGRSLR--------------------LAD--------VMPTY--------VKLFGS
A0A847YCQ7      VVFE----TR--------------------DDDPL---LR-QRQTQ--------ATLITS
A0A286RD13      VLFD----TK--------------------DDDPL---LR-NRQTQ--------TTLVTS
A0A7V3TUJ6      VLFD----TK--------------------DDDPL---LR-NRQTQ--------TTLVTS
A0A517TY85      IAFAQDKVSA--------------------TDD------R-YVQTQ--------IELLRG
A0A5B9QEI7      IAFQQGALNK--------------------DSE------R-YVQTQ--------IELLRG
                                                                            

A0A5S9IPR9      RAMA-----------KKVIERLPEAICLSFFG----------------------------
A0A533Q9U4      RSIA-----------KKVIDTLNLKNDPVFNPPEKDEYP-------------------ES
A0A533Q6B7      RLIA-----------KKVIDILDLKNHPGFNPYKGIENPALAAD----------------
A0A1U9NNE1      NEIL-----------NRVAEDMAKRGIRICEPDM--------------------------
A0A2G2JCA2      HIVL-----------GSVVSNKDVSSTPELKNSV--------------------------
A0A1G2XVR0      RSLA-----------QKVLSTMDYKDSPEFNPVKKANIFSIKELTRGNSSPTVRKPEPGK
A0A1G3B0P0      RSLA-----------QKVLSTMDYKDSPEFNPVKKANIFSIKELTRGNSSPTVRKPEPGK
A0A1E3X4X0      RSLA-----------KRVIEELKLGNGPEL---------------------------PSG
A0A286U4B3      LTLA-----------KRVVDSLRLDLDPEF---------------------------IGN
A0A5C6DDS2      RTLA-----------KRVINRLRLDLHPEF---------------------------IAK
A0A5S9IJB5      TPLL-----------QKTFDHFNFAEKEKFRNVP--------------------------
A0A2E3GW02      PVIL-----------KKAVE-----------------------------------D----
A0A5B9QNZ7      PRVI-----------GDAVD-----------------------------------N----
A0A1Z8N7H5      QPVL-----------ENAIQY-----------------------------ISPECL----
A0A1U7CZ81      NTVL-----------KPAIG-----------------------------------D----
A0A142YNY8      DRVL-----------NGAII-----------------------------------D----
A0A1U7GLS6      DRVI-----------NDALG-----------------------------------D----
A0A1G2YPI3      TPIL-----------TAVLD-----------------------------------T----
A0A532UIN2      TPIV-----------AAVLDV---------------------------------------
A0A0S8KNX5      SRVV-----------RRVADDLADRNLPFLEDEPTDPISKLKRKIDGTQDKRTPEE----
A0A3D3UVZ8      NSVV-----------QRVADDLVGKNLFFFEAEPNDLVSNWKRKILGTKKIDPAMK----
A0A517NFU9      RRML-----------AEAIQ-----------------------------------K----
A0A5C5YWH4      RRLL-----------SDAIK-----------------------------------D----
A0A3D2TNK4      PVVI-----------EQAIEY-----------------------------LAPEHR----
A0A7C1Y4F0      TPVI-----------GPVVDD---------------------------------------
A0A6I0ENW6      AGVL-----------NPVLND-------------------------PEVLKTSWYR----
A0A6L3A0B7      AGVL-----------NPVLND-------------------------PEVLKTSWYR----
A0A0J1B4A0      PKIL-----------ENAIQI-------------------------------AGLN----
A0A142WSB9      DAIA-----------AIAIE-----------------------------------K----
M5SZR3          SVII-----------SRASQL---------------------------------------
M5TW92          SVII-----------SRASQL---------------------------------------
A0A2S8FKY2      ELIV--------------------------------------------------------
A0A517N8P6      EMTS-----------QDVLSD----------------------------------A----
A0A432MJP4      PHIV-----------GRAIE-----------------------------------Q----
M5UQ35          RKVI-----------ERAISV---------------------------------------
A0A0S8FY64      RAVL-----------DKALED---------------------------------------
A0A1N6KFT7      PLVI-----------QAAVDS---------------------------------------
L0DFG4          PLVI-----------QTAVES---------------------------------------
A0A5C5XXG1      RSVY-----------SL--------PPLGPDLSYHFAVSPSIYGTLAILASSTGLL----
A0A7C7YUM8      RSLA-----------EVTVGPQAPWPADIALFDATAPDFDPVASGDTTSMEGMGLE----
A0A7C2AHI6      RSLI-----------ETTAGS----PASPRSTDGVFEVTPPDSMLQGDSMRRLGLE----
A0A518BJJ1      RSLA-----------EKTIQS----PP-----DGSIPTPENP-----HAQRNQGLT----
A0A518D182      RALA-----------EQVVAT----PA-----D----VLDAD-----ERARHLGLE----
A0A7V4HWU2      PTVI-----------SRAVE-----------------------------------K----
A0A5C5WTY6      RRTI-----------ESALN-----------------------------------Q----
A0A5C5Y033      RKIV-----------SEALA-----------------------------------E----
A0A5C6G1Y2      RKIV-----------SEALA-----------------------------------E----
A0A354PDV6      RKIV-----------EGALT-----------------------------------K----
A0A5C6FZ02      RKIV-----------GEAMAA---------------------KDDD---------G----
M5TIT3          RMIV-----------GEALE-----------------------------------Q----
A0A5M6CY44      RMIV-----------DEALK-----------------------------------T----
F2AXG2          RKIV-----------GEALDP---------------------EDVKDEETGELIKR----
M2BB46          RKIV-----------GEALDP---------------------EPVKDEETDELIKR----
L7CLQ6          RMIV-----------GEALE-----------------------------------Q----
A0A0J1B719      RMIV-----------GEALE-----------------------------------Q----
Q7UF18          RMIV-----------GEALE-----------------------------------Q----
A0A2G1W1E0      RMIV-----------GEALE-----------------------------------Q----
K5E235          RMIV-----------GEALE-----------------------------------Q----
A0A5C6FFI9      RLLI-----------SDAIAT---------------------E-----------------
A0A5C5WDJ1      RKVL------------------------------------------TQ-------A----
A0A5C5X547      AQLI-----------RSDLNI---------------------SQVLEL-------D----
A0A353FIP5      RMIVDPVV-------APQSES---------------------SLGLNL-------T----
A0A7V7MJI7      REIARQVARPPGQVAEGA--P---------------------DFGMGL-------S----
A0A5B1CIK7      RLIV-----------GEALEA---------------------N-----------------
A0A5C5WHS2      RLIV-----------GEALES---------------------N-----------------
A0A5C6B6G8      RMIV-----------GDALQE---------------------TQVPGQ-------D----
A0A5C5ZZN3      RMIV-----------GEALEQ---------------------N-----------------
A0A5C5XS91      RMIV-----------GEALEQ---------------------N-----------------
A0A5C6C4E6      RMII-----------GEALQQ---------------------N-----------------
A0A2E1VVJ1      RKLVRMVAAHPLSTDGPEFAQ---------------------GLGIGL-------S----
A0A3M2AEL0      RAVAQAVA---LPKGESDLAP---------------------EVGLGL-------S----
A0A2A2W9R6      PKVL-----------QQAIDR---------------------A---KL-------N----
A0A518HKC1      PKVL-----------QQAIDR---------------------A---NL-------N----
A0A518L3P0      PKVL-----------QQAIDR---------------------A---KL-------N----
A0A255R1S0      PKVL-----------GQAADE---------------------H---DL-------G----
A0A5B9MKP1      PKIL-----------KQAIER---------------------E---SL-------G----
A0A351FYP6      QKVL-----------DEVVKSCELREKWKKHYGGKQLTDV--------------------
A0A0S8J591      RRIA-----------RKLYNDMGMYNWEYFRKLGPDR-----------------------
A0A532UT69      TPIL-----------TAVLNDHNARQMQT------F----T-------------------
A0A7V9G2R2      RGVL-----------ESAVKGSGLMQSPD------Y----Q-------------------
A0A2D5AWU0      PAIL-----------KPLSESKALRGLKS--FSREI----I-------------------
L0DC26          RLVL-----------SAALKQASVAKLPI------L----T-------------------
M5RT57          SLVA-----------EQVLDDSEIAELPG------L----Q-------------------
D5SZ21          DIVL-----------ADAAQKLPVKYRTD----FRG----V-------------------
A0A7X7U1J4      TEII-----------SAALNAPGMADLRT------L----A-------------------
A0A7V8E5N8      PGLA-----------EATIKALPPGLKAR------Y----E-------------------
A0A356KTN1      HSLA-----------VDAVKANPKIARELELELGRE----A-------------------
A0A7Y5LV28      PSLV-----------EETLKSLPEPLRRD------Y----E-------------------
A0A7Y5HFQ5      RSVL-----------QAAYQEVPEAKRVM------S----A-------------------
A0A7W1FMQ9      RDVL-----------EQTIPLAGLLSNPA------Y----A-------------------
A0A7W1NA62      GPVL-----------DRALQSSPLKDGPA------Y----A-------------------
A0A7V9JTP9      NAVL-----------EQALKHSELRSGPA------Y----Q-------------------
A0A7W1FJ38      GPVL-----------EQTLSTTDLLQTPA------Y----A-------------------
A0A1G2YQB7      DRVL-----------QRVVDDLSDKNI-I------ASDIEK------PDPLKSVRNKWSA
A0A353P687      DRVL-----------QRVVDDLSDKNIKL------MEEAKS------RDPVTAVRNKFSK
A0A356EME5      ARVL-----------RPVVESPEIRSLPE------L----Q-------------------
A0A3L7P4E4      ELTV-----------RPAISDGRLRELPS------L----S-------------------
A0A3L7PEB5      EVTV-----------GPAITDGRLKELPS------L----S-------------------
A0A1U9NL64      TPII-----------KEAIEENDMASMRT------F----D-------------------
A0A2N1UCJ3      TPII-----------AKVVQRSDIKRLRT------FEAKPESIAEKIKKQIGLAEPSFTT
A0A7V2H881      PAII-----------GKVASDPAITRLKT------FSLYPK-------------------
A0A7C4EK84      TPIL-----------AGALELA-AQKLPS------L----A-------------------
A0A7C3F0T2      TPIA-----------ASALDRPGIRDLRT------F----A-------------------
A0A7X7U4K9      TGIL-----------TRALERVDVAHLKT------F----A-------------------
A0A2E0X4J3      TPVL-----------AAALEAPGMAQLQA------V----R-------------------
A0A838QZ11      SPVL-----------AAAVDAAGNASLET------F----R-------------------
A0A5C5YU10      TGVL-----------ASVADSPMASGMET------F----R-------------------
A0A517MPZ6      TPVL-----------AAAANAPESSQLET------F----R-------------------
A0A5C6CNV7      TPVL-----------AAAAEQGENASLET------F----R-------------------
A0A518K5H4      PSVL-----------NAAIEAPENVGIET------F----R-------------------
A0A5C6AA28      SSVL-----------SAAVEAPENAALET------F----R-------------------
A0A2E7ESJ6      PRIL-----------TQAFDNFNLFRLPTFKDDP--------------------------
A0A2E9VK20      PKVV-----------ERAVRDSQLDQLATLAGSE--------------------------
A0A3D4PJK1      PKVV-----------ERAVRDSQLDQLATLAGSE--------------------------
A0A355AI52      PLVL-----------QSASTLLEAPVRELFGSQDSE------------------------
A0A354PCQ3      PIVL-----------GPVLADADLRRAPSLSDPE--------------------------
A0A0S8GZ23      NRVL-----------QNVAD--------VLDDNNTLLGTGI-------------------
A0A1I3DDV4      RRII-----------GNALQRVNAEEMPGIKAHTDSKT----------------------
A0A7V2UF66      TSIL-----------ADAAEKLRPARLRTLGQGT--------------------------
A0A2E0SMM6      DHVL-----------QSAAM--------QLPPEHQ-IDI-------------------GG
A0A3L7SI46      DRVL-----------EGAIT--------RLPNAHR-IDL-------------------KG
A0A5B9PJZ8      TATL-----------KNAIRDGKFEQMETFEDVD--------------------------
A0A2S8G191      PFVI-----------NAALRDPEVAKLPVIKEKV--------------------------
A0A2E7EGG1      PLIL-----------GRVLSQPEITAMPEIRSRR--------------------------
A0A2E2N5A9      RGLA-----------ERVVRQLDLVNHPEFAAQPLSVGQGVGTWFARLGAFVRTKQPDQA
A0A7C8AGA2      NNIL-----------NDVADTLKESELTLFEDSV--------------------------
A0A7C2FXP7      GKVV-----------ERVADDLSTKDLKFFAEASM-SII-------------------DK
A0A1P8WP26      DEVM-----------RRALE--------RLPERFK-QHF-------------------SE
A0A3L7V1F3      DEVI-----------VRALK--------TLPKNAR-VDL-------------------VG
A0A2E3GWC6      PRVI-----------ERAVHESHLDKLPTLAGSE--------------------------
F0SLB0          PRVI-----------ERAVHESHLDKLPTLAGSE--------------------------
A0A3L7NDH9      PLVL-----------ESAAK---------LLDGPTRVAL-------------------GS
A0A7X8IIB9      DEVL-----------NRVADAIKDKNLIFFEPGQ--------------------------
A0A532UD06      IPII-----------SDAVNDTRIGHLETFAGID--------------------------
A0A660URN1      TPIV-----------ANVADDSEIGRFKTFEQID--------------------------
A0A517ZCB5      DEVV-----------KRTLK--------QLPPEHR-SDF-------------------RG
A0A225EH48      RMLL-----------DRVVSNPNVSRLPDIKGTD--------------------------
A0A518INW8      PMIL-----------NDAIESGKLSDLDSFVAARREGI----------------------
A0A518JPH9      PMIL-----------NDAIEVGNLSDLDSFVAARREGN----------------------
A0A5C5VEK8      TGVL-----------AAVAESPEAASMETFRGVE--------------------------
A0A532UTJ0      SSVV-----------QRVANALVDKNLSFFDTEPA-GLL-------------------TK
A0A2E2CCW9      PRIV-----------GEAVKEARLNQLPSLAGEK--------------------------
A0A3C0AGX3      PRIV-----------GEAVKEARLNQLPSLAGEK--------------------------
A0A518AAQ5      PRIV-----------GQAVKAAHLTELPTLEGEK--------------------------
A0A517QBG9      PRIV-----------GQAVKAAHLTELPTLEGEK--------------------------
A0A518FTU3      PRIV-----------GQAVKAAHLTELPTLEGEK--------------------------
A0A517WHH5      PRIV-----------GQAVKAGKLTELPSLEGEK--------------------------
A0A5A8BGT3      PRIV-----------GQAVKAGKLTELPSLEGEK--------------------------
A0A2E7K7A9      PRIV-----------GQAVKAGKLTELPSLEGEK--------------------------
A0A517PTS5      PRIV-----------GQAVKAGKLTELPSLEGEK--------------------------
A0A6I6AH34      PRIV-----------GQAVKAGKLTELPSLEGEK--------------------------
A0A517VTK3      PRIV-----------GEAVKEAKLYNLPSLAGET--------------------------
A0A517WQT4      PRIV-----------GEAVKEAKLYNLPSLAGET--------------------------
A0A517VID8      PRIV-----------GEAVKEAKLNQLSSLAGEK--------------------------
A0A517RK10      PRIV-----------GEAVKEAKLNELPSLAGEK--------------------------
A0A518IH18      PRIV-----------GEAVKEAKLNELPSLAGEK--------------------------
A0A7W0M4Y4      LEVI-----------RNAVESYNLSSRPEFGSRD--------------------------
A0A2D5NDU9      GEIL-----------RSALT--------RFHEEFPDSEI-------------------NK
A0A5C5XLF4      PKVV-----------ERAVRDSHLDQLATLAGST--------------------------
A0A518CHE5      DRVL-----------ETAAS--------HLPPEHQ-VDV-------------------SG
A0A1V5N3W2      DQVI-----------QRVADELADKKLALFEDPDPIARY-------------------LT
A0A517NSK8      RRIL-----------KKAIADHELTDIASVSNAI--DEG-------------------K-
A0A5C5Z0D6      RRIL-----------QTAIDKHGLEDLASIAEVV--AEG-------------------R-
A0A7W5H7D9      RRIV-----------AAAIKEHQLDKISSVVEAVNKSDS-------------------V-
M5UE94          RRIL-----------KSAIEKHDLDEVKSVVDAISESEN-------------------L-
A0A3E0MY27      PFVI-----------NTALSEPGIADISWLKEVKAEGE----------------------
A0A7V4M591      PKVV-----------ERALK--------NLGPDDR-VDW-------------------KG
A0A7X7F3G7      PTVV-----------EGALE--------KLGPEDR-IDL-------------------EN
A0A7Y4VQ32      PSVL-----------EPVLD----------DPEVQKTDW-------------------YR
A0A2E0X9P6      TVVL-----------IPLLGRSEIGAMEEFQNEP--------------------------
A0A1N6DAJ8      RLVL-----------STALKDPEVAKLEVIAKVV--------------------------
A0A2E8FLY0      DVVL-----------EEALQ--------KLPEKHR-IDL-------------------KG
A0A3D2U1E1      DLVL-----------EEVLQ--------KLPAKHR-VDL-------------------KD
E8R3W3          PIVV-----------EDALKDEKYKGL---------KTL-------------------ED
A0A5C5ZM48      PMVV-----------APLLGDPAIAQLEILRGEL--------------------------
A0A5B9WF77      DPVL-----------AGAFVVEPRIAKFSMFKNSN-------------------------
A0A7C4Z5R7      RSVL-----------TAAIH--------KLEADGV-LEP-------------------GK
A0A1P8WN28      DRVL-----------TDTVK-----------------EL-------------------KS
A0A3B9CTT0      DKSL-----------TQTAE-----------------NL-------------------DP
A0A518ALT3      PIVL-----------GPLLSRPSVSEIEEINSEF--------------------------
A0A286RGB6      RFVL-----------VAALRQPEVARLPSIREQI--------------------------
A0A7V3TZQ6      RFVL-----------VAALRQPEVARLPSIREQI--------------------------
A0A3M1QRP3      ARVI-----------ERVLERDDVRQTSLFDEVEQNVLT-------------------KL
A0A517TMV0      SEVI-----------RRAIE--------RLSPEHR-VDL-------------------AD
A0A3E0MY88      AVVL-----------SGVRQ--------LVEPSHQ-VDF-------------------QG
A0A518BBX8      PLIV-----------ERAIR---------TNPEILQLES-------------------AK
A0A5B9QF68      PIVL-----------QNAIK--------RLPPKHR-IDL-------------------VG
A0A5B9QGF0      PIVL-----------QNAIK--------QLAPQHL-IDL-------------------VG
A0A5C6CK24      PIVL-----------QNAIK--------QLSPQYL-IDL-------------------VG
A0A7C5FXU1      RYVL-----------MAALRQPQVAELESIRNHP--------------------------
A0A847YFA1      RFVL-----------VSALRRPEVARLAAIRNEL--------------------------
A0A1C3E6N1      DIVL-----------ADAAQ--------KLPVKYR-TDF-------------------RG
A0A518GJT2      DIVL-----------ADAAQ--------KLPVKYR-TDF-------------------RG
A0A2E8B0L9      AVVL-----------DGAIQ-----RLLKSPAEAR-IDL-------------------AG
A0A5Q4GFE7      QEVL-----------EGAIE-----SLLQGPAENR-IDF-------------------AS
A0A257WS34      DAVI-----------EGAIK--------GLPSKHR-HVL-------------------RK
A0A7C4LP10      DKVL-----------EAAIK--------SLPAKHR-IDF-------------------EG
A0A2E3RCU8      QPVL-----------ENAIQ--------HIPSECL-QEF-------------------KG
A0A517MLW3      DRVL-----------KQALD-----QLRQMDSSLQ-IDL-------------------VG
A0A5B9QVD0      DRVV-----------QSTLR-----SLREQPAAAQ-IDI-------------------RD
A0A3A0DET7      TPVL-----------AAAAD---------APENANLETF-------------------HG
A0A3B8PNV4      DVVL-----------EEALQ--------KLPAKHR-IDL-------------------KG
A0A3D1DR40      DVVL-----------EEALQ--------KLPAKHR-IDL-------------------KG
A0A2E7RYU8      DVVL-----------EEALQ--------KLPAKHR-IDL-------------------KG
A0A3B8LXG8      DVVL-----------EEALQ--------KLPAKHR-IDL-------------------KG
A0A6M5Z0K7      RPVL-----------QDAVS----------SAEVRSLRL-------------------VA
A0A350CI62      EEVI-----------ARALR--------IMPEKYRRVDL-------------------AG
A0A4P5WQK6      EEVI-----------ARALR--------IMPEKYRRVDL-------------------AG
A0A3C1X4W5      EEVI-----------ARALK--------ILPEKYRRVDL-------------------EG
A0A3D3W3A7      EEVI-----------ARALK--------ILPEKYRRVDL-------------------EG
A0A7Y5SKC2      TKVI-----------EGALA--------LLQPQDR-IDL-------------------AG
A0A7X7U104      APIL-----------SAAMKTGRMEQLRSFQTAS--------------------------
F0SI78          PVIL-----------KKAVE------------DFRLGEL-------------------SS
A0A517MDV3      PRVI-----------GDAIDNRQLEELESIRSELDPVLA-------------------KF
A0A518IQ30      SVVL-----------GGALD-----RIRQLDSDLK-IDL-------------------AG
A0A517LWP4      SVVL-----------GGALD-----RIRKLDSELK-VDL-------------------AG
A0A518JNW8      SVVL-----------GGALD-----RIRKLDSELK-VDL-------------------AG
A0A2E3GWX1      EEVL-----------KGTLQ--------RLPRDQQ-AKF-------------------LG
F0SG60          EEVL-----------KGTLQ--------RLPRDQQ-AKF-------------------LG
A0A2E9VST2      DEVL-----------KGALL--------RLPDTAR-TKF-------------------IG
A0A356A6X2      DEVL-----------KGALV--------RLPDTAR-TKF-------------------IG
A0A5C5XLM3      DEVL-----------KGALV--------RLPDTAR-TKF-------------------IG
A0A7V2UW16      RRIA-----------ERVFK-----DL-----GLW-ASP-------------------EF
A0A518DRX3      AVVL-----------NSAVE-----KLQDAPPEVV-LAF-------------------DA
A0A518DZF9      AVVL-----------NSAVE-----KLQDAPPEVV-LAF-------------------DA
A0A2E7ENQ5      SVVL-----------EQAAA-----RIQELPAPLR-VDV-------------------TP
A0A7V2XSV8      PRIA-----------ERVFK-----RL-----DLW-KEA-------------------PF
A0A847GXG1      TVVL-----------EGAIR-----ELLKAPPQIR-VDF-------------------AA
A0A7C5BZF0      SAVV-----------AKAVG-----KL--DAVH-R-VDL-------------------VG
A0A847YGH5      AKVL-----------QGALK-----RL--APEDIA-VDL-------------------SP
A0A286RLF2      AKVL-----------EGAIQ-----KL--SREDLA-VDL-------------------NM
A0A7V3TX18      AKVL-----------EGAIQ-----KL--SREDLA-VDL-------------------NM
A0A1G3AQE9      DKVL-----------DAAVR-----QL--RP-EDC-IDF-------------------AG
A0A3L7UQT9      DRVL-----------SAALE-----DL--PK-EYC-VDF-------------------EG
A0A4P5YBU2      DRVL-----------SAALE-----DL--PK-EYC-VDF-------------------KG
A0A7C7V5U8      KKVL-----------KRAIQ-----KL--TRPEDR-VDF-------------------AE
A0A3M1VCL4      DRVL-----------EDAIE--------RLSPEYRMVDL-------------------QD
A0A518AKT8      AIVV-----------SNALA--------NLDSEHL-IDL-------------------ER
A0A5C5ZR72      PVVL-----------RETLA----------DEDVG-SAE-------------------HL
A0A7Y5SJZ4      DAVL-----------EDAVK--------RLAPEQL-ASL-------------------AA
A0A5C5V7Z9      PVVL-----------QNAIA--------NLPPEHR-VDL-------------------LT
A0A5C5YT05      PVVL-----------QNAIS--------DLPPEHR-IDL-------------------ET
A0A518D7F9      PVVV-----------REAIQ--------ALEPQHR-LDL-------------------LG
A0A5C5ZIP0      PVVV-----------RNAIE--------QLKPEHR-IDL-------------------VE
A0A518KBK3      SEVV-----------TRAIE--------RLAPEHR-IDF-------------------VD
A0A5C6AKF9      SEVV-----------SRAID--------RLGPEYR-IDF-------------------VD
A0A7C2KUQ9      NTVL-----------QPVLE----------DPEIQ-ATG-------------------WF
A0A7C5R0U3      RTVL-----------TRAAE------RLAGVPDVA-AMW-------------------RK
A0A847YCQ7      NLVL-----------NAALR----------REGIA-RLP-------------------LL
A0A286RD13      NRVL-----------TAALQ----------RPGIS-QLP-------------------YI
A0A7V3TUJ6      NRVL-----------TAALQ----------RPGIS-QLP-------------------YI
A0A517TY85      PVVL-----------GPALDWSPQTKNGQKLPKLG-ELA-------------------EV
A0A5B9QEI7      PVVL-----------TPVLG----------RPEIA-SIP-------------------EI
                                                                            

A0A5S9IPR9      ------------RERTDVTAGQLLRTISVAVGDG--------------------------
A0A533Q9U4      AGNRTQDPSAETQFINRFLSP-----LKVSLMRN--------------------------
A0A533Q6B7      ------------NPSDPFTETYLINAFLSGLNVSL-------------------------
A0A1U9NNE1      ------------DPVAILKLMINKETILIEPGEK--------------------------
A0A2G2JCA2      ------------DIIAALGRN-----INVRAVSG--------------------------
A0A1G2XVR0      ESQEPETPVKYDVDDALINNYLSKLTVQMTGN----------------------------
A0A1G3B0P0      ESQEPETPVKYDVDDALINNYLSKLTVQMTGN----------------------------
A0A1E3X4X0      SSKR-----------RLIDVYLKKLSITPVRN----------------------------
A0A286U4B3      SKALDGSVNKSVSMDRLARQLLGRTEILSVRN----------------------------
A0A5C6DDS2      LKTKESDADKPVSVEKLVTIFLNMINIELVRN----------------------------
A0A5S9IJB5      ------------DPLKVFRGL-----FTVTPLRK--------------------------
A0A2E3GW02      ------------FRLGELSSISSSNPMASISS----------------------------
A0A5B9QNZ7      ------------RQLEAL------ESIRQQLDPELAR-----------------------
A0A1Z8N7H5      ------------SEFQGQQRESWHRQLAGKISTRV-------------------------
A0A1U7CZ81      ------------STVAEL------PFIKNSTDKLTDLRQ---------------------
A0A142YNY8      ------------PQVSGL------PFIKGSLSPRTELKE---------------------
A0A1U7GLS6      ------------ATVSEL------PFIKNSMAPQADLLE---------------------
A0A1G2YPI3      ------------AGIQQMQTFSEVDNHISYLKKTLNATV---------------------
A0A532UIN2      ------------------------PGIAQMKTLAGVD-----------------------
A0A0S8KNX5      ------------ILKQAI------------------------------------------
A0A3D3UVZ8      ------------LKLAIV------------------------------------------
A0A517NFU9      ------------GNLDQL------ASFQQVVANGGSV-----------------------
A0A5C5YWH4      ------------GKLAEL------ESFKNAAKEGRGG-----------------------
A0A3D2TNK4      ------------TDIEGMPPSTWVRIIGSRLHTRV-------------------------
A0A7C1Y4F0      ------------------------PKIARLRTFADVD-----------------------
A0A6I0ENW6      ------------DPPQKLLSSAVKPAYERLLE----------------------------
A0A6L3A0B7      ------------DPPQKLLSSAVKPAYERLLE----------------------------
A0A0J1B4A0      ------------VKVGDLAE----------------------------------------
A0A142WSB9      ------------YGLKDI------PGIANARDPLKAV-----------------------
M5SZR3          ------------------------PEISALKTKTKEL-----------------------
M5TW92          ------------------------PEISALKTKTKEL-----------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------IAIGQLTAFDETPADVSSLINMIRA-----------------------
A0A432MJP4      ------------VGVENLPTLQLAKREGKTPTQAAIE-----------------------
M5UQ35          ------------------------ARLDRTVGEIQE------------------------
A0A0S8FY64      ---------------------------DRLTGLFQAE-----------------------
A0A1N6KFT7      ------------------------------LGSNTPT-----------------------
L0DFG4          ------------------------------LGPKKTP-----------------------
A0A5C5XXG1      ------------VDFIDLPIRPSIRMTENNAKPSAPAKSESRVTEDVVTLDVLQILFRQR
A0A7C7YUM8      ------------TVVDAHDRRPSDGILRRLRGSRFLD---------------------HR
A0A7C2AHI6      ------------TRVEAKDLTPFATLWRKLTGTPHQP---------------------HR
A0A518BJJ1      ------------TVVESPDQQPVRRIFDRMVGIRRGK---------------------GA
A0A518D182      ------------AQVDDLARRPLAAAVGRLTG-QIPA---------------------PR
A0A7V4HWU2      ------------HELAKL------PSFQ-------GM-----------------------
A0A5C5WTY6      ------------AGLIAE------PSIVAKAE---PP-----------------------
A0A5C5Y033      ------------YGLMEL------PSLVAKVS---DE-----------------------
A0A5C6G1Y2      ------------YGLMEL------PSLVAKVS---DE-----------------------
A0A354PDV6      ------------DGLMDL------ASIQPLLTPA-KG-----------------------
A0A5C6FZ02      ------------NSLMTL------PSVVEHLDPEIET-----------------------
M5TIT3          ------------SNLMAL------PSIVERIDVDNPS-----------------------
A0A5M6CY44      ------------NGLTEI------ESLQSQVS---PE-----------------------
F2AXG2          ------------EKLIDL------PSVLPHLD---EK-----------------------
M2BB46          ------------EKLIDL------PSVLPHLD---EK-----------------------
L7CLQ6          ------------TKLLDL------PSILQQLS---EK-----------------------
A0A0J1B719      ------------NELLDL------PSIETHLN---EK-----------------------
Q7UF18          ------------TELVNL------PSIESHLD---EK-----------------------
A0A2G1W1E0      ------------TELVDL------PSIESHLD---EK-----------------------
K5E235          ------------TELLDL------PSIESHLD---EK-----------------------
A0A5C6FFI9      -------------NLEKL------PSIGAVVAGGD-------------------------
A0A5C5WDJ1      ------------IELGDLTQYPSFAEIRQSGG----------------------------
A0A5C5X547      ------------SEISNLPQVVAEP-----------------------------------
A0A353FIP5      ------------LRVDDLDRYSPWKLVRRKLAGKTLD-----------------------
A0A7V7MJI7      ------------LIVDDVDRNYPWERLLLLFTEWRPE-----------------------
A0A5B1CIK7      -------------GLLEL------DSILPHLNEKI-------------------------
A0A5C5WHS2      -------------GLMNL------ESITPHLGDSG-------------------------
A0A5C6B6G8      ------------YSLMEL------PSIKAQLSDTE-------------------------
A0A5C5ZZN3      -------------SLVSL------PSIVEQLDETKPQ-----------------------
A0A5C5XS91      -------------ELSEL------PSITTHLNQERPG-----------------------
A0A5C6C4E6      -------------DLATL------PSIVERLNPERTG-----------------------
A0A2E1VVJ1      ------------IKVDDFDRYWPEASILRRFTGGSVP-----------------------
A0A3M2AEL0      ------------VTVDDVDRNWPWPAVLRKLGRGEEP-----------------------
A0A2A2W9R6      ------------RSVGQLRG----------------------------------------
A0A518HKC1      ------------RSVGQLRG----------------------------------------
A0A518L3P0      ------------RSVGQLRG----------------------------------------
A0A255R1S0      ------------KSAGEIAG----------------------------------------
A0A5B9MKP1      ------------RSVGQLQR----------------------------------------
A0A351FYP6      ------------EARKHLEKV-----IDVS-QYRN-------------------------
A0A0S8J591      ------------DPIAVVRNW-----IRVSRVPK--------------------------
A0A532UT69      -GAG--------NPIGVLRSG-----LDVSVGKR--------------------------
A0A7V9G2R2      -SSQ--------DPVRLLRQR-----LRVATNRD--------------------------
A0A2D5AWU0      -GSK--------PMITELNDR-----IGTVVDPN--------------------------
L0DC26          -KMS--------DPIEWLEGQ-----LQVDFAPG--------------------------
M5RT57          -SIE--------KPIAWLTDN-----IRVQQVGS--------------------------
D5SZ21          -APA--------DWPGVLKKM-----VTVRSARQ--------------------------
A0A7X7U1J4      -ASG--------NRVLLIRGG-----LEVSVGKK--------------------------
A0A7V8E5N8      -GLG--------G-TQAFAGN-----VDLEQVRA--------------------------
A0A356KTN1      -TPE--------ELGGMFQRG-----VRVEALES--------------------------
A0A7Y5LV28      -SRP--------DPVRELTEQ-----IDIEQVRN--------------------------
A0A7Y5HFQ5      -GE--------------FSGS-----VVVTPVRN--------------------------
A0A7W1FMQ9      -GSS--------EPVEVLQAR-----VSARTVRS--------------------------
A0A7W1NA62      -SAT--------NPGAVLRKR-----MKITTNRD--------------------------
A0A7V9JTP9      -GQG--------DPVIVLRKR-----LKITTSRD--------------------------
A0A7W1FJ38      -ETT--------DVTKLLKER-----IKVTTRRD--------------------------
A0A1G2YQB7      KKNS--------DLVLALKNAIASNQLSVAPEDN--------------------------
A0A353P687      NNSS--------DLILLLRKAIADNKLTVAPEDK--------------------------
A0A356EME5      -EKK--------DKVQWLQRE-----LRLTSVGK--------------------------
A0A3L7P4E4      -GAS--------NLTQTILNG-----LNAERTVED-------------------------
A0A3L7PEB5      -GSP--------NLPMTILAG-----LSATRTVE--------------------------
A0A1U9NL64      -EID--------NPTGYLKKQ-----LQVSVGKK--------------------------
A0A2N1UCJ3      GEID--------NLVIYLKKL-----LDVQVGIK--------------------------
A0A7V2H881      -LSV--------DPMGYLLLN-----TRATVGTR--------------------------
A0A7C4EK84      -DLN--------NGVAYLKSA-----LQVEVGKN--------------------------
A0A7C3F0T2      -GMT--------NPVGYLKAI-----LRVGLGKD--------------------------
A0A7X7U4K9      -GQD--------SALARLERN-----LDVSIGKN--------------------------
A0A2E0X4J3      -DSD--------SPVGMLYEG-----LAIQVGAD--------------------------
A0A838QZ11      -DSD--------NPVGFLHEE-----LSVSVGTQ--------------------------
A0A5C5YU10      -GVE--------NRVGLLYSG-----LNVDVGRD--------------------------
A0A517MPZ6      -STD--------NPIGLLKKN-----LSVQVGKN--------------------------
A0A5C6CNV7      -DVD--------NRVAFLRKN-----IDVQVGQN--------------------------
A0A518K5H4      -NTD--------NPLALLREE-----IEVVVGER--------------------------
A0A5C6AA28      -KTD--------NPVGLLRES-----LEVAVGER--------------------------
A0A2E7ESJ6      ------------DPLLKLSEN-----LKVELVEDG-------------------------
A0A2E9VK20      ------------EPARDIIDS-----LKVS-RTAGED-----------------------
A0A3D4PJK1      ------------EPARDIIDS-----LKVS-RTAGED-----------------------
A0A355AI52      ------------ILAEIFSKS-----LSVR-GLRQ-------------------------
A0A354PCQ3      ------------IAEQNLRKN-----LSIS-GGGT-------------------------
A0A0S8GZ23      ------------DRISALKTA-----LADG-TITIKH-----------------------
A0A1I3DDV4      ------------DAVDYVSEH-----ISLT-KGGQGS-----------------------
A0A7V2UF66      ------------NLVGLIRAG-----LSVE-VGRK-------------------------
A0A2E0SMM6      TPLE--------MQVKTLRTQ-----LSTS-VSPQ-------------------------
A0A3L7SI46      TPKS--------RWTAVLKKN-----LTVS-STRL-------------------------
A0A5B9PJZ8      ------------SVIRYLRDG-----KALI-AKSADV-----------------------
A0A2S8G191      ------------DPVSWLQGA-----LSVN-FPDN-------------------------
A0A2E7EGG1      ------------DPIDWLSTQ-----GLLIAPKGS-------------------------
A0A2E2N5A9      AQGEGTSSKAFDRATEKLMAA-----ISVN-PRGK-------------------------
A0A7C8AGA2      ------------DLVQALRKA-----VVKG-DIKIEP-----------------------
A0A7C2FXP7      MGLTLTKTTQTVEPAAVLKQA-----IANE-TIIAHS-----------------------
A0A1P8WP26      LTEA--------EAVAEMQKS-----LSVS-SDFG-------------------------
A0A3L7V1F3      YPEG--------QWVRTIKDN-----LSVS-CAFS-------------------------
A0A2E3GWC6      ------------DPARDIIDG-----LKVE-RTAGED-----------------------
F0SLB0          ------------DPARDIIDG-----LKVE-RTAGED-----------------------
A0A3L7NDH9      QDPE--------IVAVILKNH-----LKIK-GVRS-------------------------
A0A7X8IIB9      ------------NLLQALRDM-----VSKG-DIEVIP-----------------------
A0A532UD06      ------------NLVGYVKRE-----LKVA-VGRK-------------------------
A0A660URN1      ------------NPAAFLKKN-----INVA-VGKK-------------------------
A0A517ZCB5      VRPE--------RWIESFQSH-----LEVS-AERK-------------------------
A0A225EH48      ------------DPVTFLEDR-----IKLR------------------------------
A0A518INW8      ------------SALGLLKQD-----LNIS-RGGSGD-----------------------
A0A518JPH9      ------------SALGLLSGN-----LNIQ-RGGAGG-----------------------
A0A5C5VEK8      ------------NRVAMLYEA-----LSVG-VGQD-------------------------
A0A532UTJ0      WKQKLLGTTPKPEIAARLKQA-----IVGEKSIVVAA-----------------------
A0A2E2CCW9      ------------DPTQDIIDT-----LKVK-RISGND-----------------------
A0A3C0AGX3      ------------DPTQDIIDT-----LKVK-RISGND-----------------------
A0A518AAQ5      ------------DPAQEIIDS-----LKVK-RLSGTD-----------------------
A0A517QBG9      ------------DPAQEIIDS-----LKVK-RLSGTD-----------------------
A0A518FTU3      ------------DPAQEIIDS-----LKVK-RLSGTD-----------------------
A0A517WHH5      ------------DPAQEIIDS-----LKVK-RLSGTD-----------------------
A0A5A8BGT3      ------------DPAQEIIDS-----LKVK-RLSGTD-----------------------
A0A2E7K7A9      ------------DPAQEIIDS-----LKVK-RLSGTD-----------------------
A0A517PTS5      ------------DPAQEIIDS-----LKVK-RLSGTD-----------------------
A0A6I6AH34      ------------DPAQEIIDS-----LKVK-RLSGTD-----------------------
A0A517VTK3      ------------DPTEEILGS-----LKVK-RISGND-----------------------
A0A517WQT4      ------------DPTEEILGS-----LKVK-RISGND-----------------------
A0A517VID8      ------------DPTQDIIDT-----LKVK-RISGND-----------------------
A0A517RK10      ------------DPTQDIIDT-----LKVK-RISGND-----------------------
A0A518IH18      ------------DPTQDIIDT-----LKVK-RISGND-----------------------
A0A7W0M4Y4      ------------AAIGMIMKG-----LTVEPMSKG-------------------------
A0A2D5NDU9      DET---------ITVPWLKYH-----LRAE-VGSD-------------------------
A0A5C5XLF4      ------------EPARDIIDS-----LKVT-RTAGED-----------------------
A0A518CHE5      NPME--------MQVKILRSQ-----LSTS-VSPQ-------------------------
A0A1V5N3W2      KDSKPLNPVV--AIRQAIRDG-----IIAVVPGRK-------------------------
A0A517NSK8      ------------NPLEYIRDH-----LHVT-KGGLGV-----------------------
A0A5C5Z0D6      ------------SSLKFVMDN-----LSVS-KGGEGV-----------------------
A0A7W5H7D9      ------------TPLVYILDN-----LDVT-KGGDGV-----------------------
M5UE94          ------------SPLAYILDN-----LEVT-KGGDGV-----------------------
A0A3E0MY27      ------------DQVAWLNER-----IDVV-NPRM-------------------------
A0A7V4M591      LSRD--------RWVEKLQKG-----LSAR-TIRG-------------------------
A0A7X7F3G7      VARK--------GWVSALQKK-----ISTK-NIPS-------------------------
A0A7Y4VQ32      NPRPGLLKQPL-PPLQRLRLD-----LSVS-NQRG-------------------------
A0A2E0X9P6      ------------EPLKHLQEH-----LAVA-QIGE-------------------------
A0A1N6DAJ8      ------------DPIEWLEKE-----LQVD-FASG-------------------------
A0A2E8FLY0      IPRN--------KWTETLRNN-----LAVT-TPRR-------------------------
A0A3D2U1E1      VPRA--------KWIDALRKQ-----LGVS-APRR-------------------------
E8R3W3          LNEN--------ERFNWLSAN-----IQSS-FA---------------------------
A0A5C5ZM48      ------------DPIGMLGEL-----VHVF-QRGD-------------------------
A0A5B9WF77      ------------DPAAELRKR-----LEVQ-ILPD-------------------------
A0A7C4Z5R7      AAEN----------LAWLEKG-----LLGD-FTQG-------------------------
A0A1P8WN28      LPPELAAEPDRTVWPIRLREM-----LVVT-FETD-------------------------
A0A3B9CTT0      KPPELSG-VDSLRWPGELRKM-----LTVK-FNSA-------------------------
A0A518ALT3      ------------DPQAYIREH-----LSVR-QVGK-------------------------
A0A286RGB6      ------------DPVQWVSEH-----LSVR-FPGN-------------------------
A0A7V3TZQ6      ------------DPVQWVSEH-----LSVR-FPGN-------------------------
A0A3M1QRP3      LRSP--------SPGKRLMDG-----LDVN-VAHN-------------------------
A0A517TMV0      TPPR--------KWISSINSR-----LSAS-TVRK-------------------------
A0A3E0MY88      TRGP---------GVGVLASN-----ISVS-TAKG-------------------------
A0A518BBX8      PSSEDE------DAVDVIIEE-----IDVKRTTGRLS-----------------------
A0A5B9QF68      EPTH--------KWVEKLSEN-----LSAR-VTRK-------------------------
A0A5B9QGF0      KPTH--------EWVETLSEN-----LSAQ-VTRR-------------------------
A0A5C6CK24      EPTH--------KWVETLSKN-----LSAR-VTRK-------------------------
A0A7C5FXU1      ------------DPVSLVQEG-----LRVR-FPGN-------------------------
A0A847YFA1      ------------DPVQWVSER-----LSVR-YPGD-------------------------
A0A1C3E6N1      VAPA--------DWPGVLKKM-----VTVR-SARQ-------------------------
A0A518GJT2      VAPS--------DWPGVLKKM-----VTVR-SARQ-------------------------
A0A2E8B0L9      LPRD--------KWIDALRAN-----LSAS-GLRR-------------------------
A0A5Q4GFE7      APRH--------RWANILRGN-----LSAQ-AIRR-------------------------
A0A257WS34      VPRA--------RWADTLRSG-----LSVS-AARQ-------------------------
A0A7C4LP10      VPKT--------KWTQSLRSR-----MSVS-SARL-------------------------
A0A2E3RCU8      NRES---------WHRELASK-----ISTH-VVRS-------------------------
A0A517MLW3      LSDE--------QALTTLQGN-----LTVQ-LVRN-------------------------
A0A5B9QVD0      KSDE--------AAVKTIRAN-----LSVN-LLRN-------------------------
A0A3A0DET7      VDNR----------VAFLRDN-----INVG-VGSQ-------------------------
A0A3B8PNV4      IPRS--------KWTEALRNN-----LAVT-APRR-------------------------
A0A3D1DR40      IPRS--------KWTEALRNN-----LAVT-APRR-------------------------
A0A2E7RYU8      IPRS--------KWTEALRNN-----LAVT-APRR-------------------------
A0A3B8LXG8      IPRS--------KWTEALRNN-----LAVT-APRR-------------------------
A0A6M5Z0K7      AQS---------DPVEWLEKQ-----LVVE-QVPS-------------------------
A0A350CI62      YPQS--------AWVRMVRDN-----LQAS-SAYN-------------------------
A0A4P5WQK6      YPQS--------AWVRMVRDN-----LQAS-SAYN-------------------------
A0A3C1X4W5      YPQS--------AWIRKVRDN-----LQAS-SAYN-------------------------
A0A3D3W3A7      YPQS--------AWIRKVRDN-----LQAS-SAYN-------------------------
A0A7Y5SKC2      VSRE--------NWANVLRGN-----LRVK-AIRN-------------------------
A0A7X7U104      ------------NIMGALRRG-----LDTV-VGKK-------------------------
F0SI78          ISSS--------NPMASISSG-----LSVSRSAKA-------------------------
A0A517MDV3      DHRR--------AVVNYIIEQ-----LWIE-RGGQ-------------------------
A0A518IQ30      VSPE--------KWKDTLRNN-----LSAS-AARR-------------------------
A0A517LWP4      VPEE--------KWKDLLRGK-----LSAS-AARR-------------------------
A0A518JNW8      VPEE--------KWKDLLRGN-----LSAS-AARR-------------------------
A0A2E3GWX1      MSKR--------QAIGTLREN-----LSVS-TTRQ-------------------------
F0SG60          MSKR--------QAIGTLREN-----LSVS-TTRQ-------------------------
A0A2E9VST2      MTKH--------QAIEKLRSN-----LTVN-STRQ-------------------------
A0A356A6X2      MTKH--------QAIEKLRSS-----LTVN-TARQ-------------------------
A0A5C5XLM3      MTKH--------QAIEKLRSS-----LTVN-TARQ-------------------------
A0A7V2UW16      EGMS--------DPIPAFLGH-----VSVK-PVRN-------------------------
A0A518DRX3      APSK--------EWAKTIEQN-----LRAS-SKRG-------------------------
A0A518DZF9      APSK--------EWAKTIEQN-----LRAS-SKRG-------------------------
A0A2E7ENQ5      KPRD--------EWVEILRKN-----LTAR-AVRS-------------------------
A0A7V2XSV8      ANSA--------DPIAAFLKC-----VRVQ-PVRN-------------------------
A0A847GXG1      VPRE--------KWLDVLRKN-----LTAN-AVRR-------------------------
A0A7C5BZF0      KPKD--------QWVETIQKN-----LTVR-AVQH-------------------------
A0A847YGH5      DTPE--------KWIKQLQMR-----LSAS-AVHK-------------------------
A0A286RLF2      DKPE--------TWVEGLRRN-----LAAS-AVYR-------------------------
A0A7V3TX18      DKPE--------TWVEGLRRN-----LAAS-AVYR-------------------------
A0A1G3AQE9      APKS--------EWSKKLRDK-----LSVN-ALRN-------------------------
A0A3L7UQT9      FNPE--------VWPTLLKNH-----VSVT-NERG-------------------------
A0A4P5YBU2      FNPE--------VWPTLLKNH-----VSVT-NERG-------------------------
A0A7C7V5U8      VPPE--------KWAEVLERN-----LSAR-TYQN-------------------------
A0A3M1VCL4      VPRS--------KWVKEVRSN-----TYVS-TIKQ-------------------------
A0A518AKT8      VPRS--------DWVEDLTDR-----LSAS-ISRK-------------------------
A0A5C5ZR72      KEES--------NRVKAIQKR-----LKVK-QVGG-------------------------
A0A7Y5SJZ4      LPPE--------KRAGALRQA-----LEVS-SATG-------------------------
A0A5C5V7Z9      VKPS--------RWIEALNEN-----LSAT-TVRR-------------------------
A0A5C5YT05      INPS--------HWVEELGRG-----LSAS-TVRR-------------------------
A0A518D7F9      VPSQ--------RWLEDILSR-----LSAS-SVRK-------------------------
A0A5C5ZIP0      SPPH--------KWVDSISDR-----LSAS-ATRK-------------------------
A0A518KBK3      QKPN--------RWVETIGDS-----LTAS-TVRK-------------------------
A0A5C6AKF9      KKAN--------EWVETINEQ-----LTAS-TVRK-------------------------
A0A7C2KUQ9      NERPRSLFGGEQSPLERLREA-----LTVT-VRPR-------------------------
A0A7C5R0U3      VPES--------ERLRHIQEH-----LTAR-GVRR-------------------------
A0A847YCQ7      AGKA--------DPVQWLRQQ-----IRVR-FPGE-------------------------
A0A286RD13      RNQV--------DPIMWLRRN-----LRVR-FADQ-------------------------
A0A7V3TUJ6      RNQV--------DPIMWLRRN-----LRVR-FADQ-------------------------
A0A517TY85      KEQA--------DPVDYLKRN-----LSVS-QVGK-------------------------
A0A5B9QEI7      KRSP--------DPLKYLQKQ-----LTVR-QIGK-------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      LDHRRAVITYILD-----------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      -----NSIAYLKK-----------------------------------------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      -------IDHILK-----------------------------------------------
A0A5C5YWH4      -------IDHILQ-----------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      -----NHVAFLRQ-----------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ----HQGLNVELD-----------------------------------------------
M5TW92          ----HEGLNVELD-----------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A0S8FY64      ----------------------------------DMRQMARPGLWHSAFREVRAVLGYEP
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      WLIAFLTLAGLAAGVAYALQARVWYESTARVLINEKSSGLASSSSSEMVEEDILANHIEL
A0A7C7YUM8      LRARLEPLAGKTADESEVRELDVYFVDEATVRIAPHGGYLFAEVPGAQDGEDFVEFDYKP
A0A7C2AHI6      LFASASGPID--P-----RRLTVSFPSD-----PSAGTVRVRDEEGGEE----VEVPYRP
A0A518BJJ1      LHARARALADGAA-----EAIRVSFDGEGQIRLTPVDVAASPDDDAREARPQRPDGRYRV
A0A518D182      IAVRSERLDGSAP-----ERVRLRFVSPTRVELAALGDMAYAEHFGSDA----TELDYAA
A0A7V4HWU2      ----ADPTGVIIA-----------------------------------------------
A0A5C5WTY6      ----EDTVTYVAS-----------------------------------------------
A0A5C5Y033      ----TDQVDYVIQ-----------------------------------------------
A0A5C6G1Y2      ----TDQVDYVIQ-----------------------------------------------
A0A354PDV6      ----EDAADYVIS-----------------------------------------------
A0A5C6FZ02      ----VDAVDYVID-----------------------------------------------
M5TIT3          ----SDAVDYVIN-----------------------------------------------
A0A5M6CY44      ----TDAAEYVIE-----------------------------------------------
F2AXG2          ----TDAIDYVID-----------------------------------------------
M2BB46          ----TDAIDYVID-----------------------------------------------
L7CLQ6          ----TDAIDYVID-----------------------------------------------
A0A0J1B719      ----TDAIDYVID-----------------------------------------------
Q7UF18          ----TDAIDYVID-----------------------------------------------
A0A2G1W1E0      ----TDAIDYVID-----------------------------------------------
K5E235          ----TDAIDYVID-----------------------------------------------
A0A5C6FFI9      -----NAVDYIIE-----------------------------------------------
A0A5C5WDJ1      -----SYVDHILD-----------------------------------------------
A0A5C5X547      -----DPIEWILE-----------------------------------------------
A0A353FIP5      -----GALSGELALPIARQNSAPVTVTFHSSNSGVATSGKILRQQSKAFSL-------AN
A0A7V7MJI7      -----GSLHAELVEIPEKALTSWIRVNFLSQDSVEVGWDRLLASEKQVFR--------LD
A0A5B1CIK7      -----DSVDYVIE-----------------------------------------------
A0A5C5WHS2      -----DPVEYVID-----------------------------------------------
A0A5C6B6G8      -----DAIDYVID-----------------------------------------------
A0A5C5ZZN3      ----FDAVDYVIE-----------------------------------------------
A0A5C5XS91      ----FDATDYVVE-----------------------------------------------
A0A5C6C4E6      ----FDATDYVVE-----------------------------------------------
A0A2E1VVJ1      ----NGSLEMELLQPYTDPWTHRIELEFLAEGEVLARSSRI------AEPETIRFDPNDT
A0A3M2AEL0      ----TGSLRVEVEQLPRDLTYRAWRIHFSSPEVVEVLPDSLWAAVLPGRKQVVRLD--DG
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A7V9G2R2      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A7X7U1J4      ------------------------------------------------------------
A0A7V8E5N8      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A7Y5LV28      ------------------------------------------------------------
A0A7Y5HFQ5      ------------------------------------------------------------
A0A7W1FMQ9      ------------------------------------------------------------
A0A7W1NA62      ------------------------------------------------------------
A0A7V9JTP9      ------------------------------------------------------------
A0A7W1FJ38      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7V2H881      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A7X7U4K9      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A838QZ11      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A7V2UF66      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A7X8IIB9      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A7W0M4Y4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
A0A7W5H7D9      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7V4M591      ------------------------------------------------------------
A0A7X7F3G7      ------------------------------------------------------------
A0A7Y4VQ32      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A7C4Z5R7      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A7V3TZQ6      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A847YFA1      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A7Y5SKC2      ------------------------------------------------------------
A0A7X7U104      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7V2UW16      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7V2XSV8      ------------------------------------------------------------
A0A847GXG1      ------------------------------------------------------------
A0A7C5BZF0      ------------------------------------------------------------
A0A847YGH5      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A7V3TX18      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      ------------------------------------------------------------
A0A7Y5SJZ4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A7C2KUQ9      ------------------------------------------------------------
A0A7C5R0U3      ------------------------------------------------------------
A0A847YCQ7      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A7V3TUJ6      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A2E3GW02      ---------GLSVSRS--------------------------------------------
A0A5B9QNZ7      ---------NLWVERGGQEL----------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1U7CZ81      ---------KLKVKN---------------------------------------------
A0A142YNY8      ---------RLAIVN---------------------------------------------
A0A1U7GLS6      ---------RLVVTN---------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      ---------ELDVSV---------------------------------------------
A0A0S8KNX5      ---------TNGVIVAAA------------------------------------------
A0A3D3UVZ8      ---------EDETITVAA------------------------------------------
A0A517NFU9      ---------NIEVNRGGE---------------------------GS-------------
A0A5C5YWH4      ---------HIEVIRGGE---------------------------GS-------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ---------NLTVNI---------------------------------------------
A0A6I0ENW6      ---------DLNVVN---------------------------------------------
A0A6L3A0B7      ---------DLNVVN---------------------------------------------
A0A0J1B4A0      ---------NLSVSKGGD---------------------------GL-------------
A0A142WSB9      -----WEDATAKLVSGQD------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ---------------------------------------------GF-------------
A0A517N8P6      ---------NLVLSPPFE---------------------------GAE------------
A0A432MJP4      ---------ELDVSRP--------------------------------------------
M5UQ35          ---------NLAVGRGGS---------------------------GD-------------
A0A0S8FY64      VRPVEAW-----------------------------ELLREIVGVRP-------------
A0A1N6KFT7      --------------------------SLAQSSDPVGFARGNLKVSRP-------------
L0DFG4          --------------------------SLALATNPLEAVRGSLKVTRP-------------
A0A5C5XXG1      LLSRKIVGEAMAAQDDDGNS-------LMTLPSVVEHLDPEIETVDAVDYVIDHMEVVKG
A0A7C7YUM8      GVDLEVFDLRLRLQASGAFAGQTYCVGLRSTEEAVLHLMKTTRAAEA-------------
A0A7C2AHI6      DEPFAAFGLSLRLRAIGAFAGQTYEIERFTLPELVDEIEDGLSVHET-------------
A0A518BJJ1      G------GVELNLAVRGDVSRREFVVRRVSEASAVKRLLSDTRVVES-------------
A0A518D182      GEPVEWSGLRLWIDADADRSLGTYVVHVRTPDDAARDLMNNTRVMET-------------
A0A7V4HWU2      ---------SLTATTPS----------------------------AT-------------
A0A5C5WTY6      ---------NLRIDRGGL---------------------------GA-------------
A0A5C5Y033      ---------NTSIGKGGD---------------------------GS-------------
A0A5C6G1Y2      ---------NTSIGKGGD---------------------------GS-------------
A0A354PDV6      ---------QLEIVKGGA---------------------------GA-------------
A0A5C6FZ02      ---------HMEVVKGGE---------------------------GG-------------
M5TIT3          ---------HLSVSKGGD---------------------------GS-------------
A0A5M6CY44      ---------HLEIVKGGS---------------------------GG-------------
F2AXG2          ---------QLSIVRGGD---------------------------GS-------------
M2BB46          ---------QLSIVKGGD---------------------------GS-------------
L7CLQ6          ---------QLSIVKGGD---------------------------GS-------------
A0A0J1B719      ---------QLSIVKGGD---------------------------GS-------------
Q7UF18          ---------QLSIVKGGD---------------------------GS-------------
A0A2G1W1E0      ---------QLSIVKGGD---------------------------GS-------------
K5E235          ---------QLSIVKGGD---------------------------GS-------------
A0A5C6FFI9      ---------NLDVARGGK---------------------------GA-------------
A0A5C5WDJ1      ---------SIEVERGGD---------------------------GN-------------
A0A5C5X547      ---------NLHVMQLPD------------------------------------------
A0A353FIP5      SPLVEIADTKIRLFPEGDLTGRQFRLNVATRREAVERVLKELAVSET-------------
A0A7V7MJI7      GSPIEFGGVKILLQPDSNLEGREFRLRWCSERVATESLLTRLKVEET-------------
A0A5B1CIK7      ---------HLSIVKGGD---------------------------GS-------------
A0A5C5WHS2      ---------RLELVKGGD---------------------------GS-------------
A0A5C6B6G8      ---------HLELVKGGE---------------------------GS-------------
A0A5C5ZZN3      ---------QLSIVKGGE---------------------------GS-------------
A0A5C5XS91      ---------HISISKGGE---------------------------GS-------------
A0A5C6C4E6      ---------HLSISKGGE---------------------------GS-------------
A0A2E1VVJ1      EPIVTMFGRRYKLMITGTLSGRKFGVTLRNLDATVGDLLSRLRIRET-------------
A0A3M2AEL0      KPL-ELAGARIRLIPDGDLSGRTFRLTLRSVRRAIRDTQESCRVVET-------------
A0A2A2W9R6      ---------GLSISKGGQ---------------------------GA-------------
A0A518HKC1      ---------GLSISKGGQ---------------------------GA-------------
A0A518L3P0      ---------GLSISKGGQ---------------------------GA-------------
A0A255R1S0      ---------KLSVGKDGE------------------------------------------
A0A5B9MKP1      ---------GLSISTGGE---------------------------GA-------------
A0A351FYP6      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A7V9G2R2      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A7X7U1J4      ------------------------------------------------------------
A0A7V8E5N8      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A7Y5LV28      ------------------------------------------------------------
A0A7Y5HFQ5      ------------------------------------------------------------
A0A7W1FMQ9      ------------------------------------------------------------
A0A7W1NA62      ------------------------------------------------------------
A0A7V9JTP9      ------------------------------------------------------------
A0A7W1FJ38      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7V2H881      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A7X7U4K9      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A838QZ11      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A7V2UF66      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A7X8IIB9      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A7W0M4Y4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
A0A7W5H7D9      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7V4M591      ------------------------------------------------------------
A0A7X7F3G7      ------------------------------------------------------------
A0A7Y4VQ32      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A7C4Z5R7      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A7V3TZQ6      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A847YFA1      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A7Y5SKC2      ------------------------------------------------------------
A0A7X7U104      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7V2UW16      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7V2XSV8      ------------------------------------------------------------
A0A847GXG1      ------------------------------------------------------------
A0A7C5BZF0      ------------------------------------------------------------
A0A847YGH5      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A7V3TX18      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      ------------------------------------------------------------
A0A7Y5SJZ4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A7C2KUQ9      ------------------------------------------------------------
A0A7C5R0U3      ------------------------------------------------------------
A0A847YCQ7      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A7V3TUJ6      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      -------TDILY-----ITCRGKNA-ENVAYIANLYVDVFVDENEREIKNAQDKLLNWLK
A0A533Q9U4      -------SGVVS-----ISYDGHNP-QLITRIANMIVKTYIEQDWEKRYNVAKDALDWLN
A0A533Q6B7      ----MRNSGVVC-----ITYTGDDP-YLITTITNAIVKTYIEQDWERRYSVAKEALEWLN
A0A1U9NNE1      -------TELIN-----IKMKTNNT-AFSEELVDSFIRVYMTMQAYEENQGEDNKLALLE
A0A2G2JCA2      -------SEMYS-----VEFQSTDP-VKASLIVNEVAKSYYNLHNQTEAVKDKRVLDLLE
A0A1G2XVR0      -------SDIIS-----ISFTGTHP-ETLAKMCNMHAKKFLETHLELRFAASQDAVKWLQ
A0A1G3B0P0      -------SDIIS-----ISFTGTHP-ETLAKMCNMHAKKFLETHLELRFAASQDAVKWLQ
A0A1E3X4X0      -------TGVVN-----VSFSGNYP-DIITDILNAHVKFYKDQELERRFLASQDAVEWID
A0A286U4B3      -------SQLVK-----IKVSTGYP-ELCKKIADTIADEYIKKNLEDKVLTTSGATDEIV
A0A5C6DDS2      -------SQLVK-----LKAETGSP-GLCVSIVDTLADEYIKKNLEDKVLTTTGATGEIG
A0A5S9IJB5      -------SFIVR-----VSFKWTDP-RLPPRVVDFLQKAYIQQDRERRVGLSGTGIDILY
A0A2E3GW02      ----AKAEDILL-----FTFTCGHP-KDAQKVLEAVIASYFAFLDESQRTASNRTVELIK
A0A5B9QNZ7      ----AYAPLTFV-----AEFRHGQA-ADCATVLTAITESYQDFMAETLQDANSEATGLIQ
A0A1Z8N7H5      ----VKSTTVLN-----ISYTSTKP-QNAVAIVTAVIKSYLQFVDETHKGTAAKIINVMT
A0A1U7CZ81      ----KDGTVHIQ-----VSFDSTDA-HEAAAIVNAVVASYLRSYKDVQQSRDESHLKRLT
A0A142YNY8      ----PRNTEFVH-----VSLESTNP-EEAAAIVNAVVASYLQAQNELTEGADGLMKKSLE
A0A1U7GLS6      ----QKNTNYVV-----VSLELNDP-EEAALIVNAVVAAYLRNYKDYKAGADKILRANLK
A0A1G2YPI3      ----GKKDDIIS-----ISYDSPYP-NEAAQLVNTVIDSYITYHATQKRSTSSEILKILR
A0A532UIN2      ----GKKDDIIS-----LSFNSPYP-AEAAQLINEAVDSYITYHATRKRSTSAEVLKILQ
A0A0S8KNX5      ----DRLSELIR-----ITVLHPDR-EQARQIVDAFINAYTAVEVSASVEDEDKKLTILE
A0A3D3UVZ8      ----DRRSELIN-----ITMRSANE-EEAKQIVDAFIKAYMEIEVVSADEDENRQLAILE
A0A517NFU9      ----ARDAMVLR-----ASYRDTNP-EDAAIVLSAIYDSYRDYVESHGHNSTEQAVELME
A0A5C5YWH4      ----SRDAMVLR-----AAYRDSSP-EDAALVLSTIYDSYRDYVESHGHDSTEQAVELIQ
A0A3D2TNK4      ----TRKKSFIE-----VTYRSKDP-KTAAAVVRAIIRAYLAFVEKHHKGTAGEIIADLT
A0A7C1Y4F0      ----GRKDDVIT-----VSLESPYP-VEAAQIVNELVRSYIAYHAERKRDTASEVLKILQ
A0A6I0ENW6      ----VKGTELIE-----IGFYATDP-KDAELIVKTIQQVYLDQTKGTADQRTRDLQQRLQ
A0A6L3A0B7      ----VKGTELIE-----IGFYATDP-KDAELIVKTIQQVYLDQTKGTADQRTRDLQQRLQ
A0A0J1B4A0      ----AKSASVLK-----ATYQDPDP-EVAAAALQAIFDSYQDYIDEQTSSVGNEAAELIA
A0A142WSB9      ----QSFDAIIE-----VAYESADK-AVAKTVVEAIVKAYEDWLGQTKDKNSADLYAALQ
M5SZR3          ----ENADNILH-----VSFEGEVP-EECPVIIRGILNTYQDYLEETYDTMSTDTVQLIS
M5TW92          ----ENADNILH-----VSFEGEVP-EECPVIIRGILNTYQDYLEETYDTMSTDTVQLIS
A0A2S8FKY2      ----PGDAEILQ-----VSMMSKDP-TSAPKIVNAVVSAYKDEVIETERLARVTRLENLE
A0A517N8P6      ----SPDRTIVE-----VSFESGDP-TVATAIVNAVVDAYDKSINGRHQGNIENVVGFFR
A0A432MJP4      ----DRAASVLR-----IDYRARTK-EEAVLLTDALIRSFEAFLEESYQSNNTKVVTLIT
M5UQ35          ----AEAANMLT-----ATFQDEDP-EMAAKILQAVYESYFSYIDNQSRAIGSEAADLIA
A0A0S8FY64      ----VKDTNLVD-----ILVRAPDA-NVASLVANLVAQAYVDYSVAARQQSAGEAFEMLQ
A0A1N6KFT7      ----DRLTKIIV-----LQYQSAST-QESLQMIHAIVASYKKLLETNYQKNNQEVITLVS
L0DFG4          ----DRLTKIIV-----VQYQSASP-QESLDMIRAVVASYKKLLETNYQKNNQEVITLVS
A0A5C5XXG1      GEGGAKTARTLR-----ISLNHTEP-EDAQRLLTAVLQTYSRYLDQQISDMMDLATAKIN
A0A7C7YUM8      ----GRKTNVVK-----VTVDDSCP-YRAAETANALAKNYIRRSVQIGRLKAERTLGFIE
A0A7C2AHI6      ----ARNSGVIS-----LTIADHDP-NRAAELANALCQNYIQRSIRIGRYRASQTVTFVS
A0A518BJJ1      ----QRNSGVIA-----LTVDDSDP-ERAAAVANALCHNYFDLNVERGRKRASQTVGFIQ
A0A518D182      ----QRNSGVLE-----LTVSDSDP-LRAAAKANALCLNYFDLKVERSRRRASQSIGFIE
A0A7V4HWU2      ----AVSSNIVG-----LTFKGSDP-VDCAKVLTAIFDSYNEFLGNAYQDRTKETAELIS
A0A5C5WTY6      ----AKKARSLT-----VTFDHSDP-VVAQQVLQAVIDQYLQTLSQKVDEILERSHRVVL
A0A5C5Y033      ----ARSAAIMN-----ITLQHNSP-EDVQKILAAIMRRYERFIVSQVESVMGEAGRMIQ
A0A5C6G1Y2      ----ARSAAIMN-----ITLQHNSP-EDVQKILAAIMRRYERFIVSQVESVMGEAGRMIQ
A0A354PDV6      ----AKSARSLS-----LAFAHTDP-EESRKILESVLVEYQNYIAGQLESVMSKANEYIT
A0A5C6FZ02      ----AKTARTLR-----ISLNHTEP-EDAQRLLTAVLQTYSRYLDQQISDMMDLATAKIN
M5TIT3          ----AKNARSLS-----VSFEHTNP-EDAQVLLTAVMKRYEQFIIAQVEQLMGKANEMIH
A0A5M6CY44      ----AKTARTLN-----ISFSHPDP-EDARLILTAVMKQYEKFIVAQVEQVMGRANELVQ
F2AXG2          ----AKTARTLN-----ITFTHTDP-DDAKRILTAVMSRYQQFLIDQIDQVMSHADKMVQ
M2BB46          ----AKTARTLN-----ITFTHTDP-DDAKRILTAVMSRYQQFLIDQIDQVMGHANDMVT
L7CLQ6          ----AKTARSLN-----ITFTHTEP-DDAKLILTAVMKRYEQFIKDQIEQVMGQANNLVE
A0A0J1B719      ----AKTARSLN-----ITFTHTDP-DDAKLILTAVMKRYEQFIIDQVEQVMGRANEMVN
Q7UF18          ----AKTARSLN-----ITFTHTEP-DDAKRILTAVMKRYEQFIIDQVEQVMGRANEMVN
A0A2G1W1E0      ----AKTARSLN-----ITFTHTEP-DDAKLILTAVMKRYEQFIIDQVEQVMGRANEMVN
K5E235          ----AKTARSLN-----ITFTHTEP-DDAKRILTAVMKRYEQFIIDQVEQVMGRANQMVN
A0A5C6FFI9      ----SKNAMVLS-----ATFRDPNP-DDAATILAAIYGSYERYVESHTQDTSREAAELID
A0A5C5WDJ1      ----AQNAMVLR-----VTYRANDP-EEAAMVLSSIYNSYKTYIDSQDQDKSKLAVELID
A0A5C5X547      -------TELLN-----VSFRDPDP-QAAMAIANAVVKNYYDKYVKADEQKDNKRLADLQ
A0A353FIP5      ----ARGSGVLQ-----ITYKDTDP-DRAAQVVNNLISSYAERSRERLALPAEKTVTYIE
A0A7V7MJI7      ----SRGSGVLR-----LSYRDSDP-VRAAQTTNQIVQAYMERSRERLSLRAQTTVDYLE
A0A5B1CIK7      ----AKTARSLK-----VLFDHTDA-EDTQLVLTAILKRYEEFIISQVEQVVGQANQMVN
A0A5C5WHS2      ----AKTARSLN-----IALTHTDP-EDTQLILTAVLKRYEQFIINQVEQVMGRANEMVN
A0A5C6B6G8      ----AKTARSLN-----VSFKHTEP-DDAQLVLTAVMKRYEQFIIDQVEQVMGRANELVQ
A0A5C5ZZN3      ----AKTARSLS-----VTFTHTEP-DDAQIILTAVMKRYEQFIIAQVEQLMGRANEMVN
A0A5C5XS91      ----AKAARSLR-----VTMTHTDP-DDAQLILTAVMKRYEQFIIAQVEQLMGRANEMVN
A0A5C6C4E6      ----AKAARSLR-----VTLTHTDA-DDAQLILTAVMKRYEQFIIAQVEQLMGRANEMVN
A0A2E1VVJ1      ----SRGSGVLQ-----ITYSDTSP-SRAQRFVNRLAEMYVAYKHDRLAAQAGATEAFVS
A0A3M2AEL0      ----HKGSNVLR-----LSYFDTDP-ERAAQVANALLRAYIEHNKSRLSRQASSTVQFIK
A0A2A2W9R6      ----GASASILR-----ATYRDSDP-ETAAKVLQAIFDSYQLYIDGQSRDVGAEAVELIA
A0A518HKC1      ----GASASILR-----ATYRDGDP-ETAAKVLQAVFDSYQLYVDGQSHDVGAEAVELIA
A0A518L3P0      ----GASASILR-----ATYRDGDP-EVAAKVLQAIFDSYQLYIDGQSHDVGAEAVELIA
A0A255R1S0      -------ASILR-----ATYQDGNP-EVAAKVLEAVFETYFDYVETRSQSVGSEAAELIA
A0A5B9MKP1      ----GSAASLLK-----ATYKDEDP-EVAARVLQAIFDTYQNYVEGHSENVGAEAAELIA
A0A351FYP6      -------TSIIE-----LRAYDRDK-NLAQQIAQALAKEYENYRSSLQEERVKAGIDKLR
A0A0S8J591      -------THHVE-----IWVLWPDP-KMAARMVNAVTDAYTDILKEWRSSAFDASVRALL
A0A532UT69      -------DDIIS-----VSFSSPYP-DEAVEIVNAAVDSYKAHYVSRKRNTSAEVLKIIQ
A0A7V9G2R2      -------TWVLT-----IALQDKDS-QRAEAGLQAVIDAFLAVQAKRKVDRGQDAIDFLE
A0A2D5AWU0      -------TDRLS-----IAYLSPFP-DEAAKIARATVEEYIAYHKRKKRESAEESAAIIR
L0DC26          -------SEILR-----ISMTGEKP-EIPMLLVNAVTQAYMDEIVDVEMKQSRQRYDLLK
M5RT57          -------SELYN-----ISLATSDP-ESSAKLVNAILDTYFAVRAKDNEDQTARVLELLG
D5SZ21          -------TNVLE-----LTCRSRDP-KAAAAILYAVLSASIDFLNKNHQGTSQEILQILS
A0A7X7U1J4      -------DEIIN-----VSFTSVYP-DEAAHIVNAIVAAYITTNEQDKRTAFGEVVRVLK
A0A7V8E5N8      -------SFILK-----VGFPDTDA-EASTQIVNTLISVYLDDANRRMRELKSNAANTLS
A0A356KTN1      -------TYLVD-----VSYESTDP-KRCDRYANAVAEAYREQLQTLWGEKTQIAEKKVS
A0A7Y5LV28      -------SFVLR-----VGIVDPDP-EKASQIANTLISIFLEDTNRRLREVKSEAVEALS
A0A7Y5HFQ5      -------SFLIK-----VAFESPWP-DVNPLCANAVAETFIASGKTQRVNRNEMAGKELE
A0A7W1FMQ9      -------TWVIE-----ITLRDEDP-KVAESALQVLLDVYLAKQARLSQSRGDQTLRFLT
A0A7W1NA62      -------SWVIA-----IALQDEDP-ARAAAGLEAVVNSYLAYQVERQSGRSQGAVTFLR
A0A7V9JTP9      -------SWVIE-----AALRDEDA-GRARAGLEEVLNSFLSKQSERQTDRSRGALVFLS
A0A7W1FJ38      -------SWIIT-----VALRDEDP-ARARAALDALLKAYTANQTAQKSERASDALTFLS
A0A1G2YQB7      -------TELIK-----IAVKSSNP-TSASKIANAFVQAYMTIVASEEVKDGDHKLTVLE
A0A353P687      -------TELIK-----ISVKSSNP-SNASKIANSFVQAYMTIVATEELKDGDHKLTVLE
A0A356EME5      -------SEFLQ-----VDFQGPDP-KNAAKIVNAVVKRYFDLLAEVTDERVAKVIALLD
A0A3L7P4E4      -------GQVLD-----ISFKGTDP-DDCAKVVNAVVASYDKNLRETYTDQGMVVSNLLK
A0A3L7PEB5      -------GQILD-----ISFKGSDP-VDCAKVVNAVVASYDKSLRESYADKGTVVAKLLT
A0A1U9NL64      -------DDILS-----VSFDSPYP-AEAAHVVNEIIDSYITYHSQRKRSTSAEVLKILQ
A0A2N1UCJ3      -------DDIIA-----VSCLSPYR-EEAAQIVNAVIEAYVDYQTSQKKSSVSEVLKILQ
A0A7V2H881      -------SEIVT-----VSVTGPEK-EDVAILADKVIDAYREFNDELKKGSASEVAKMIR
A0A7C4EK84      -------DDLVT-----VSLESPDP-RQAAVLVNSVVESYVEYQSRQQRWTAAELLKILN
A0A7C3F0T2      -------DDIIS-----VSLESPYP-EEAAQIVNAVVDAYVTYQGASRRSTAAEVLRILQ
A0A7X7U4K9      -------DDVIT-----VSFSCPYP-LEAAEIVNAVVNAFMADYEENRRRTSTEILDSLN
A0A2E0X4J3      -------NEIIT-----VSLELPDP-EEAAQLVNAVVDAYVSKYAGDYQDSALELLNILR
A0A838QZ11      -------DDIIN-----VALELPNS-SDAAQLVNSVVDAYITKYAEQRRNSAAEVLTILR
A0A5C5YU10      -------DEIIN-----VSLTLPNP-VEAAQLVNEIVAAYITQYAEKHNTETFKILEILN
A0A517MPZ6      -------DDIIN-----VMIELPSA-EDAAQIVNSVVDAYISKYAEERRTDTVEVLNILR
A0A5C6CNV7      -------DDIIN-----VSAELANS-ADAAQLVNSVVEAYISKYAEERRTDTVEVLTILR
A0A518K5H4      -------DDIIN-----ISIELENP-TDAAQIVNSVVDAYITKYAEERRSDVVDVVNILR
A0A5C6AA28      -------DDIIN-----IAIELENP-TDAAVIVNSVVDAYITQYAEERRTNVVDVVNILR
A0A2E7ESJ6      -------TNVLN-----IRFIGPYP-EDTQKVVNAVLHTYQQFLQEAYEDSGTETRDLIV
A0A2E9VK20      ----HHQLNILN-----LQYTTSKS-KDATAILNGVIKAYDDYLKDDARKNHAELQTLLE
A0A3D4PJK1      ----HHQLNILN-----LQYTTSKS-KDATAILNGVIKAYDDYLKDDARKNHAELQTLLE
A0A355AI52      -------TNLLE-----LNFRSSHQ-DATAVVVAAIIQAYAKFMDESHRGTANSIVDLLQ
A0A354PCQ3      -------ASRLV-----VSYQDSDR-EAAATVCNAIVQSYLRQRDAFDSIRVNNLERWLE
A0A0S8GZ23      ----LTRTEFLG-----VSMTSRKP-RQAEQIVNAFMKEYMKVVDNIDLGMEDQDLANLR
A0A1I3DDV4      ----ARDARSLN-----IAFRHTNP-DEALLILQALVAEYESFLDEQVSRIMSEANRLIT
A0A7V2UF66      -------DDIIN-----VSFEGPHP-EEAAQVANAVVDAYVTFHSKTKRNTAAEVLRILR
A0A2E0SMM6      -------TSLID-----VRFISKSP-ETAAYTTNQIIACYIKFMQETHQYGTQNLLTLLQ
A0A3L7SI46      -------TNMIQ-----VRYVSKNA-KTAKLVVDAIVAAYLEYMNEIHKGNSKESMVLLN
A0A5B9PJZ8      ----KSNSGVIK-----ISFDGGNQ-KEAEQILDAVVKAFGSYIDSDAEEIGGQTTQLWK
A0A2S8G191      -------AEIME-----VKLSGESP-QSISKIVNAVVQAYMDEVVDAEANMRRSRLSSLE
A0A2E7EGG1      -------SELLE-----VAFEGVNP-ENSALLVNAIIDAYFTMRQEKRGQRAQSVISLLE
A0A2E2N5A9      -------SQVVA-----VEVLLADS-YVAMKAANALVEGYIASKFEAGVATSATATAWMD
A0A7C8AGA2      ----VSNTELIR-----IKMTTDHQ-KQAERIVDAFIQAYMARVVRDEIRGEDQKLNTLA
A0A7C2FXP7      ----SQDTELIM-----ITIEWHDV-KEAQQIVDSFINSYMAVEVSTSIQGEDRTISVLE
A0A1P8WP26      -------TNVLD-----VSYRSTDA-KVAAAVVAHVLVAYNSFMNDVNRGSSDKNIERLE
A0A3L7V1F3      -------TTVLD-----LSYKSKDP-KAAQAVLRSMLAAYVEFLDDTHNGSSEESIRKLK
A0A2E3GWC6      ----HHKLNILN-----LQYTSTSE-EDAKQILNAVVKAYDEYLQDDAQKSHRELTQLLN
F0SLB0          ----HHKLNILN-----LQYTSTSE-EDAKQILNAVVKAYDEYLQDDAQKSHRELTQLLN
A0A3L7NDH9      -------TNLID-----LKYRAQDP-RAAAMAVGAIIKAYSLFMQETHRGSAGTLVEVLT
A0A7X8IIB9      ----DRQTEFLH-----VQMKTEHP-RDAEILIDAFLRSYEAIVRTDEIKDIDDRLARLE
A0A532UD06      -------DDIIT-----VSFDSPYP-QEAAQLVNAMVDSYVRYHSARQKSTVSEVLRIIE
A0A660URN1      -------DDIIK-----VSFDSPYP-AEAAQIVNAVVNSYVDYHSSRKRSTVSEVLKILQ
A0A517ZCB5      -------TNVMN-----IRYRSGDA-DTAYVVVSTLIGAYLEYMDHVMENTARDLLGILS
A0A225EH48      ----WGSPEILE-----VSMNGDDP-KQILLIVNTMVDEYIKDADSDERQGRQRRRKIIE
A0A518INW8      ----AEGASVLQ-----VSFQSADP-EDAQHVLEVIYERYCHHVESRTQNVGQEAATLIN
A0A518JPH9      ----SQGASVLQ-----VTYQSSDP-EDAEYVLEVVYERYCHHIESRTQNVGEEAAALII
A0A5C5VEK8      -------DEIIN-----VGLELPNR-FEAAQLVNAIVDAYITQYAEKRRNDTVEVLKILR
A0A532UTJ0      ----DRRSELIH-----VTMQTTKP-EEARQIVDAFITAYMDIEVLSAVEGENARLTLLE
A0A2E2CCW9      ----RAFLNILT-----ITYENPNA-KDARTVTQAIVDAYKRYLHEVREENTEDIIQQLK
A0A3C0AGX3      ----RAFLNILT-----ITYENPNA-KDARTVTQAIVDAYKRYLHEVREENTEDIIQQLK
A0A518AAQ5      ----RTYLNILN-----LTYENPNS-HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLN
A0A517QBG9      ----RTYLNILN-----LTYENPNS-HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLN
A0A518FTU3      ----RTYLNILN-----LTYENPNS-HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLN
A0A517WHH5      ----RTYLNILN-----LTYENKNS-HDAKAIMQAIVDAYQHYLDEVRDQNTGEIIEQLN
A0A5A8BGT3      ----RTYLNILN-----LTYENKNS-HDAKAIMQAIVDAYQHYLDEVRDQNTGEIIEQLN
A0A2E7K7A9      ----RTYLNILN-----LTYENKNS-NDAKVIMQAIVDAYHHYLDEVRDQNTGEIIDQLN
A0A517PTS5      ----RTYLNILN-----LTYENKNS-NDAKVIMQAIVDAYHHYLDEVRDQNTGEIIDQLN
A0A6I6AH34      ----RTYLNILN-----LTYENKNS-HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIDQLN
A0A517VTK3      ----RAYLNILN-----ILYENPRS-QDAKIVTQAIVDAYQRYLHEVRQVNTNEIREQLD
A0A517WQT4      ----RAYLNILN-----ILYENPRS-QDAKIVTQAIVDAYQRYLHEVRQVNTNEIREQLD
A0A517VID8      ----RAFLNILT-----ITYENPNA-KDAQAVTQAIVDAYKRYLSEVREENTEDIIQQLK
A0A517RK10      ----RAYLNILS-----ITYENPLS-ADAKAVTEAVVKAYRKYLNDVSDENTKDIIKQLN
A0A518IH18      ----RAYLNILS-----ITYENPLS-QDAKAVTEAVVKAYRKYLNDVSDENTKDIIKQLN
A0A7W0M4Y4      -------SRVVV-----IDYRGSTP-GETRAVVDALVKSYREFLGDSEQAVSEDAVRLIT
A0A2D5NDU9      -------NDVIT-----LTLDNRHK-HEACALVNEVVEAYQKFQRKMQRNSATELYRILD
A0A5C5XLF4      ----HHQLNILN-----LQYTTSKS-KDATAILNGIIKAYDDYLKDDAQKNHSELQTLLE
A0A518CHE5      -------TNLID-----IRFTSQSP-ETAAYTIDQVIMAYLKFMEETHQNGTQNLLKLLT
A0A1V5N3W2      -------TELIK-----ITMDSLNP-KEAELVVDAFVRAYMNIEGSRSMEGGNKNLEVLE
A0A517NSK8      ----AKDAHTLQ-----ATYDDPSP-EDCAVVLRAIFDAYDVYLKEHFSSNSSQAIDLLS
A0A5C5Z0D6      ----ARDAHILQ-----ASYDDPSP-SDCAVILRAIFDEYAAYLKEHFEGTSTQAVDLLT
A0A7W5H7D9      ----ARDAHTLK-----ATYDDPSP-MDCATILRAIFDEYSTYLKQHFEGTSTQAVDLLT
M5UE94          ----AKDAHTLK-----ATYDDPSP-VDCALILRAIFDEYKIYLDDHFAGTSTQAVELLT
A0A3E0MY27      -------TAVLR-----ISMSGDEK-EPVRMIVEAVAQAYLENVVRRERNDLLAKLSELE
A0A7V4M591      -------TSIIE-----VAYTSLDP-HVAARVVNAVVQSYVDFMREMHQGTTAELMEQLV
A0A7X7F3G7      -------TNILE-----VSVKSKKP-EVAVNLVNAVVDSYLEFLDETHKGTTGEIREIFS
A0A7Y4VQ32      -------TELIN-----VAIDTDEP-ADAKLIVDKVVQRYVYHTDTSEEKVDQLKLDMLT
A0A2E0X9P6      -------SELYS-----VDYVSPSA-SDAATVANLVVLEYLQMQGQQERQRTQLVIDLLE
A0A1N6DAJ8      -------SEILR-----ISINGEKP-QVPMLLVNAITQAYIDEIVDVETKQRRQRYDLLK
A0A2E8FLY0      -------TNLID-----VRYRSRDP-QVAATVVNHIVESYLTLMRGIHKNNAGNDIQFMT
A0A3D2U1E1      -------TNLID-----VRYRSRDP-QTAAAIVNHVVNSYLKLMREIHKSTASEDVEFLT
E8R3W3          -------GDLMM-----VSIPTPYP-EEASTLTNTLVNSYLRFANVLEMDRKMDEFSQLR
A0A5C5ZM48      -------SELFR-----LSMESTDP-QAAKDVINALARSYLDFRSKQESETKRRVIALLQ
A0A5B9WF77      -------TNFIK-----ISLESTNP-QEAADTVNAVALAYKLATQPDDTQLVPPAITGLR
A0A7C4Z5R7      -------PEVLR-----LTLKGQNP-EELAAILNTITSVYLDQVKKQDLERRQARFNQLQ
A0A1P8WN28      -------EYVLE-----IKCRSTSP-ESTVNVIEGLSVASGKFMDEYQKDLSVELMKQLE
A0A3B9CTT0      -------SQDLT-----ISCRSRDP-ESTVAVIEALQEVSEQFIEDYQTSLTVTLMNRLQ
A0A518ALT3      -------SELYE-----VAYTSSSA-DDAATVANYVVAEYMTVENDETDKRTNMVINTLR
A0A286RGB6      -------SEFMN-----VSFTSTRP-DETAVIVNAIVDAYMREVVDTEQRERRQRLSELD
A0A7V3TZQ6      -------SEFMN-----VSFTSTRP-DETAVIVNAIVDAYMREVVDTEQRERRQRLSELD
A0A3M1QRP3      -------SSILE-----IAVTLPDS-YDSAVVANAIADEYLRAVREDEQEDSESLAAERR
A0A517TMV0      -------TNIIR-----LGYESLDP-ETAAAVVRAVLDSYLDFVSESHRGAAADFLDKLI
A0A3E0MY88      -------TNIIH-----VRYQSKDP-DAAEAVLNSLLTSYKNFIKSTHGRTAEDVMEVLQ
A0A518BBX8      ----SSPDNVLE-----VSFSGKLP-EESRLILAAVIDSYRDFLDETYKNITDETATLMT
A0A5B9QF68      -------TNFIN-----VSFRSKSP-DAAAAVVRAIIHSYLQFVQEKDRGTAVDALHSLL
A0A5B9QGF0      -------TNFID-----VTYRSKSP-DAAAAVVRAVINSYLQFVQEKHQGTAGDALHSLL
A0A5C6CK24      -------TNFID-----VTYRSKHP-EAAAAVVRAIINSYLQFVQDKHQGTAGDALHSLL
A0A7C5FXU1      -------SELME-----VSYTAKNP-QEAAAIVNSVVESYLQEVVGVELAERRQRLDELD
A0A847YFA1      -------AELMQ-----VSVTGEKG-NEAAALVNAIVDAYMEEVVDVEQNERRNRLGELD
A0A1C3E6N1      -------TNVLE-----LTCRSRDP-KAAAAILYAVLSASIDFLNKNHQGTSQEILQILS
A0A518GJT2      -------TNVLE-----LTCRSRDP-KAAAAILYAVLSASIDFLNKNHQGTSQEILQILS
A0A2E8B0L9      -------TNIVE-----LNYRSKSP-HAAEAVVDAVVDSYIEFMKENHTDVSVEIVSILE
A0A5Q4GFE7      -------TNVIE-----ISYKSRSP-GAAEAVVGAVVQSYLEFMERSHKDVSTEIVQILD
A0A257WS34      -------TNVMT-----LRYRSTDP-ELSAYIVSSVLNSYLKFMQATHRHSSRETLDVLT
A0A7C4LP10      -------TNIIT-----LRCTSKNP-QTAAFVVGAIVESYLRFMAETNRNSSQETLLLLT
A0A2E3RCU8      -------TTVLN-----ISATSTQP-KNAVAMVNAVIQSYLQFVDQTHQGTATKIIQVMT
A0A517MLW3      -------TNVIE-----LSYRSASP-KAAEVVLDVLVQSYLDFMQQHHQDTSVTVLELLK
A0A5B9QVD0      -------TNVVE-----LSYKSGSP-EAAKAVLDTLVDAYLAFMQQHHQDTSIQVLELLQ
A0A3A0DET7      -------DDIIN-----VSAELPNA-ADAAQLVNSIVDAYVSKYAEQRKTNTVEVLTILR
A0A3B8PNV4      -------TNLID-----VRYRSRDP-QVAATVVNHIVESYLTLMQGIHKNNAGNDIQFMT
A0A3D1DR40      -------TNLID-----VRYRSRDP-QVAATVVNHIVESYLTLMQGIHKNNAGNDIQFMT
A0A2E7RYU8      -------TNLID-----VRYRSRDP-QVAATVVNHIVESYLTLMRGIHKNNAGNDIQFMT
A0A3B8LXG8      -------TNLID-----VRYRSRDP-QVAATVVNHIVESYLTLMQGIHKNNAGNDIQFMT
A0A6M5Z0K7      -------TELVR-----VSMSSRGSGDDLRPIVHAVVRSYMSKSIEVEVDEKFKHLELLK
A0A350CI62      -------TNVMD-----ISYRSRDP-RAAAAMLTAMLAGYEQFLNETNRGLSEQGLKTLA
A0A4P5WQK6      -------TNVMD-----ISYRSRDP-RAAAAMLTAMLAGYEQFLNETNRGLSEQGLKTLA
A0A3C1X4W5      -------TNVMD-----ISYRSRDP-RAAAAMLTAMLAGYERWLNETNQGLSEQGLKTLG
A0A3D3W3A7      -------TNVMD-----ISYRSRDP-RAAAAMLTAMLAGYERWLNETNQGLSEQGLKTLG
A0A7Y5SKC2      -------TNIIK-----VSYESKDP-NAAVAVVDAVVRSYLNFSAETYKTTAGEIIQILG
A0A7X7U104      -------DELIS-----VSFMSPYP-EEAAHVVNTVVDAYVTFHGQRKRNTSGELLKILT
F0SI78          -------EDILL-----FTFTCGHP-KDAQKVLEAVIASYFAFLDESQRTASNRTVDLIK
A0A517MDV3      -------ELAYAPLTFVAEFRHNDA-ADCALVLSAITESYQDFMAATLQDANSEATGLIQ
A0A518IQ30      -------TSIIE-----LSYRSKST-PAAQAVLQAVVESYLEFIDTSHKDVSVEIATILK
A0A517LWP4      -------TSIIE-----LSYRSKST-LAARAVLEAVVESYLEFIDTSHKDVSVEIATILK
A0A518JNW8      -------TSIIE-----LSYRSKST-LAARAVLEAVVESYLEFIDTSHKDVSVEIATILK
A0A2E3GWX1      -------TNLLS-----VNYRTTDP-KSAAIIVTEILNSYFAFMQDMHQNSSREMLKLLT
F0SG60          -------TNLLS-----VNYRTTDP-KSAAIIVTEILNSYFAFMQDMHQNSSREMLKLLT
A0A2E9VST2      -------TNLLQ-----VSYCSESP-EVASLIVTEILNSYFQFMHEMHESSSGELLETLT
A0A356A6X2      -------TNLLE-----VKYCSESP-EESSTIVTEILNSYFKFMHEMHESSSGQMLDTLT
A0A5C5XLM3      -------TNLLE-----VKYCSESP-EESSMIVTEILNSYFKFMHEMHESSSGQMLDTLT
A0A7V2UW16      -------SRLVD-----VTVTHGEP-AKAAAWASALVKAYIDDAVERRAGLGREALAQLR
A0A518DRX3      -------TNLIE-----LSYRAKSP-EAATAVVAAILSSYLDFMDKNHKDVSLEIVTILD
A0A518DZF9      -------TNLIE-----LSYRAKSP-EAATAVVAAILSSYLDFMDKNHKDVSLEIVTILD
A0A2E7ENQ5      -------TNFIE-----VSYRSRDD-EAAVAILDAVVESYLDFIDLNQKNVATEIVRILD
A0A7V2XSV8      -------SRLVD-----LFVEHPDP-AKAAAWADALVTEYIADTQERRTGLGREAQAQLK
A0A847GXG1      -------TNVIE-----VSYRSRNP-KAAEAVVQAVVQSYLEFMERNHKNVSAEIVQILE
A0A7C5BZF0      -------TNVLE-----LQYRSKEP-RAAVAVVDAILDAYMEFIEETYQGAAKEIVTLLT
A0A847YGH5      -------TNIIT-----VGYESKDP-ATAVRVVNAVVDSYLEFMRETHQGTAVEIVQTLN
A0A286RLF2      -------TNIIT-----VEYRSKDP-GVAARIVGAVVQSYLDFMRSTTQGTTAEIIRILT
A0A7V3TX18      -------TNIIT-----VEYRSKDP-GVAARIVGAVVQSYLDFMRSTTQGTTAEIIRILT
A0A1G3AQE9      -------KNIIT-----ASYRSRDP-DAAVSVVSAVVACYLKFTDSTLKGQAGEVFDVLS
A0A3L7UQT9      -------TTLID-----VRYRSRSP-KVAAFIVQRIVTEYINNINRTYGNQTQDAVAKLT
A0A4P5YBU2      -------TTLID-----VRYRSRSP-KVAAFIVQRIVTEYINNINRTYGNQTQDAVAKLT
A0A7C7V5U8      -------TNVIK-----IEYRSRDP-DAAVAVVNAVLDSYLEFMEQTQKGTASRVLEVFE
A0A3M1VCL4      -------TSLID-----VRYRSRDP-KAAAAMVEAILAAYLDFMERTHKKGAHDNLEVLT
A0A518AKT8      -------GSFVE-----VRYRSLDP-DAAAAVVSEVVNSYLSFVDQTHKGSAGDTIEMLD
A0A5C5ZR72      -------SELYE-----VAYTSPSA-KESADVVRAVLQQYFARQSDEEYQRAQRVIDLLE
A0A7Y5SJZ4      -------TNLMD-----IAYRSTDP-DAAAAVVECVLQAYVSFMELLHRSTGRDMLEVLT
A0A5C5V7Z9      -------TKFIQ-----VSYRSHQP-ESAVAVVNSVINSYLRFVEETHRSTAADVLDVLT
A0A5C5YT05      -------TKFIQ-----VSYKSRRP-ESAVAVVNAVINSYLHFVEETHRSTAAEVLDVLT
A0A518D7F9      -------TNVIE-----VRYRSKEP-EAATAVVTSVINSYLAFVDRTHRGAALDIHEMLT
A0A5C5ZIP0      -------TNFVS-----VAYESLHP-EAAAAVVNAVINSYLEFVEETHRGTAADVLNVLT
A0A518KBK3      -------TNFIN-----VGYDSLDP-EAAAAVVRAVIEAYVDFVGETHRGTAAEVLDVLT
A0A5C6AKF9      -------TNFIN-----VGYDSLDP-EAAAAVVRAVIEAYLDFVAETHRGTAAEVQDVLT
A0A7C2KUQ9      -------TSLID-----ITMQARDK-TSAAKIVNAVARRYEAHSDEQQRMKSDLRWQELD
A0A7C5R0U3      -------THLIE-----LAYRSRSP-RVAHATLESLISAYHDFIDEHHRGMAVEVADLLE
A0A847YCQ7      -------ADILE-----ISMKGEDP-QQIKEIVNAVKDAYMEQVVNVDREFVLRRKELLQ
A0A286RD13      -------AEILE-----ISMTGGDP-EQIAAIVNAVKDAYMSEVGDVSRNYALERKKLLE
A0A7V3TUJ6      -------AEILE-----ISMTGGDP-EQIAAIVNAVKDAYMSEVGDVSRNYALERKKLLE
A0A517TY85      -------SELFE-----VAFHSRSP-DDAATVVNAVVMTYLEKNREKETDRSKLVISELE
A0A5B9QEI7      -------SELYE-----VSFVSPSS-QDAASVANVVVAEYLALQNREERQRSQMVIEVLE
                                                                            

A0A5S9IPR9      -QV-------------VPNLEKKIREKRDI-----LIKLQQEYPEIR-------------
A0A533Q9U4      -KQ-------------LKDVKIALEESEAA-----LQRYKRENDLISVEAV---------
A0A533Q6B7      -KQ-------------MENVKDAVEQSELA-----LQKYKKENNIFGIEPVGSGESGRIE
A0A1U9NNE1      -NK-------------RASTAKQMQQQRKI-----IRQLAEEFGT---------------
A0A2G2JCA2      -TE-------------KNSRESGLKDLRGV-----VKTLAIETTGKDPYVVTSSSERAGT
A0A1G2XVR0      -DQ-------------LVDKKLKVEEAEEA-----LILYKEKQNIVG-------------
A0A1G3B0P0      -DQ-------------LVDKKLKVEEAEEA-----LILYKEKQNIVG-------------
A0A1E3X4X0      -GR-------------LKDLGKDLEKDEEE-----LQKYKEDEDLIT-------------
A0A286U4B3      -EQ-------------LKEIKIKIEDSEKK-----LYKYARENDIVA-------------
A0A5C6DDS2      -KQ-------------LKEIKKRIEDSEKE-----LYKYARQNDIVA-------------
A0A5S9IJB5      -RK-------------EGELRAELETFANQ-----IQDYVLKNKLIN-------------
A0A2E3GW02      -EA-------------KDDLTESLTKKETA-----YQQFREDS-----------------
A0A5B9QNZ7      -QA-------------RDDMSLEIDQLENT-----YREFRRST-----------------
A0A1Z8N7H5      -QE-------------KDDIGRQLMEEETK-----LADARVAS-----------------
A0A1U7CZ81      -VY-------------LDRLKKDKEEKVEA-----LKEIVERGNVNG-------------
A0A142YNY8      -DY-------------LKKMIDDKKEKVKE-----LSTLMSKGKVDS-------------
A0A1U7GLS6      -TY-------------LDEKQKERKQKEKD-----LAALVDSG-VDA-------------
A0A1G2YPI3      -AD-------------KTKRDKELSETLKK-----LLDFQNDN-----------------
A0A532UIN2      -SE-------------KTKRGKELTEKLTT-----MLDFKKEN-----------------
A0A0S8KNX5      -NE-------------RKLLAEKMESQRQA-----IYRLGQEY-----------------
A0A3D3UVZ8      -NR-------------RDYLYEKIENDRQT-----IYQLGQEY-----------------
A0A517NFU9      -KA-------------RETHELELATADRE-----YREFVTSV-----------------
A0A5C5YWH4      -QA-------------RQTHEEELAAADIA-----YREFVKSV-----------------
A0A3D2TNK4      -NE-------------RNQIQASLKSKQLQ-----LQKFRQEV-----------------
A0A7C1Y4F0      -KE-------------KESRDKYLTDKLEE-----MIAFTEEN-----------------
A0A6I0ENW6      -EE-------------EGRLKNTLTSLISS-----RGTFTGKF-----------------
A0A6L3A0B7      -EE-------------EGRLKNTLTSLISS-----RGTFTGKF-----------------
A0A0J1B4A0      -RA-------------QVQNEKALREADQA-----YREFVASV-----------------
A0A142WSB9      -GS-------------RTALIDDISKMEAA-----WKAWRDASPYFY-------------
M5SZR3          -EA-------------RDLLLRDIRKQEFE-----YREFRRES-----------------
M5TW92          -EA-------------RDLLLRDIRKQEFE-----YREFRRES-----------------
A0A2S8FKY2      -RV-------------HSETENKARQMRSD-----FKQLAETLGTSD-------------
A0A517N8P6      -DS-------------RDSIIPKLDELENE-----FTEFRANA-----------------
A0A432MJP4      -EA-------------RDLISKELVDLEQK-----YLEIRKKN-----------------
M5UQ35          -NA-------------QLKNEETLRRADKA-----YREFLASM-----------------
A0A0S8FY64      -RQ-------------MKEQEKALVKAEDD-----LLTYREQT-----------------
A0A1N6KFT7      -RA-------------RDDLKKELDLLQAE-----YHKFRKDN-----------------
L0DFG4          -RA-------------RDELKSELDTLQDE-----YHKFRKNN-----------------
A0A5C5XXG1      -EA-------------KNEVEGELHIAEKK-----YLEHRQTA-----------------
A0A7C7YUM8      -RQ-------------LQGQLVTLQAAERV-----VADLQSEN-----------------
A0A7C2AHI6      -EQ-------------LAAQEQALREAEDE-----VVQLQSLH-----------------
A0A518BJJ1      -SQ-------------LDEQLAALETAEHE-----VVDLQAEN-----------------
A0A518D182      -DQ-------------LDEQTAALETAEAD-----VVALRKQY-----------------
A0A7V4HWU2      -QA-------------KDVLLKQLGEKEEA-----YRKFRQEA-----------------
A0A5C5WTY6      -DT-------------QQQLAAKIGELEQR-----QKLARDQA-----------------
A0A5C5Y033      -DA-------------KRALEADLQAAEEE-----YLVSRQNA-----------------
A0A5C6G1Y2      -DA-------------KRALEADLQEAEEE-----YLVSRQNA-----------------
A0A354PDV6      -HA-------------KDEVESELRNAEQD-----YLTARKAA-----------------
A0A5C6FZ02      -EA-------------KNEVEGELHVAEKK-----YLEHRQTA-----------------
M5TIT3          -EA-------------KQEVESELLASEQE-----HLKARQNA-----------------
A0A5M6CY44      -KA-------------KSDVEESLATAEQE-----QLKARQEA-----------------
F2AXG2          -EA-------------KSVVQKNLKEAEDE-----YLAARRKA-----------------
M2BB46          -EA-------------KSKVEKSLEDAENE-----YLAARQKA-----------------
L7CLQ6          -QA-------------KTDVQGKLTNLEAE-----HLKFRRDA-----------------
A0A0J1B719      -KA-------------KTEVETDLIAAEQE-----HLKARQEA-----------------
Q7UF18          -KA-------------KTEVEAELVAAEQE-----HLKARQEA-----------------
A0A2G1W1E0      -KA-------------KTEVEAELVAAEQE-----HLKARQEA-----------------
K5E235          -KA-------------KTEVEAELVAAEQE-----HLKARQEA-----------------
A0A5C6FFI9      -AA-------------RIENEKELDAADRE-----YREFISSV-----------------
A0A5C5WDJ1      -AA-------------RETHEKELRDADED-----YRNYVASV-----------------
A0A5C5X547      -LL-------------YQEKTKELKAARTR-----LVDLAETAGSGS-------------
A0A353FIP5      -GQ-------------VERIQLELAEAEAE-----LVA----------------------
A0A7V7MJI7      -DQ-------------IKGIQTELEEAEKE-----LVD----------------------
A0A5B1CIK7      -QA-------------KNEVETELVAAEQE-----YLTARQNA-----------------
A0A5C5WHS2      -KA-------------KTEVETDLVAAEQE-----YLTARQEA-----------------
A0A5C6B6G8      -TA-------------KSEVEAELNAAEQE-----HLASRKAA-----------------
A0A5C5ZZN3      -EA-------------KQEVESELLAAEQE-----HLQSRQNA-----------------
A0A5C5XS91      -EA-------------KQDIEADLVAAEQE-----HMKSRQSA-----------------
A0A5C6C4E6      -EA-------------KQDIEADLIAAEQE-----HLKSRQDA-----------------
A0A2E1VVJ1      -KE-------------IERIQGELDAAEDE-----IVK----------------------
A0A3M2AEL0      -DE-------------IERVRRELEDAEQE-----LVS----------------------
A0A2A2W9R6      -KA-------------QVQNEIALQKADQE-----YRDFVASV-----------------
A0A518HKC1      -KA-------------QVQNEIALQEADQA-----YRDFVASV-----------------
A0A518L3P0      -KA-------------QDQNEVALQKADQE-----YRDFVASV-----------------
A0A255R1S0      -NA-------------QAKNEEELRAADKA-----YRDFVASV-----------------
A0A5B9MKP1      -KA-------------QLRNEMDLRKADEE-----YRNFVASV-----------------
A0A351FYP6      -ER-------------MKKTNDEITAMQAN-----VDDLRAKLGISD-------------
A0A0S8J591      -NR-------------AQDIKREQDKASRA-----VQDFSAERE----------------
A0A532UT69      -SE-------------KTKRTQELSEKLKT-----MTDFKKANE--A-------------
A0A7V9G2R2      -SE-------------IGEAKKKLAVAQTE-----QQQFQSEKG--I-------------
A0A2D5AWU0      -GE-------------LGSILKVRDDLTEK-----IIRLRTENN----------------
L0DC26          -ST-------------WNRYQESLREKRKQ-----LKRLTELAGSDD-------------
M5RT57          QEKQARSVE-------IQNLREKMRQLGQD-----VVGMDPYTG--M-------------
D5SZ21          -KE-------------KVELEQKLATREAE-----LIELRGRSLTFV-------------
A0A7X7U1J4      DEK-------------SKRSEELLAKLGRM-----MEFRQQNED--L-------------
A0A7V8E5N8      KET-------------LPDIRKAITAAEAG-----LAEFQASSG--F-------------
A0A356KTN1      -EQ-------------ADLLYQKLTKSEQD-----LRDFLNQSA--E-------------
A0A7Y5LV28      RDT-------------LPGIRRQVEEAEAA-----VRNFQATSG--Y-------------
A0A7Y5HFQ5      -DR-------------RKALRQELDAVDAR-----IREFR-ERI--F-------------
A0A7W1FMQ9      -DQ-------------VKEANERLAGMRAN-----EAAFRAKHG--I-------------
A0A7W1NA62      -EQ-------------VDLARTRLDEAHAR-----EEAFRLDNG--I-------------
A0A7V9JTP9      -KQ-------------VADERDRVKDARAQ-----AQRFRSEHN--V-------------
A0A7W1FJ38      -TS-------------VDTARGRWDEARRK-----EHEFRREHA--I-------------
A0A1G2YQB7      -NE-------------RRVMGEKIERQRKT-----LNDMAQEFG--T-------------
A0A353P687      -DE-------------RRVMAEKIERQRKT-----LNDMAQEFG--S-------------
A0A356EME5      -RE-------------IANRKKHVEEKRRQIQTRTLAETGKDPF--A-------------
A0A3L7P4E4      -DA-------------KEEWLTTLRKCEDE-----YAEFRKSSS--L-------------
A0A3L7PEB5      -NA-------------KDEWTTNLRKLEAE-----YAEFRKTTS--L-------------
A0A1U9NL64      -KE-------------KTKRAKELEENLHA-----MMNFKRENE--G-------------
A0A2N1UCJ3      -KE-------------KITRDQELSANFKE-----LLEFTRQYG--V-------------
A0A7V2H881      -AQ-------------KDKVAKDLEAKYNE-----RLQFQRENA--S-------------
A0A7C4EK84      -RE-------------KDRRDAELAEKLRA-----MLEFKQANG--A-------------
A0A7C3F0T2      -RE-------------KARRETELAAALKA-----MTDYQKSND--L-------------
A0A7X7U4K9      -KQ-------------IELADQQVAKKRRE-----LADLKKT----M-------------
A0A2E0X4J3      -EE-------------KRDRQAELDAAQTA-----LDDFRNAHP--E-------------
A0A838QZ11      -SE-------------KERRDAELEERRQA-----LDDFREQHQ--E-------------
A0A5C5YU10      -GE-------------KQRRDKVLIEARRE-----LTAFREANP--E-------------
A0A517MPZ6      -NE-------------KQRRDAELEQRIEA-----LEKFRGQNA--A-------------
A0A5C6CNV7      -NE-------------KQRRDAELEARRQE-----LIEFRQQNA--A-------------
A0A518K5H4      -SE-------------KQRSDQDLEERRQA-----LDEFRRDHV--T-------------
A0A5C6AA28      -SE-------------KQRRDDELESRRKA-----LESFRQEHV--S-------------
A0A2E7ESJ6      -KA-------------KDDLLKKWQMLERE-----YGEFKASTPL---------------
A0A2E9VK20      -QI-------------NNDLSPRLAAKTKE-----YHEFRRNAPLVWKAPAGA-------
A0A3D4PJK1      -QI-------------NNDLSPRLAAKTKE-----YHEFRRNAPLVWKAPAGA-------
A0A355AI52      -NE-------------KEEVDKKIQVKQEE-----FLAVRKKVGDLG-------------
A0A354PCQ3      -PE-------------IQRWEQEVAERRRV-----VQKLSEQTLGYA-------------
A0A0S8GZ23      -KL-------------KLELENKLKNHLQE-----LRKINEKYG----------------
A0A1I3DDV4      -QA-------------QGKIESDLKSLEEQ-----YVQARQSAPI---------------
A0A7V2UF66      -TE-------------KAKRDAEFSEKLKA-----LMEFKEANPA---------------
A0A2E0SMM6      -QD-------------QANLIAQYKQNATD-----LIELQRRSDLL--------------
A0A3L7SI46      -RE-------------KAQSEVAIRNKETD-----LLGLKRDSGIL--------------
A0A5B9PJZ8      -TL-------------NENMLSRTKEVQEE-----IEKLMGLPEM---------------
A0A2S8G191      -RA-------------YSETENELRSKRSE-----FRRLADTLGTGD-------------
A0A2E7EGG1      -DE-------------RARRSEEIKLLQAE-----VRQLQKQLVANDPSL----------
A0A2E2N5A9      -SR-------------LEELRQKLQESENR-----LQAYRESEG----------------
A0A7C8AGA2      -EE-------------RRNLAEKIQRQQDT-----IRQLADEFG----------------
A0A7C2FXP7      -EE-------------RRVLAENMQRQRHD-----ILEMGKEYG----------------
A0A1P8WP26      -AQ-------------FAEVTKELQELQAY-----RDELTKRSPDFVG------------
A0A3L7V1F3      -QQ-------------LKDDNERLTLAEAE-----RLRLRNSAPELVE------------
A0A2E3GWC6      -QI-------------NNDLTPRLNAKTEE-----YQRFRDEAPLLWKAPPGA-------
F0SLB0          -QI-------------NNDLTPRLNAKTEE-----YQRFRDEAPLLWKAPPGA-------
A0A3L7NDH9      -KE-------------KTDVDLRLQKTEAE-----FLVIRQRVGDLG-------------
A0A7X8IIB9      -AQ-------------RRILEEQMRRQRAQ-----IRERVDEFG----------------
A0A532UD06      -KE-------------KVRRDEELSGKFSE-----LLAFTRENGV---------------
A0A660URN1      -KE-------------KVKRDAQLTEKFQQ-----LVQFTKENGI---------------
A0A517ZCB5      -QR-------------KDALERDLKAREAE-----LIEMKSRSQLLF-------------
A0A225EH48      -AH-------------LETLNRLIKSREDR-----LKDWVKLGQAPG-------------
A0A518INW8      -QA-------------QLTNEQELQQATQA-----YTNFLSTSVG---------------
A0A518JPH9      -QA-------------QATNEQELQDATQA-----YTAFLATSVG---------------
A0A5C5VEK8      -SE-------------QERRDAALAEARQD-----LTAFREANPE---------------
A0A532UTJ0      -DR-------------RKGLYEKIDNERKT-----IYQLGQEYGDIV-------------
A0A2E2CCW9      -EA-------------EKQIAAELELKKNE-----YKKFRENAPLYWESTPGS-------
A0A3C0AGX3      -EA-------------EKQIAAELELKKNE-----YKKFRENAPLYWESTPGS-------
A0A518AAQ5      -KA-------------NKSLLAELERKKKE-----YTEFRKDAPLYWESTPGS-------
A0A517QBG9      -KA-------------NKSLLAELERKKKE-----YTEFRKDAPLYWESTPGS-------
A0A518FTU3      -KA-------------NKSLLAELERKKKE-----YTEFRKDSPLYWESTPGS-------
A0A517WHH5      -KA-------------NKALLTELEQKKKE-----YKEFRKDAPLYWESTPGS-------
A0A5A8BGT3      -KA-------------NKALLTELEQKKKE-----YKEFRKDAPLYWESTPGS-------
A0A2E7K7A9      -KA-------------NESILSDLEKKKQE-----YKEFRKDAPLYWENTPGS-------
A0A517PTS5      -KA-------------NESILSDLEKKKQE-----YKEFRKDAPLYWENTPGS-------
A0A6I6AH34      -KA-------------NESILSDLEQKKKE-----YKEFRKDAPLYWENTPGS-------
A0A517VTK3      -QA-------------NKQILNDLERKKKE-----YREFREDAPLYWENTPGS-------
A0A517WQT4      -QA-------------NKQILTDLERKKKE-----YREFREDAPLYWENTPGS-------
A0A517VID8      -DA-------------EQQIATELELKRNE-----YQKFRENAPLYWESTPGS-------
A0A517RK10      -VA-------------NQQISTDLEQKKKE-----YKEFREKAPLYWENTPGS-------
A0A518IH18      -EA-------------NQQILSDLEQKKKE-----YKEFREKAPLYWEHTPGS-------
A0A7W0M4Y4      -QA-------------KDELLKDLKALESD-----YAKFRKEIPV---------------
A0A2D5NDU9      -MD-------------RKRYEVEYDTALRA-----LDEYCKKHPA---------------
A0A5C5XLF4      -QI-------------NNDLSPRLAAKTKE-----YHEFRRSAPLVWKAPAGA-------
A0A518CHE5      -ED-------------QTKMENQYQENANQ-----LIELQRRSDLL--------------
A0A1V5N3W2      -SE-------------RKAIQDKIQRQQET-----IRKMGEEYGTIA-------------
A0A517NSK8      -QL-------------ANDTADEVREAEQN-----LTKHLASSKV---------------
A0A5C5Z0D6      -EL-------------SDKTAQDVKDAEEA-----FASHVASSTL---------------
A0A7W5H7D9      -QL-------------ANETGRDVREAEKQ-----LADQLANSAI---------------
M5UE94          -QL-------------SEETAQEVRDAERK-----LAEHLAGSQI---------------
A0A3E0MY27      -RQ-------------HQELEADIGRRRKR-----YNDMVAEVDVFD-------------
A0A7V4M591      -KQ-------------RTEVGKSLRAIQDQ-----LVEARRQLDDIK-------------
A0A7X7F3G7      -RQ-------------LADVGRELKQKEES-----LIHAQTECGVLP-------------
A0A7Y4VQ32      -AE-------------QSELKTEIDGKIRT-----RQVLEKKLG----------------
A0A2E0X9P6      -QE-------------RHARSSRLEQLRRR-----VVELSREVTGTDPF-----------
A0A1N6DAJ8      -ET-------------WNRYQENLREKRKE-----LKRLTELAGSDD-------------
A0A2E8FLY0      -AE-------------KKKLDEETNQINAE-----LLNLKRQMQII--------------
A0A3D2U1E1      -KK-------------REKLDEETNAINAE-----LLVLKRQMQII--------------
E8R3W3          -DS-------------YVKFNESLNTKRKE-----LQKLAEQYGSGDPIILEMRYQFHQN
A0A5C5ZM48      -QQ-------------KEKYFEDIKRLRGN-----LVTVADQATKNDPYGGLMSG-----
A0A5B9WF77      -KDTAQAEVAALEEYRKKEIDSKIKMKKDA-----LLKLAKNGGVQFKKDANAKGEP---
A0A7C4Z5R7      -TS-------------YQTHEAELRIKQEQ-----LRALEKKIGVVD-------------
A0A1P8WN28      -RK-------------GETVLKGLLAKENE-----LLEARQNCGDIA-------------
A0A3B9CTT0      -ED-------------RRGVETKLIEKNKE-----LLEERRDCGDIV-------------
A0A518ALT3      -EE-------------LKDREGHIEQLRTR-----VVDLAKDVTGRDP------------
A0A286RGB6      -QL-------------YSEKEADVRKLEND-----LKSLSQQLETGD-------------
A0A7V3TZQ6      -QL-------------YSEKEADVRKLEND-----LKSLSQQLETGD-------------
A0A3M1QRP3      -RQ-------------EELLRKQIEIKEEE-----VDALRKML-----------------
A0A517TMV0      -VQ-------------REKFETELANKQVQ-----LLQIRERIGHLA-------------
A0A3E0MY88      -QE-------------KIQLKGEIDRKKER-----LLEAQRRFGDFT-------------
A0A518BBX8      -QA-------------RDVLRKELRDKEEG-----YREFRLESPL---------------
A0A5B9QF68      -QK-------------GAELEAKLTEKQNE-----LQSFSQAVGHLA-------------
A0A5B9QGF0      -QK-------------GAELEAKLTEKQNE-----LQSFSQEVGHLA-------------
A0A5C6CK24      -QK-------------GAELEAKLTEKQNE-----LQDFSQQVGHLA-------------
A0A7C5FXU1      -QL-------------YSEKEAELRKRRND-----LMQLAEQLQTGD-------------
A0A847YFA1      -QL-------------YVEKESEVRKLQND-----LKQLSAQLETGD-------------
A0A1C3E6N1      -KE-------------KVELEQKLATREAE-----LIELRGRSLTFV-------------
A0A518GJT2      -KE-------------KVELEQKLTTREAE-----LIELRGRSLTFV-------------
A0A2E8B0L9      -KE-------------RVAKEQELQAKQQE-----MLSLKRAVGALG-------------
A0A5Q4GFE7      -RE-------------RLEIEGRLSTKQEE-----ILDVQRRLRDLG-------------
A0A257WS34      -RE-------------KRDLESQLTQKEQQ-----LHGLKSQVGLLLSG-----------
A0A7C4LP10      -RK-------------RDEYAQILDEKESR-----LHQLKSQSGILLSG-----------
A0A2E3RCU8      -RE-------------KDNLARQLSAEEVK-----LADARLAAGDFS-------------
A0A517MLW3      -GE-------------REKIEETLHLEQQR-----LIKLRDEAHVVG-------------
A0A5B9QVD0      -AE-------------RTKVEKRLGEQQEK-----LVELRDETRVVA-------------
A0A3A0DET7      -NE-------------KHKRDAELAECRKA-----LDDFRQQHME---------------
A0A3B8PNV4      -AE-------------KKKLDEETNRINSE-----LLDLKRQMQII--------------
A0A3D1DR40      -AE-------------KKKLDEETNRINSE-----LLDLKRQMQII--------------
A0A2E7RYU8      -AE-------------KKKLDEETNRINSE-----LLDLKRQMQII--------------
A0A3B8LXG8      -AE-------------KKKLDEETNRINSE-----LLDLKRQMQII--------------
A0A6M5Z0K7      -TI-------------ALNYQIEIDKQRSS-----LKSAMTLN-----------------
A0A350CI62      -TR-------------LEAIEQEVKELQSR-----RLHLKASAPELVDT-----------
A0A4P5WQK6      -TR-------------LEAIEQEVKELQSR-----RLHLKASAPELVDT-----------
A0A3C1X4W5      -TR-------------LEVIEQEVKSLQAR-----RLQLKASAPELVDT-----------
A0A3D3W3A7      -TR-------------LEVIEQEVKSLQAR-----RLQLKASAPELVDT-----------
A0A7Y5SKC2      -KE-------------KNQLAEQMARKNEE-----LLQARRALGDMG-------------
A0A7X7U104      -EE-------------KTKRDAELDTKLQA-----MMEFKQKSEGL--------------
F0SI78          -EA-------------KDDLTESLTKKETA-----YQQFREDSALLW-------------
A0A517MDV3      -QA-------------RDDLTLEIDQLEQS-----YREFRRGTPLLTLGPDSLTKNQIRL
A0A518IQ30      -DE-------------LREKERDLKAKQEE-----WVQVSRDAGDLG-------------
A0A517LWP4      -DE-------------LREKERNLKAKQEE-----WVTVSRDAGDLG-------------
A0A518JNW8      -DE-------------LREKERDLKAKQEE-----WVTVSREAGDLG-------------
A0A2E3GWX1      -AE-------------RKKVEQQMTDKQNE-----LLRLRAESDSL--------------
F0SG60          -AE-------------RKKVEQQMTDKQNE-----LLRLRAESDSL--------------
A0A2E9VST2      -TE-------------RDNIQKQIFEKQAE-----LLNLQRDSDSL--------------
A0A356A6X2      -KE-------------RDNIQNQILVKQSE-----LLDLQRESDSL--------------
A0A5C5XLM3      -KE-------------RDNIQNQILVKQSE-----LLDLQRESDSL--------------
A0A7V2UW16      -AE-------------EEEMRGRLDAKEQA-----IQSFCEAKGLVS-------------
A0A518DRX3      -QE-------------RKQVEETLAEKQDQ-----MLDLQHRVGDLG-------------
A0A518DZF9      -QE-------------RKQVEETLAEKQDQ-----MLDLQHRVGDLG-------------
A0A2E7ENQ5      -KG-------------RSDVASQLDAKEQE-----LLVAQRETGDLG-------------
A0A7V2XSV8      -KE-------------ADEMRVQIDAQEKA-----IQAFREAHGLVS-------------
A0A847GXG1      -KE-------------RAEISGQLDKRQRD-----LIDVQKKVRDLG-------------
A0A7C5BZF0      -SE-------------KSQLEERLAEKEAQ-----LLALRQEAADLG-------------
A0A847YGH5      -KE-------------KDDLSLRLSEKEQQ-----LQDLSRSLGALD-------------
A0A286RLF2      -TE-------------KDDIAARLSEKEQA-----LQQLSQQIGALD-------------
A0A7V3TX18      -TE-------------KDDIAARLSEKEQA-----LQQLSQQIGALD-------------
A0A1G3AQE9      -QE-------------KNTLGVELSHKEQE-----RLALRQQCGVLR-------------
A0A3L7UQT9      -EE-------------KKETSRKLTEKNQE-----FLELQSQTGNIY-------------
A0A4P5YBU2      -EE-------------KKETSRKLTEKNQE-----FLELQSQTGNIY-------------
A0A7C7V5U8      -LQ-------------LDQGRAQMVAVETA-----LRQAREEVGAFA-------------
A0A3M1VCL4      -RK-------------QRQLEEEIRSKESQ-----LAALRSASEEI--------------
A0A518AKT8      -GR-------------LKQVQTDIQDKQRQ-----LIELRDRVGHLA-------------
A0A5C5ZR72      -RE-------------RARRQFEVERLRKH-----VIDLAKDLTGMDPF-----------
A0A7Y5SJZ4      -QQ-------------KDKLEGELQTKESE-----LLALRSKAG--V-------------
A0A5C5V7Z9      -VE-------------RDQLQEELLQKQRL-----LQACRERCGHLA-------------
A0A5C5YT05      -IE-------------RDQLQSELLRKQKL-----LQEARERCGHLA-------------
A0A518D7F9      -TK-------------HAQLVEELDAKQRE-----LQQVRNEVGRLV-------------
A0A5C5ZIP0      -VE-------------RDQIEQDLIVKQQL-----LQEFRQRIGHLA-------------
A0A518KBK3      -IE-------------RDQLEQSLAAKQLE-----LQQSRERVGHLS-------------
A0A5C6AKF9      -TE-------------GTKLKQELSAKQLE-----LQQTREQVGHLS-------------
A0A7C2KUQ9      -QR-------------KRDLETEIAHHKEM-----VLKYRTDLG----------VTTADE
A0A7C5R0U3      -RE-------------RHDVQSRIEQKQQQ-----LRRVQRALSTAG-------------
A0A847YCQ7      -QS-------------YERTLELVKNRSAR-----YEELANAVGSSDSEVVRRKAVTALE
A0A286RD13      -AN-------------YAQTLELVKKRDQR-----YRELANAVGSADSEVARKKALTALE
A0A7V3TUJ6      -AN-------------YAQTLELVKKRDQR-----YRELANALGSADSEVARKKALTALE
A0A517TY85      -KE-------------SADRSMRVELLRKE-----VIALARKLTGTDP--FQPGLVTDVG
A0A5B9QEI7      -KE-------------RLERGTKVDQLRKR-----VVELAKDLTGKDP--FGQGVVTDAV
                                                                            

A0A5S9IPR9      -------------------------TYNLE---KEGRAIS-RV--EAAKSDLYELERSMY
A0A533Q9U4      -------------------------GSENLTSEKQNVVLQ-KL--MELNTAVTYARTERI
A0A533Q6B7      DP-------------------------------QHNVVFQ-KL--EEINAAITKAKIERL
A0A1U9NNE1      -------------------------TSLTG---RQEMMLE-QV--MKLQNELTTLETKRI
A0A2G2JCA2      YS---------------------------------------PV--SELQSRLVSAKVEKL
A0A1G2XVR0      -L-----------------------GE------TAGIIEQ-KL--EGLKSNLTETKIEKV
A0A1G3B0P0      -L-----------------------GE------TAGIIEQ-KL--EGLKSNLTETKIEKV
A0A1E3X4X0      -L-----------------------DNLGTVEQRQNIVLE-KL--SELSTELTRAKTQRI
A0A286U4B3      -M-----------------------DA------SQSIILK-EL--TTISDELTRAEAERI
A0A5C6DDS2      -M-----------------------DA------SQNIFMK-EL--ITISEELTKAEAVRI
A0A5S9IJB5      -------------------------VESRQ-----NIIFQ-RL--NDINEKLTEIELKRI
A0A2E3GW02      -A-LLWT------------------SDEGN-----NLHQA-RL--AQIEGQRSELLIKSS
A0A5B9QNZ7      -P-LLTL------------------GPDSL-----NKNQI-RL--AALHSELIRLQLRES
A0A1Z8N7H5      -------------------------GDFSI-----SAESN-IV--HPVVQSVITLNEAFL
A0A1U7CZ81      -QSAGESKPKESTKTQGSDP-----APQTKDASIEKFSIE-QY--RNFKADILKKKLELN
A0A142YNY8      -QSLTPNQASQANTAGPAAPADGTVQDSSKARNLGDVSIE-QY--RKWKDRLLETQVDLF
A0A1U7GLS6      -RNVAQREPAPDR------------QGEDPATTLQDVSME-EL--RTIKAQLLDVQIELM
A0A1G2YPI3      -PDIVLE------------------DSRG------NILIE-QL--QRWSTLLTEAKLKTI
A0A532UIN2      -EALAFE------------------GSRG------NIVIT-RL--ERLSQELTEAQLATI
A0A0S8KNX5      ---GTVA------------------LGSRT-----DMMLQ-RV--GSLLSTLTEVEAERI
A0A3D3UVZ8      ---GTVA------------------LEGRQ-----DMMLQ-RV--ASLLDTLTSVEAKRI
A0A517NFU9      -P-VLIE------------------GSTVQ-----DVHKD-RL--ENLEAELNIVTTSLA
A0A5C5YWH4      -P-VLIE------------------GDSVQ-----DIHKE-RL--ANLEKELHLVTNSLA
A0A3D2TNK4      -GHLAVS------------------TEDGVI----DPKIQ-RV--MKLNEVLLTAQEKRL
A0A7C1Y4F0      -GIVSFD------------------DKGG------NIVFE-ML--RTLSTELSQAEMAAM
A0A6I0ENW6      --------------------------GSASLEDVQTLHNS-ER--LKLQGELRSLETTIK
A0A6L3A0B7      --------------------------GSASLEDVQTLHNS-ER--LKLQGELRSLETTIK
A0A0J1B4A0      -P-ALIS------------------SNINGRDSLEDVHRL-RL--NNIEQQLGGIRESLS
A0A142WSB9      -PTPPVV------------------TVNGVATPQMSPQAQ-AL--DRVIREQESIQTQRA
M5SZR3          -P-LLTT------------------DEGGS-----NPVYS-RI--AAIQRQQSELLLRRT
M5TW92          -P-LLTT------------------DEGGS-----NPVYS-RI--AAIQRQQSELLLRRT
A0A2S8FKY2      -S-ETLS------------------LAQQGSVQHYGLVRN-EL--AQVRFELMRAEGELD
A0A517N8P6      -P-LEWN------------------GKGEAI----NPYRD-DA--IRLEDNLYNLQSQAR
A0A432MJP4      -T-VLAT------------------DQSGR-----SFITR-RV--DGWDSVINQTLVRAV
M5UQ35          -P-ALVD------------------TNQDGEASLQDVHRI-RL--AQIESELSETRKKLA
A0A0S8FY64      -TIPELG------------------TPNEQ-----SPVLT-RR--RALNDEFTRVQLKRI
A0A1N6KFT7      -P-GFAI------------------GSNGQ-----TLTMR-KL--EQWSQGINNTTDLMI
L0DFG4          -P-GLAI------------------GANGQ-----TLMMR-KL--EQWSQGINNTTDLMI
A0A5C5XXG1      -P-MLFQ------------------GEGSS-----NVYQD-KY--RRLQDELIDLQIQES
A0A7C7YUM8      -P-ETIS------------------LPDAA-----KAVID-RL--SALELQRTQLDLART
A0A7C2AHI6      -P-ETID------------------VSAAS-----QAWID-RV--SDLELRRTQAELART
A0A518BJJ1      -L-DAID------------------SVATA-----ESLIR-NL--SDLEVQRMRLDLQAS
A0A518D182      -P-DLID------------------LTTSA-----GRIVE-QL--SGFEVERLRLDLARH
A0A7V4HWU2      -P-LLWK------------------GSEGS-----NLHED-RM--AKIEAARAEVIVQLA
A0A5C5WTY6      -P-ILFD------------------GSNTT-----NVYEE-RY--RSLQSELVSADLEVS
A0A5C5Y033      -P-LFFQ------------------GEGSS-----NVYQD-RY--RRLSEELLELDIQQS
A0A5C6G1Y2      -P-LFFQ------------------GEGSS-----NVYQD-RY--RRLSEELLELDIQQS
A0A354PDV6      -P-MLFQ------------------GEGSS-----NVYQD-KY--RRVEEELLNVDIEES
A0A5C6FZ02      -P-MLFQ------------------GEGSS-----NVYQD-KY--RRLQDELIDLQIQES
M5TIT3          -P-LFFQ------------------GEGSS-----NVYQD-RY--RRLQEELLDVDIKES
A0A5M6CY44      -P-LFFQ------------------GEGSS-----NVYQD-RF--RRLQDEMLDLDIQES
F2AXG2          -P-LSFQ------------------GEGSS-----NIYQD-RY--RRLQDELLDLDIQES
M2BB46          -P-LFFQ------------------GEGSS-----NIYQD-RY--RRLQDELLDLDIQES
L7CLQ6          -P-LFFQ------------------GEGSS-----NIYQD-RY--RRLQDELLDLDIQES
A0A0J1B719      -P-LFFQ------------------GEGSS-----NIYQD-RY--RRLQDELLDLDIQES
Q7UF18          -P-LFFQ------------------GEGSS-----NIYQD-RY--RRLQDELLDLDIQES
A0A2G1W1E0      -P-LFFQ------------------GEGSS-----NIYQD-RY--RRLQDELLDLDIQES
K5E235          -P-LFFQ------------------GEGSS-----NIYQD-RY--RRLQDELLDLDIQES
A0A5C6FFI9      -P-VLLE------------------GERVR-----DVHKT-RL--EQLESELNTVRTSLA
A0A5C5WDJ1      -P-VLLE------------------GDKVR-----DIHKE-RL--ADIEKELNDVRSGLA
A0A5C5X547      -S-ESLT------------------LNQQSTLSEREILEK-QR--HELRFKRMELEAQLF
A0A353FIP5      -----FQ------------------EEEKA-----SVLSD-TA--QAIVGRMSEIDLEQA
A0A7V7MJI7      -----YQ------------------EKSGA-----ALLTD-AA--RTVVERMAQIDLERA
A0A5B1CIK7      -P-LFFQ------------------GEGSS-----NIYQD-RF--RSLQEQLLDIDIQES
A0A5C5WHS2      -P-LFFQ------------------GEGSS-----NIYQD-RY--RRLQEQLLDIDIQES
A0A5C6B6G8      -P-LFFQ------------------GTGSS-----NVYQD-RY--RRLQEELLDLDIKES
A0A5C5ZZN3      -P-LFFQ------------------GEGSS-----NVYQE-RY--RRLQEELLDIDIQES
A0A5C5XS91      -P-LFFQ------------------GEGSS-----NVYQD-RY--RRIQEELLDLDIKES
A0A5C6C4E6      -P-LFFQ------------------GEGSS-----NVYQD-RY--RRIQEELLDLDIKES
A0A2E1VVJ1      -----YQ------------------EANET-----PVLPE-VA--KAIVEQQSSLTLELA
A0A3M2AEL0      -----YQ------------------EAEGA-----VALSE-EA--SLLVQRLSELDLRDA
A0A2A2W9R6      -P-ALLN------------------VSGSGVGSLEDIHRT-RL--KSIEVELATVRAALA
A0A518HKC1      -P-ALLN------------------VSGSGVGNLEDIHRT-RL--KSIEGELASVRTALA
A0A518L3P0      -P-ALLN------------------VSGSGVGNLEDIHRT-RL--KSIESELANVRTALA
A0A255R1S0      -P-ALVL------------------SGG-------NIQRD-RL--TAIEAELNTIRRTIA
A0A5B9MKP1      -P-ALVN------------------VSGSGVGTLEDVHRA-RL--KSIEEELASVRRVLA
A0A351FYP6      -A-----------------------AGEDS---YSIVEPE-IV--RRYESELITAKGLYT
A0A0S8J591      -I-----------------------YALPE---IRSVVLT-NE--RWLQEAAAQANVEMI
A0A532UT69      -L-----------------------ALEGE---RGNVVTE-RL--ARLSSVLTEAQLATV
A0A7V9G2R2      -F-----------------------N-TDP---DKSYPAQ-RL--TALNSKRVILGEQLG
A0A2D5AWU0      --------------------------ITQG---GETLIQA-RL--TQTRELWTDAHFDML
L0DC26          -K-----------------------TTLAS---IHQHELD-RL--GRAEDELSRIQSELR
M5RT57          -P-----------------------Q--KN---GGQAGAG-PL--ERLRERLTAAEVDRK
D5SZ21          -S-----------------------NGTDN---ATNVAVA-RV--VRLNEEFMKAKEETL
A0A7X7U1J4      -A-----------------------MGTER---DTNIIVQ-RL--GRLSAALTEAQLEAM
A0A7V8E5N8      -V-----------------------D-FED---RTNSYRS-GW--NKSNERLTEVRLKRI
A0A356KTN1      -T-----------------------PLLEE---HEKLLVE-RI--RINNNALSDIQRQRI
A0A7Y5LV28      -I-----------------------D-QEE---QYRTLLE-GW--RKVSTTLVDVRLRRI
A0A7Y5HFQ5      -N-----------------------A-PEL---RVSDVTA-EK--AKADKLLADFEARVD
A0A7W1FMQ9      -L-----------------------S-ADP---DRNVHTQ-RL--EDLARRQVDLEQKLE
A0A7W1NA62      -Q-----------------------S-TDA---ERNHLAL-RV--QEMTQARAGLERELS
A0A7V9JTP9      -L-----------------------G-SDP---DHNQYSD-RL--AALNLQRVDLDRQLA
A0A7W1FJ38      -V-----------------------S-GAA---ETSPVSQ-RI--DLLNRERTTLDQQLA
A0A1G2YQB7      -I-----------------------VLDNR----QQMMMN-HI--SRMQEKLTELELERI
A0A353P687      -V-----------------------ILDNR----QQMMMN-HL--AKLQEKVTELELERI
A0A356EME5      -T-----------------------TLHAG---SGANWPH-PL--AGLQTRLTEVEVERE
A0A3L7P4E4      -I-----------------------YNGEN---VTSLSES-RM--AGIEIERSKVMIAQT
A0A3L7PEB5      -I-----------------------YNGES---VTSVSES-RM--AGIEAERSKVLIAQT
A0A1U9NL64      -L-----------------------AFENN---GNNIILD-RL--ANLSQAVTDAQLALI
A0A2N1UCJ3      -I-----------------------SFEKS---GGNEVFQ-RL--KALGDSLTIAQLDTI
A0A7V2H881      -L-----------------------SFNRD---VRNPVLE-RV--NAISAELTRAELEAV
A0A7C4EK84      -L-----------------------SFESD---RGNIITQ-KL--ARLSEALTTAQLQTV
A0A7C3F0T2      -L-----------------------AFQGS---DGSFMSK-RM--ESYSSALIAVQNELL
A0A7X7U4K9      -L-----------------------FVPDA---NGAVMGDPEL--PNLAATLRQAQIERI
A0A2E0X4J3      -L-----------------------AVQVR---SSDIVSD-RF--SALTNELNETEIELL
A0A838QZ11      -L-----------------------AVQVH---DGNVVSQ-RF--SSLSQELNTTEIDLL
A0A5C5YU10      -L-----------------------AVLVD---NQDVASD-RF--SRLMSELNQTELEQL
A0A517MPZ6      -L-----------------------AVQVG---EENVITK-RF--AALASELDRVELALL
A0A5C6CNV7      -L-----------------------AVQVG---EENVITK-RF--SSLAQELDRVELELL
A0A518K5H4      -L-----------------------AVQSKEGREGNVVTE-LF--AALSRELNATQIELL
A0A5C6AA28      -L-----------------------AIQSK---EGNVVNE-LF--SALSQELNATQIQLL
A0A2E7ESJ6      -M-----------------------YNGQE---SINVHAQ-RQ--ADYENERVSLQKQMT
A0A2E9VK20      -D-----------------------KGPNN---VTNIHHQ-RV--DAIATERVKVELLYE
A0A3D4PJK1      -D-----------------------KGPNN---VTNIHHQ-RV--DAIATERVKVELLYE
A0A355AI52      -I-----------------------KEGGK---TMHPLVE-RA--IQLNSTLIETQKKRL
A0A354PCQ3      -P-----------------------GSKTS---ILENQGA-IALLTRLRSQIAELTVELS
A0A0S8GZ23      -A-----------------------DSLEG---LQRVALG-DI--TSLREQLRNLELVIS
A0A1I3DDV4      -I-----------------------YVGNE---SSNVYLD-TF--RRLQDELVTVDIERS
A0A7V2UF66      -L-----------------------LFEVK---GGNIIVE-GL--SRLSDALNAAHLETI
A0A2E0SMM6      -L-----------------------NNGTE---TVSLVGQ-RI--IALQNSYMEAQNQMI
A0A3L7SI46      -L-----------------------HGNDK---NSHVIIE-QT--VKLNDALIEAQKKTL
A0A5B9PJZ8      -L-----------------------IVDGR---VQNPYQL-QQ--ARLHEELHQLRRERT
A0A2S8G191      -T-----------------------ASLSL---VQQNALQ-QF--AALRSELTRVQLDLL
A0A2E7EGG1      -T-----------------------STSLI---GSDVVIS-ESPLKSMQENLAKAQIEHK
A0A2E2N5A9      -L-----------------------VDLQG---ISTIAAT-EL--TLTSDRLINARRQRA
A0A7C8AGA2      -S-----------------------TELTS---RQEMMLQ-QV--TSLQNELININIRRI
A0A7C2FXP7      -D-----------------------TALGT---RHEMKME-RV--ARLLSELTELEAERI
A0A1P8WP26      -V-----------------------GDGES---VVNLSVA-NM--KHLLARLSEAQQEAA
A0A3L7V1F3      -T-----------------------GDKNS---GLSIVSE-TI--RLLNIDYSAARRISE
A0A2E3GWC6      -D-----------------------AAPGD---VTNIHHQ-RV--DAIAAERVKVELKYQ
F0SLB0          -D-----------------------AAPGD---VTNIHHQ-RV--DAIAAERVKVELKYQ
A0A3L7NDH9      -I-----------------------KSDGK---VMHPLVE-RA--IQLNAALIEAQKKRL
A0A7X8IIB9      -T-----------------------EQLTP---RQEIALQ-QV--ATLKQEQIAIGVQRM
A0A532UD06      -V-----------------------SFNDN---GGNIVLE-RL--TRLSNALTETQLAAL
A0A660URN1      -V-----------------------SFDDK---NGPIVFQ-RL--AKLSTALTDAQLATI
A0A517ZCB5      -A-----------------------SDEDR---MISVLNQ-RV--IKLNESLVKAQHEAI
A0A225EH48      -E-----------------------QASVL---KMKLLTD-EV--SKFNSTVSSLSLEIV
A0A518INW8      -M-----------------------FDGDQ---LQSVSHN-RL--QSIEQELANVRSQLT
A0A518JPH9      -M-----------------------LDGEQ---LHSVSHD-RL--QTLEQEIAEVRSQLV
A0A5C5VEK8      -L-----------------------SVQVD---NQDVASD-RF--SRLMNELNQTELEQL
A0A532UTJ0      ---------------------------LEG---RQEMMRE-RV--IALLDRLTAVQLDKI
A0A2E2CCW9      -E-----------------------AAVAG---STNVHQE-RV--KAIDNERRLNLLKLT
A0A3C0AGX3      -E-----------------------AAVAG---STNVHQE-RV--KAIDNERRLNLLKLT
A0A518AAQ5      -E-----------------------AAVAG---STNMHQE-RV--KAIDNERRQNLLKLT
A0A517QBG9      -E-----------------------AAVAG---STNMHQE-RV--KAIDNERRQNLLKLT
A0A518FTU3      -E-----------------------AAVAG---STNMHQE-RV--KAIDNERRQNLLKLT
A0A517WHH5      -E-----------------------AAVAG---STNMHQE-RV--KTIDNERRQNLLKLT
A0A5A8BGT3      -E-----------------------AAVAG---STNMHQE-RV--KTIDNERRQNLLKLT
A0A2E7K7A9      -E-----------------------AAVAG---STNMHQE-RV--KTIDNERRQNLLKLT
A0A517PTS5      -E-----------------------AAVAG---STNMHQE-RV--KTIDNERRQNLLKLT
A0A6I6AH34      -E-----------------------AAVAG---STNMHQE-RV--KTIDNERRQNLLKLT
A0A517VTK3      -D-----------------------AAVAG---STNVHQE-RV--KAIDNERRLNLLKLT
A0A517WQT4      -D-----------------------AAVAG---STNVHQE-RV--KAIDNERRLNLLKLT
A0A517VID8      -E-----------------------AAVAG---STNVHQE-RV--KAIDNERRLNLLKLT
A0A517RK10      -E-----------------------AAVAG---STNVHQE-RV--KAIDNERRLNLLKLT
A0A518IH18      -E-----------------------AAVAG---STNVHQE-RV--KAIDNERRLNLLKLT
A0A7W0M4Y4      -L-----------------------GQGEE---VINSHAV-RL--ADIEAEKTSLMLRAS
A0A2D5NDU9      -M-----------------------RLDMQ---GARASVE-EH--GRVRKLIHDVDQRLL
A0A5C5XLF4      -D-----------------------KGPNN---VTNIHHQ-RV--DAIATERVKVELLYE
A0A518CHE5      -L-----------------------NSGSE---TVSLVGQ-RI--LSLQTAYTEAQNQMI
A0A1V5N3W2      ---------------------------LTG---RQDMMLA-RV--SDLRQQLTQIESKKL
A0A517NSK8      -M-----------------------WDGSK---TTNIYKK-RL--ESIEIDLLELTENEA
A0A5C5Z0D6      -M-----------------------WDGQK---ARNIHKD-RL--MKIEESLLELTEQEA
A0A7W5H7D9      -M-----------------------WDGEK---TRNIHKE-RL--DKIEEDLHDLTETEA
M5UE94          -M-----------------------WDGEK---TRNIHKE-RL--EKIEDDLHELTEREA
A0A3E0MY27      -G-----------------------GQADA---NRELLMA-EQ--KSLREEIGLIRIDIL
A0A7V4M591      -F-----------------------DSETK---TLHPLLQ-RC--VFFNDALITLRKQRA
A0A7X7F3G7      -S-----------------------GDGKE---ILDPATK-RA--LYFADELSKIERKRI
A0A7Y4VQ32      -T-----------------------SKPDE---IRSREAQ-RL--LELRQELANLDIERE
A0A2E0X9P6      -G-----------------------QGAVF---NLDRALS-PV--DTLYQSLNEIDVNQE
A0A1N6DAJ8      -K-----------------------KTIAN---IHQHELD-RL--GRAEDELARVQSELR
A0A2E8FLY0      -S-----------------------GPDNQ---NINPAAE-RV--AALNKELIVAQNRTR
A0A3D2U1E1      -S-----------------------GPDNQ---NINPAAE-RL--QELNKHLIDAMNRTR
E8R3W3          KV-----------------------ARLEQ---LLEEVNQ-RIRLAEIRRQILLEEQRTN
A0A5C5ZM48      -G-----------------------GGVSP---LVEDSVR-RL--IEIDLARVSLTAERE
A0A5B9WF77      -V-----------------------DTPQA---TSDDLLE-QF--RSTNELLMQTDFQLI
A0A7C4Z5R7      -P-----------------------QAMVL---SQQTAQA-AV--TAAELKLQEAQVATK
A0A1P8WN28      -L-----------------------SKESE---DSHPLVQ-RV--SHLNENLTTVQSRRL
A0A3B9CTT0      -I-----------------------NKNST---QSHPLVE-RV--GQINQRFTELRSQRM
A0A518ALT3      -F-----------------------GQGAI---VGVTAFS-PS--TSVYQELTETEVSLE
A0A286RGB6      -S-----------------------QALSL---KQQITLQ-QF--STYRNELINVQLRML
A0A7V3TZQ6      -S-----------------------QALSL---KQQITLQ-QF--STYRNELINVQLRML
A0A3M1QRP3      -----------------------------------------RV--HTADDLVNTQRLYLD
A0A517TMV0      -L-----------------------PDREN---VVDPIVA-RA--IHLNESLLEAQRERI
A0A3E0MY88      -N-----------------------GGETD---HVHPLVE-RA--LALHTELTVAETERI
A0A518BBX8      -L-----------------------GRSSE---GVDTNLE-SL--ASIQREISQLKLERA
A0A5B9QF68      -V-----------------------SQDDS---AVEPTIQ-RA--LRLNDALMDEQQRRL
A0A5B9QGF0      -M-----------------------SQDDS---AVEPTIQ-RA--LRLNDALMDVQQRRL
A0A5C6CK24      -V-----------------------GQDDS---AVEPIIQ-RA--LRLNDALMDVQQRRL
A0A7C5FXU1      -A-----------------------EALNL---KERSALQ-RF--SMFRQELGNIQMAIL
A0A847YFA1      -S-----------------------QALTL---KQQITLQ-QF--STYRGELVGVSLKIM
A0A1C3E6N1      -S-----------------------NGTDN---ATNVAVA-RV--VRLNEEFMKAKEETL
A0A518GJT2      -S-----------------------NGTDN---ATNVAVA-RV--VRLNEEFMKAKEETL
A0A2E8B0L9      -T-----------------------EGSTT---VVHPMVQ-RV--ITLNNALVEVQQERM
A0A5Q4GFE7      -L-----------------------SGNQN---VVHPAVQ-RV--IRLNETLLKVQQDRL
A0A257WS34      -N-----------------------GTSES---GTHIAAD-RA--RQLNLTLTTAVEQTA
A0A7C4LP10      -T-----------------------NEHER---ESHILAE-RA--KKLNLALTDAVQKTA
A0A2E3RCU8      -I-----------------------DPESD---VIHPVVQ-TV--VTLNEAFLDAKKDRL
A0A517MLW3      -F-----------------------DNDSL---KSHPALQ-RV--NSLNESLTQAQKTRI
A0A5B9QVD0      -F-----------------------DDQSL---ASHPAVQ-RV--NSLNASLTDAQKTRI
A0A3A0DET7      -L-----------------------AVQLE---QGNVVTQ-RF--SSLAEELNSTEIELL
A0A3B8PNV4      -S-----------------------GPDNQ---SINPAAE-RV--AALNKELIVAQNRTR
A0A3D1DR40      -S-----------------------GPDNQ---SINPAAE-RV--AALNKELIVAQNRTR
A0A2E7RYU8      -S-----------------------GPDNQ---SINPAAE-RV--AALNKELIVAQNRTR
A0A3B8LXG8      -S-----------------------GPDNQ---SINPAAE-RV--AALNKELIVAQNRTR
A0A6M5Z0K7      -V-----------------------GATSS---DPKIVAY-LQ--SNLMEQHSDAKRRER
A0A350CI62      -G-----------------------ERNQN---SLNTISK-NI--EMLTQEYTNSRRRTE
A0A4P5WQK6      -G-----------------------ERNQN---SLNTISK-NI--EMLTQEYTNSRRRTE
A0A3C1X4W5      -G-----------------------ERNQN---SLNTISK-NI--ELLTQEYINARRRTE
A0A3D3W3A7      -G-----------------------ERNQN---SLNTISK-NI--ELLTQEYINARRRTE
A0A7Y5SKC2      -L-----------------------PVDSK---VLHPLAQ-RA--VSLNEDLIKAQTKRI
A0A7X7U104      -A-----------------------LGTDQ---DNNVILR-DF--EQVQNALTQAHLATI
F0SI78          --------------------------TSDE---GNNLHQA-RL--AQIEGQRSELLIKSS
A0A517MDV3      AM-----------------------LHNEL---IRLQLRE-SE--LQSRASILARTQNDE
A0A518IQ30      -L-----------------------RSGSN---VVHPLVQ-RA--VKMNDILVAAREKRL
A0A517LWP4      -L-----------------------RSGST---VVHPLVQ-RA--VKMNDILVAAREKRL
A0A518JNW8      -L-----------------------RSGSS---VVHPLVQ-RA--VKMNDILVAAREKRL
A0A2E3GWX1      -L-----------------------GTGDS---VVSVVNE-RV--VELNRSLAAAQKETI
F0SG60          -L-----------------------GTGDS---VVSVVNE-RV--VELNRSLAAAQKETI
A0A2E9VST2      -I-----------------------GTGDN---VMSVVNE-RV--IELNRALAKAQQDSI
A0A356A6X2      -I-----------------------GTGDN---VMSVVNE-RV--IELNHALAKAQQESI
A0A5C5XLM3      -I-----------------------GTGDN---VMSVVNE-RV--IELNHALAKAQQESI
A0A7V2UW16      -L-----------------------NERQT---L---LEQ-RL--GDLASQATAAAKQRQ
A0A518DRX3      -M-----------------------REGST---VVHPAVQ-RV--VELNRTLIEAQKNRV
A0A518DZF9      -M-----------------------REGST---VVHPAVQ-RV--VELNRTLIEAQKNRV
A0A2E7ENQ5      -L-----------------------RNGST---ITHPLVH-NV--VRINEALIDVRKERM
A0A7V2XSV8      -V-----------------------NERQT---L---LER-RL--EELSSLATAAGKERR
A0A847GXG1      -I-----------------------SGKQD---VVHPAVQ-RV--IRLNEALVKVQQDRL
A0A7C5BZF0      -Y-----------------------QTEGR---MTHPLVQ-RA--IDLNSKLMEARTRRI
A0A847YGH5      -S-----------------------GGNGQ---LLHPLVE-RA--KVFNAALIEAQKERV
A0A286RLF2      -V-----------------------GVNSQ---TVHPLVE-RA--KAFNQALVEVQKERV
A0A7V3TX18      -V-----------------------GVNSQ---TVHPLVE-RA--KAFNQALVEVQKERV
A0A1G3AQE9      -V-----------------------GPEGE---VQHPLVQ-AA--IALSEQLIESQSRRA
A0A3L7UQT9      -------------------------DGEGK---STNLLSL-RV--VELNKLLIEAQRVTL
A0A4P5YBU2      -------------------------DGEGK---STNLLSL-RV--VELNKLLIEAQRVTL
A0A7C7V5U8      -E-----------------------DGQAG---VTHPVLK-TA--MEFTQELITLQKRRG
A0A3M1VCL4      -V-----------------------TADGR---QISLIAE-QI--ARLNQALLEAKKETI
A0A518AKT8      -L-----------------------GDEKE---AIDPIVQ-RA--LSLNESWIEAQQQRV
A0A5C5ZR72      -G-----------------------HRTMT---NADRAFS-PL--SGYHRQLAEIEVKKE
A0A7Y5SJZ4      -I-----------------------REDGK---GTNAEVK-RA--MALNEALIQARKERL
A0A5C5V7Z9      -I-----------------------DQKDS---VVDPLIG-RA--IHLNDSLMQAQQQRL
A0A5C5YT05      -I-----------------------DQKDG---VVDPMIG-RA--IHLNDALMEAQQRRL
A0A518D7F9      -A-----------------------AGDSD---AVDPMVA-RA--LKLNDALMDAQAKRL
A0A5C5ZIP0      -L-----------------------PKDNE---VVDPIIG-RA--LQLNTALMEAQQERI
A0A518KBK3      -L-----------------------PDRDD---VVDPIIS-RA--IQYNDALLEAQRRRL
A0A5C6AKF9      -L-----------------------PDHEN---VVDPIVG-RA--IQYNDALMGAQRRRL
A0A7C2KUQ9      LV-----------------------TQQRT---RTDAEQA-QL--ASLRQEIKLIEFQLE
A0A7C5R0U3      -M-----------------------LDHPD---AMHPLVA-RV--MQLNEALMEARSRRV
A0A847YCQ7      TL-----------------------ADYRR---RVNELRR-QI--GGLDRKTAVLRSRLD
A0A286RD13      TL-----------------------ADHRK---HVNELRQ-QI--SGLERRIAILQSRLR
A0A7V3TUJ6      TL-----------------------ADHRK---HVNELRQ-QI--SGLERRIAILQSRLR
A0A517TY85      AI-----------------------TA-------AGSFHQ-GI--VEAEVGAEIARAELE
A0A5B9QEI7      AF-----------------------SP-------AGSLYQ-SL--TETDVEFEVLKAELQ
                                                                            

A0A5S9IPR9      DVKLRYG----------KCQEVKKK-------------------KSLEAILSSDLFVQNA
A0A533Q9U4      KLEVLYN----------KLKDFKSIQY-------------KDDIIQSIPAVVQS------
A0A533Q6B7      RLETLYNKLA-------ILKNAQNQ---------------AEIIQSIAPVVQND------
A0A1U9NNE1      ALEANVQ--------------------------------MKVNGDKVLLAPTDRMKLKYE
A0A2G2JCA2      VLEVEHQ----------ALKEIHEK-----------------------------------
A0A1G2XVR0      KLKALSD----------QIKQYSKD---------------PTLTKLIPEIVKDG------
A0A1G3B0P0      KLKALSD----------QIKQYSKD---------------PTLTKLIPEIVKDG------
A0A1E3X4X0      GVETLYN----------EIQKLSER---------------PEMIEAITPVIENR------
A0A286U4B3      GKEIRFL----------AVQNSDD-------------------LSSLPGIADNK------
A0A5C6DDS2      AKEVRFL----------AVQNSDD-------------------LSSLPGITDNV------
A0A5S9IJB5      SAYTSYR----------ETIDNYNK---------------AKIISTPEILKSRT------
A0A2E3GW02      QVRAELE----------AIQNALNRGTSRQALL-------MM------------------
A0A5B9QNZ7      ELESRAI----------ILKNTAGQESL---RE-------FSDLERLGLIDARDVERLAL
A0A1Z8N7H5      DAKKDS-----------LIQQSLVEGIQRAIVR-------GEDLKQYAMAVEETIGKELL
A0A1U7CZ81      ELEFALQKRVADSQ---EQDSEVAETTGFQKSQ-------LEARINETFRRDPSVASLIQ
A0A142YNY8      QAKALLEQRTADYQNGAEIEQLESGLRP-SEEE-------LTERIQAAFLADPAIADLRD
A0A1U7GLS6      TAKSRLQSRTQDYQDLGQIEPTAAETATLPEEE-------VARRIEAEFRSDPMIADLYG
A0A1G2YPI3      ERNSAYE----------STKEMVSDPVKLQQ-----------------------------
A0A532UIN2      ESKSAYE----------SVGEMVSDPVKLKQ-----------------------------
A0A0S8KNX5      KLEAQVQ----------LLELTKTQPIA--------------------------------
A0A3D3UVZ8      ELEAQVL----------LLERTREQPIS--------------------------------
A0A517NFU9      ESRSRLE----------VIKSYLATRDS---SK-------INSMDHLALLSQKEVERLKL
A0A5C5YWH4      ESRSRLE----------VIATYLADRNG---QE-------INNIDHLALLSHNEVERLKL
A0A3D2TNK4      SLQANLA----------TVETAY--------NR-------GEDLNQHLMHLEAPLGQQVL
A0A7C1Y4F0      TAKTDFD----------AIMGIEDDPFKIKQFA-------A-------------------
A0A6I0ENW6      MYDWERD----------YLRQIVEGATPEEADA-------AADGTSASASASVGVEEGGE
A0A6L3A0B7      MYDWERD----------YLRQIVEGATPEEADA-------AADGTSASASASVGVEEGGE
A0A0J1B4A0      HAKSRRV----------VIREFVKGKDP---DS-------LSDVHVMSLLDADEIDRVNA
A0A142WSB9      NVQGKIA----------TLKKMIAANESPDEIQ-------FWVMHALSAGTGGGAEGGGG
M5SZR3          ELESLIQ----------SLENAI--------ES-------GLEPKHLAMLISNAGVQLAA
M5TW92          ELESLIQ----------SLENAI--------ES-------GLEPKHLAMLISNAGVQLAA
A0A2S8FKY2      FLLSSNK----------AQIESVSRSGGDGGLT-------TENAPGVGDDATPRVPVSDA
A0A517N8P6      QLDSKLR----------LIREAVKGGR----HP-------YAVFQEVQYLLDD-------
A0A432MJP4      ELRTQLE----------LGKS----------------------------LREKGVGLAGI
M5UQ35          QVRARRQ----------TIRDFVGGRSR---DE-------ITDAEVLAILTEEELSRLKT
A0A0S8FY64      ELGVVVQ----------ANLG-------TGEEP-------QDLEELLSISIVRS------
A0A1N6KFT7      QLKTQLE----------LIKK--------MESS-------GSQGNAISLALSQFPTMTPG
L0DFG4          QLKTQLE----------LIKK--------MESS-------GSQGNAIALALNQFPTVSSN
A0A5C5XXG1      TIKTRLA----------RVENELEDLDGKTLSM-------TESMDKLALIDSESLERLGL
A0A7C7YUM8      VLRQALE----------HLDG--GDFEALARLG-------KETPNLLVLGYIKELATLEA
A0A7C2AHI6      ALGEAIA----------LLRE--GKREAIARLA-------KEVPDLESLVLIQEVGRLSA
A0A518BJJ1      SLSESLA----------LLRG--GDFDALGRIA-------QELDDPLAKSLLEQLSVLHM
A0A518D182      ALEEALE----------LTQA--GDDRGLSQLS-------SELADPLSKGLVERLETLGL
A0A7V4HWU2      QTKSRMA----------AIENAIAKGGNRE-AV-------TLLIGNLA------------
A0A5C5WTY6      KLRSRLE----------QVNSTIEQIAASDRKS--------DHIDKLALIDVESLQRMGV
A0A5C5Y033      TMRTRLE----------RVRESLKHIGGGSDLS--------DHLDKLALIDSDSLERLGA
A0A5C6G1Y2      TMRTRLD----------RVRESLKHIGGGSDLS--------DHLDKLALIDSDSLERLGA
A0A354PDV6      SLKTRLE----------RVRETLGDMDLDGPLS--------EHLDKLALIDSESMQRLGL
A0A5C6FZ02      TIKTRLA----------RVENELEDLDGKTLSM-------TESMDKLALIDSESLERLGL
M5TIT3          TVRTRLQ----------RVADTLNEMDDSGDAF--------DHLDKLALIDSESLERLGV
A0A5M6CY44      TLRTRLD----------RVQAVLAELEESNDPV--------DNLDKLSLIDSESLERLGL
F2AXG2          TVKTRLA----------RVDETLKEMDGSVDPI--------DQLDKLALIDSESLERLGV
M2BB46          TVKTRLT----------RVDETLKEMDESVDPI--------DQLDKLALIDSESLERLGV
L7CLQ6          TVKTRLT----------RVDETLKEMDESVDPI--------DQLDKLALIDSESLERLGV
A0A0J1B719      TVKTRLT----------RVDQTLKEMDESTDPI--------DQLDKLALIDSDSLERLGV
Q7UF18          TVKTRLT----------RVDETLKEMDESTDPI--------DQLDKLALIDSESLERLGV
A0A2G1W1E0      TVKTRLT----------RVDETLKEMDESTDPI--------DQLDKLALIDSDSLERLGV
K5E235          TVKTRLT----------RVDETLKEMDESTDPI--------DQLDKLALIDSDSLERLGV
A0A5C6FFI9      EAKSRLK----------VIEAFTDENE----TS-------VNDFDKLALLSQKDVTRLKL
A0A5C5WDJ1      ESKSRLE----------VIESTLERNG----GT-------TGDMGHLALLSQKEVERLKF
A0A5C5X547      ALLETQK----------HRQAVGETAPNEDGQP-------VVSEEPVDPSLRAPLPPLPV
A0A353FIP5      KLVMMAE----------RQNQLAESLRKG--SP-------VEEVGAAVELDPQ-------
A0A7V7MJI7      QLTLVIE----------SHEALLKAMEEG--TP-------VEQAASLAELDPT-------
A0A5B1CIK7      SIKTRLK----------RVEVTLNEIDETNTSA-------VDQLDKLALIDSESLERLGV
A0A5C5WHS2      TIRTRLE----------RVEETLSEMDEEKSTA-------ADQLDKLALIDSESLERLGV
A0A5C6B6G8      TLRTRME----------RVQATLEDMDTST-DP-------VDHLDKLALIDSESLERLGL
A0A5C5ZZN3      TVRTRLT----------RVEDTLKEMDDSG-DA-------FDHLDKLALIDSESLERLGV
A0A5C5XS91      TVRTRLQ----------RVDATLKEMDGSD-NP-------VDHLDKLALIDSESLERLGV
A0A5C6C4E6      TVRTRLQ----------RVDATLKEMDGSD-DP-------ADHLDKLALIDSESLERLGV
A0A2E1VVJ1      RLRLTIR----------AHELVAERLQDPE-AS-------LMSLAGAIELDPL-------
A0A3M2AEL0      DLDLRIR----------TVKNLIETVRTSD-SG-------LERLVSVPDLDPV-------
A0A2A2W9R6      SARSRRL----------VIADAVKGKRA---DE-------LTDAGVMALLTEEDIARLET
A0A518HKC1      SARSRRL----------VIADAVKGKRP---ED-------LTDAEVMTLLTEDDMARLQT
A0A518L3P0      SARSRRL----------VIADAVKGKTP---ED-------LTDAAVMTLLTEEDIARLQT
A0A255R1S0      EIETRRQ----------KISSSVKGQRP---EE-------LTDAQLATLLSKEDISRLQM
A0A5B9MKP1      ETRSRRS----------VIAEAVDGKAP---EE-------ITDADVMTLLSDTEVTRLQA
A0A351FYP6      QQATLLQ----------GLQEQSLE-----------------ELRESIMTANPD------
A0A0S8J591      AAQSLYD----------AVNKAVEE---------------GTYENTRDTDLLQR------
A0A532UT69      EARHTYE----------SMKAMVSD---------------PAKLSQFIEAQRAT------
A0A7V9G2R2      ALEALVK----------QIRDSDAK---------------PDATKRLE-----------S
A0A2D5AWU0      RERATFE----------LFSRAEAD---------------AEKFLDLG------------
L0DC26          SLRVEAE----------VLEEQATL---------------NE-----------------T
M5RT57          MLEMEIT----------AIREAMAK---------------EDL----------------R
D5SZ21          RATAQLA----------ALEQAISR---------------GEDVLQFAMASLDV--VGKQ
A0A7X7U1J4      EKASWCN----------AARELAEK---------------PSDLFELG-----------N
A0A7V8E5N8      RLAAEYK----------SLVDYGSD---------------GSSGLFNP-----------S
A0A356KTN1      QLNAQLE----------SIQRVLEQ---------------GRP-----------------
A0A7Y5LV28      KLAAELE----------ALATYRAD---------------GTGSEFHP-----------T
A0A7Y5HFQ5      EQKVKLV----------RLERTMAE---------------VRRAREAG-----------N
A0A7W1FMQ9      AQRSLVT----------RLKVAAKE---------------TVPGRQQA-----------V
A0A7W1NA62      GAATLAT----------QVRESTAL---------------ADAAARRG-----------A
A0A7V9JTP9      AKRSVID----------QLTEAEAM---------------QEPAKRLQ-----------A
A0A7W1FJ38      ASQALLK----------QIHDADRL---------------NNPGERLL-----------T
A0A1G2YQB7      VLQTKID----------LHSSKEEK---------------TITPEMMAKLRHDF--INSD
A0A353P687      VLQTKID----------LHSSQKEK---------------TITPEVMAKLRHDF--INSD
A0A356EME5      VLEAEWK----------ALNEM-PN---------------PLAQQVDEALAGNV--TSAV
A0A3L7P4E4      EIQSQID----------AIQKALER---------------GGSREAITLMLESF--NDKK
A0A3L7PEB5      EVQSQID----------AIKKALDR---------------GGSREAITLMLESF--NDKN
A0A1U9NL64      EAKSEYD----------TVKAMVSD---------------PKKVKQFVEAKRVS--GLYV
A0A2N1UCJ3      KAKATLE----------AVKKF-DS---------------PQKVRQYAMAQPGI--SSNL
A0A7V2H881      RLEAEYN----------TVKSAVSD---------------PARVKQLLASPQYR--GDSY
A0A7C4EK84      EAQAAYD----------AAQAI-KD---------------PTQLRQLVQMQQSR--QTGV
A0A7C3F0T2      DALADVQ----------ATRETVED---------------PTRFRRFVELRRLG--GREG
A0A7X7U4K9      DAETFRQ----------GVVNCAKD---------------PASLREYVEYLRGR--GSPD
A0A2E0X4J3      EAKALHN----------RVQRMYES---------------PTLRPLLADMAMDG--KPVD
A0A838QZ11      QAKAIYN----------RAKKMYDT---------------PQQRPFLLEMA--G--SEQQ
A0A5C5YU10      TAKAEYE----------RVKEMAAS---------------PTLRPMLLDMALDS--VGKA
A0A517MPZ6      DSKARHN----------RTQQMLES---------------PSLRPFLLELASGQ--QSVA
A0A5C6CNV7      DAKARYN----------RTKSMYET---------------PSQRPFLLELASSQ--QQVA
A0A518K5H4      EAKTRYA----------RAQKMLEN---------------PDQIPFLMELARTA--QAGS
A0A5C6AA28      ESKTRYA----------RAKKMLEN---------------PDQAPFLMELARSA--HSNS
A0A2E7ESJ6      ELGAQIK----------SVEEALER---------------DDNLESILLLAEKD------
A0A2E9VK20      EISSRLS----------TLKSAIER---------------GESHEALMLLVKTF--LQKD
A0A3D4PJK1      EISSRLS----------TLKSAIER---------------GESHEALMLLVKTF--LQKD
A0A355AI52      LLEASYQ----------SLTEAIKA---------------GQNIRQSLIAIEET--LGKE
A0A354PCQ3      VRDAQSA----------MQNNLMQA---------------ESDGAGEVLQVAAEALVPDP
A0A0S8GZ23      DTLTQIE----------LLSDPNHP---------------IDIPPDMLKNRSDS--INND
A0A1I3DDV4      AVATRLQ----------NVLTSLDQIKQNK----------GNSLEMLALIDSES--LTRL
A0A7V2UF66      NARAAHE----------SIKSLADD---------------PEKIRAFLEVRRAG------
A0A2E0SMM6      KMQTLID----------ALTEAIEN---------------GSNVQQYAEEILGAGPVGNE
A0A3L7SI46      ESRALLI----------SVQHALAE---------------GNDIQPYLQQAAGD--ISRE
A0A5B9PJZ8      RLEARVT----------SIQQAKAM---------------GKNPESLVIGVLQE--FSET
A0A2S8G191      RAKGKLA----------GIQSSVAA-----------------NLTEPVVAKKPV--VEEE
A0A2E7EGG1      VLAAQVQ----------ALEDSVQT---------------GPAVPDVLIEREIA--GREE
A0A2E2N5A9      ESESQFR----------QVEAMKAS--------------RLDELASVPAVLSDP--VIQQ
A0A7C8AGA2      SLETQIQ----------VQENGIGD---------------VATPGSLIERQNAV--INSD
A0A7C2FXP7      HLEAKIP----------VLEQTQGN--------------YSITSDELMQIRQQY--INSD
A0A1P8WP26      NAQATLE----------TLRQAVAN---------------GEDVLQYASEL------GEQ
A0A3L7V1F3      QSRTQFD----------GLQRAIAS---------------REDILQFANKTLDT--AGRQ
A0A2E3GWC6      EITSRIQ----------TLRNAVQR---------------GESSEALLLLVRTF--LQRD
F0SLB0          EITSRIQ----------TLRNAVQR---------------GESSEALLLLVRTF--LQRD
A0A3L7NDH9      SLQASQA----------SFQTAIQN---------------KQNIRQSLMAIEES--LGKE
A0A7X8IIB9      QMEARVQ----------AKEQQLNK---------------PLTVEDITTQIELR--VEND
A0A532UD06      NAKADFE----------ATKKMANE---------------PAKIRQFAGAAAGA--GAQV
A0A660URN1      NAKADFE----------AILSMVDE---------------PEKIKQFAMAQPNA--GVRV
A0A517ZCB5      DARSFLL----------AIEEAIRQ---------------GEDIQQFASRMSEG--LATE
A0A225EH48      SHETNLI----------TLQHKQSV---------------IDMQEVSLDELEKA--VAKN
A0A518INW8      YAKSKLE----------TIAEIQAEDVEHQRTDIERLALLNPRDTERLRFFMDV--ASGD
A0A518JPH9      YAKSKLE----------SIAEIEASGSDQEQMDIERLALLNARDADRLKFFMDI--ANGD
A0A5C5VEK8      TAKAEYE----------RVKQMAAS---------------PSLRPMLLDTALDA--FGSK
A0A532UTJ0      SLEAQVQ----------LLERSTER---------------AIAPEELLRMRQEY--INQD
A0A2E2CCW9      ELKSKID----------SLKAAIAS---------------GESKETLELLAQQY--LMGQ
A0A3C0AGX3      ELKSKID----------SLKAAIAS---------------GESKETLELLAQQY--LMGQ
A0A518AAQ5      ELKSKIN----------TLKAAIAS---------------GESKETLELLAQQF--LMGQ
A0A517QBG9      ELKSKIN----------TLKAAIAS---------------GESKETLELLAQQF--LMGQ
A0A518FTU3      ELKSKIN----------TLKAAIAS---------------GESKETLELLAQQF--LMGQ
A0A517WHH5      ELKSKIN----------TLKSAIAS---------------GESKETLELLAQQF--LMGQ
A0A5A8BGT3      ELKSKIN----------TLKSAIAS---------------GESKETLELLAQQF--LMGQ
A0A2E7K7A9      ELKSKIN----------TLKSAIAS---------------GESKETLELLAQQF--LMGQ
A0A517PTS5      ELKSKIN----------TLKSAIAS---------------GESKETLELLAQQF--LMGQ
A0A6I6AH34      ELKSKIN----------TLKSAIAS---------------GESKETLELLAQQF--LMGQ
A0A517VTK3      ELKSKIS----------SLKAAIAS---------------GESKETLELLAQQF--LMGQ
A0A517WQT4      ELKSKIS----------SLKAAIAS---------------GESKETLELLAQQF--LMGQ
A0A517VID8      ELKSKID----------SLKAAIAS---------------GESKETLELLAQQF--LMGQ
A0A517RK10      ELKSKID----------SLKAAIAS---------------GESKETLELLAQQF--LMGQ
A0A518IH18      ELKSKID----------SLKAAIAS---------------GESKETLELLAQQF--LMGQ
A0A7W0M4Y4      QLQAKID----------AITDALKR---------------GGSREAL------------S
A0A2D5NDU9      TARTEAA----------TAADFVDN----------------PKLLAQLNLGATE--TGKP
A0A5C5XLF4      EISSRLS----------TLKAAIER---------------GESHEALMLLVKTF--LQKD
A0A518CHE5      KLESLIK----------VLKQAIEK---------------GSNAQQYAEEILGP--GPVG
A0A1V5N3W2      ALQSLVQ----------LSEQTKDK---------------TIVPEKLLERRYDF--INSD
A0A517NSK8      HIESRLA----------VISDFVENADPEKVSDFDRLALLSEKEVNRLKVLFDV--TRGD
A0A5C5Z0D6      EVESRLA----------VITDFLQNTDPNSITDFNRLALLSEKEVNRLKLLYEI--TRGD
A0A7W5H7D9      ETASRLA----------VITSFLSNNAPNTVSDFDRLALLSEKEVNRLKLMYEV--TRGD
M5UE94          ESSSRLT----------VISDFLASKDASEITDVDRFSLLSEKEVNRLKLMIEM--TRGD
A0A3E0MY27      RQQLQIS----------QLQRLEAN---------------DPEQVRQRLISNTL--AADQ
A0A7V4M591      EMEASWK----------SLDEAVRN---------------GQDIGQHLMAFGDV--AGRE
A0A7X7F3G7      DLQPTLA----------RVQTAVRN---------------GEDLRRHWITVANV--VGQE
A0A7Y4VQ32      LNQWRLD----------RLENPVAP---------------SADGTEGSAEEAAA--RSR-
A0A2E0X9P6      VLKAELQ----------ALNDAPIV---------------YGDETASSGLFALE--ISNR
A0A1N6DAJ8      SLRIEHE----------VSQEKVTQ---------------TASMITPVM-IEDA--ISRD
A0A2E8FLY0      ENRATLE----------AIENAAAQ---------------GQSIEQFAMQQIEV--VGKE
A0A3D2U1E1      EARATMQ----------AIREAAAR---------------GEDIHQFALQQIEV--VGKE
E8R3W3          RTGTGLT----------PRRDAEGK---------------SDSNAASRSPAATS--PGRL
A0A5C5ZM48      NLK----------------QDTPNH---------------AADYAAAEAAVVEL--IGRD
A0A5B9WF77      EAEAKLT----------ARQ--AQA---------------AGDVASQSQAPDSN--VPNE
A0A7C4Z5R7      RAQLEVS----------NLRARLTQ---------------KPRVKVSEEAINEA--LAKD
A0A1P8WN28      QLEATLV----------SARELVAT---------------NSDLTSALKKLEEI--VGED
A0A3B9CTT0      ELEAAMK----------SARRLVAT---------------QADLTPAVQALQRI--VGPE
A0A518ALT3      VAKAELQ----------ALKTSDII---------------SADNAIATGHFELE--ISNR
A0A286RGB6      RLQGELS----------IKKAIRDK---------------AAQIPVTDREIEAA--ARTD
A0A7V3TZQ6      RLQGELS----------IKKAIRDK---------------AAQIPVTDREIEAA--ARTD
A0A3M1QRP3      KLESRRE----------DLLLAISN---------------REARLKRLELLAAS--GDGA
A0A517TMV0      EIEASQA----------TIQSAIDN---------------GSDLSRHLALVEES--LGEQ
A0A3E0MY88      KHQAALE----------SIRAAIHS---------------GADLNQFLMSAEQS--VGRS
A0A518BBX8      EVESDLL----------TLQRAIQE---------------KEPFDALLVMATEI--AQKS
A0A5B9QF68      ELQATLL----------SVEGALDR---------------GENIHQYLVAMEES--VGRQ
A0A5B9QGF0      ELQATLA----------SIDGALER---------------GEDINQYLVAMEES--VGRQ
A0A5C6CK24      ELQATLV----------SVEGALER---------------GEDINQYLVAMEES--VGRQ
A0A7C5FXU1      RAQAEMR----------IREAWANE---------------SLKIPISEEDLEMF--ARTD
A0A847YFA1      RTHGEIA----------LKNAIRDK---------------AAQIQVAESEIDAA--GRVD
A0A1C3E6N1      RATAQLA----------ALEQAISR---------------GEDVLQFAMASLDV--VGKQ
A0A518GJT2      RATAQLA----------ALEQAISR---------------GEDVLQFAMASLDV--VGKQ
A0A2E8B0L9      QLEASLG----------AVRMAVRN---------------GSDLRQHMIDLEPL--VGRQ
A0A5Q4GFE7      QLEASLW----------AIRTAIRD---------------GNDLRQHLTAIEPL--IGRE
A0A257WS34      EARAFYE----------AVAYAVRS---------------GGDIQQFITQVADV--VGSQ
A0A7C4LP10      DAKAFYE----------AVAFAVNS---------------GGDIQQFVMQLADV--VGRE
A0A2E3RCU8      VQQSLVE----------GIQRAIVR---------------GEDLKQYAMAIEET--LGRE
A0A517MLW3      ELQAISA----------VVSDAIRE---------------GRDPRPHMHAVDPD--AARS
A0A5B9QVD0      ELQAIAG----------VVEQSIRE---------------GRDPRPHMHAVDPE--AARS
A0A3A0DET7      QAKALFH----------RVK-----------------------------SMYDT--PKQR
A0A3B8PNV4      ESRATLE----------AIVDAAAR---------------GQNIEQFAMQHLEV--VGKE
A0A3D1DR40      ESRATLE----------AIVDAAAR---------------GQNIEQFAMQHLEV--VGKE
A0A2E7RYU8      EARATLE----------AIVDAAAR---------------GQNIEQFAMQHLEV--VGKE
A0A3B8LXG8      EARATLE----------AIVDAAAR---------------GQNIEQFAMQHLEV--VGKE
A0A6M5Z0K7      AIESQKQ----------ELQLKIDA---------------ARARLERPAPKEAG--APND
A0A350CI62      EARTTSQ----------ELQRAIAS---------------GEDILQFAMETLDS--AGRQ
A0A4P5WQK6      EARTTSQ----------ELQRAIAS---------------GEDILQFAMETLDS--AGRQ
A0A3C1X4W5      EARTTSQ----------ELQRAIAG---------------GEDILQFAMEALDS--AGRQ
A0A3D3W3A7      EARTTSQ----------ELQRAIAG---------------GEDILQFAMEALDS--AGRQ
A0A7Y5SKC2      ELEATLA----------ALQAAVRN---------------GGDLQQYVFTVASV--VGEQ
A0A7X7U104      ESKSFYE----------ATKKMEND---------------PAGLRQFVEA----------
F0SI78          QVRAELE----------AIQNALNR---------------GTSRQALLMMADQA--RQRA
A0A517MDV3      SLQDFSD----------LERLGLID---------------NRDVERLALLVNVE--RGDA
A0A518IQ30      KLQASEV----------AVKHAVET---------------GGDLRQYLVELEPT--IGRE
A0A517LWP4      KLQASEV----------AVKHAIQT---------------GGDLRQYLVELEPT--IGRE
A0A518JNW8      KLQASEV----------AVKHAVQT---------------GGDLRQYLVELEPT--IGRE
A0A2E3GWX1      ESRSFYT----------AVEQAIRN---------------GENLQQLMAQTNSS--VASE
F0SG60          ESRSFYT----------AVEQAIRN---------------GENLQQLMAQTNSS--VASE
A0A2E9VST2      QAQSHYT----------AVEQAIRN---------------GESLQQLMNQSNQT--LANE
A0A356A6X2      QARSYYT----------AVEQAVRN---------------GESLQQLMNQSNQT--LANE
A0A5C5XLM3      QARSYYT----------AVEQAVRN---------------GESLQQLMNQSNQT--LANE
A0A7V2UW16      DLEATQE----------KIATLLAK---------------GS--WTALFSLPQV--QESE
A0A518DRX3      HLEALQT----------AVGDAVRE---------------GRDLRQHLLTFSPE--IGRE
A0A518DZF9      HLEALQT----------AVGDAVRE---------------GRDLRQHLLTFSPE--IGRE
A0A2E7ENQ5      RLDASLA----------AVRRAISQ---------------GQDVRQFMLSMEDA--GGRE
A0A7V2XSV8      DLEAGQE----------KLAALVQE---------------GA--WDALFSLPQA--QGNL
A0A847GXG1      QLEASLA----------AIRTAVRD---------------GADLRQHMSAIEPL--VGRE
A0A7C5BZF0      SLEVAAQ----------QLQLAIQT---------------GADLHQHLLGISEL--VGQD
A0A847YGH5      ELAASLA----------ALQAAIRN---------------GEDLRQYLTTMSDA--VGQE
A0A286RLF2      QLAASLQ----------ALENAVQQ---------------GADIRQYLFAADDT--LGQQ
A0A7V3TX18      QLAASLQ----------ALENAVQQ---------------GADIRQYLFAADDT--LGQQ
A0A1G3AQE9      KLEASLA----------AIEAAVHD---------------GEDLEKCILLAAEV--VGWE
A0A3L7UQT9      DAWSFLQ----------TVEQAART---------------GQDLQQLMFQAVET--LGAS
A0A4P5YBU2      DAWSFLQ----------TVEQAART---------------GQDLQQLMFQAVET--LGAS
A0A7C7V5U8      DLEATLI----------EVRQAVGR---------------GENPLQYLFDVQEV--VGKE
A0A3M1VCL4      NARVFLN----------AVENALAT---------------GQDVFQLMQGELEP--VGRQ
A0A518AKT8      DLEARLA----------AVNSSIAR---------------GDDMRQHLMSLEET--LGQQ
A0A5C5ZR72      VLRAELE----------SIQEAEVV---------------NTDFRERSGAIDLE--VDMN
A0A7Y5SJZ4      NAETVLT----------AVEGAVQR---------------GENLHRQAVELLDD--VGSD
A0A5C5V7Z9      DLQASLA----------SVSAALAR---------------GEDMRNYLSVVEEA--VGEQ
A0A5C5YT05      DLQGSLA----------SVAMAMAR---------------GDDMRNYLSVVEEA--VGEQ
A0A518D7F9      EVEASLA----------TVREALAS---------------GQDLRRYVALVEEA--VGQQ
A0A5C5ZIP0      GMQASLA----------TVRRAMSQ---------------GEDLRQYLSLVQEA--VGEQ
A0A518KBK3      DLQSSLT----------TIQMAIDR---------------GDDLSQHLGLVEQS--IGEA
A0A5C6AKF9      DLTASLA----------TIQVAIAR---------------GEDLSQHMGLVEES--IGQA
A0A7C2KUQ9      MARPVQE----------KGAPG--------------------DHAPVQPEYAL-------
A0A7C5R0U3      ELESQQA----------ALEEAIRQ---------------GRDLGPLLLKIEPL--VGRE
A0A847YCQ7      LLEKERP----------ESTEEERR---------------ARDEAVIKQIVEAG--LSAD
A0A286RD13      YMEEHRP----------QTSEEERR---------------QRDEAVIQQIVENA--LRAD
A0A7V3TUJ6      YMEEHRP----------QTSEEERR---------------QRDEAVIQQIVENA--LRAD
A0A517TY85      AIKR-PI----------ASD----------------------DQGSVSGILTLE--VANR
A0A5B9QEI7      AINNSPM----------LGE----------------------DRAVASGLLELE--ISNR
                                                                            

A0A5S9IPR9      MIDDLQKKKFLYE-----------------------------------------------
A0A533Q9U4      ---------------------------PLIQNLK--------------------------
A0A533Q6B7      ----------------------------LIQNLK--------------------------
A0A1U9NNE1      FINADLTIKALT------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ----------------------------SINTLK--------------------------
A0A1G3B0P0      ----------------------------SINNLK--------------------------
A0A1E3X4X0      ----------------------------LIQDLK--------------------------
A0A286U4B3      ----------------------------LINELK--------------------------
A0A5C6DDS2      ----------------------------LINELK--------------------------
A0A5S9IJB5      -----------------------------IQELK--------------------------
A0A2E3GW02      -------------ADQARQRAGQSSAEGVQNASI--------------------------
A0A5B9QNZ7      LVTVERGD-----ATTDESFVAQQPQRTTTATTE--------------------------
A0A1Z8N7H5      IKGLGFN-----------------TENIQVRNQL--------------------------
A0A1U7CZ81      QILETDEELAHTVGVARKGYDPARQAAEKRKAQL--------------------------
A0A142YNY8      EILTVRDRLSHVVSNARKGNDPSKRAHEARLKQL--------------------------
A0A1U7GLS6      QKQEVERRRDHVQKGARKVADPSRVAHDARLAEL--------------------------
A0A1G2YPI3      -------------FIEAQRARGMYIPQDSEKAKI--------------------------
A0A532UIN2      -------------FIEAQRARGIYVSTDSAKASL--------------------------
A0A0S8KNX5      -------------PGELLSMRQSYINEDPAVVAF--------------------------
A0A3D3UVZ8      -------------PEELLKMRQDYINQDPAVVAF--------------------------
A0A517NFU9      FLDVTRG------ETQSEAFQAEQPIRQEVAKAQ--------------------------
A0A5C5YWH4      FLDMTRG------ETQSEAFQAEQPIRQEVAKAQ--------------------------
A0A3D2TNK4      LSSVGVS-----------------PQDMQVLGDQ--------------------------
A0A7C1Y4F0      -------------ASTGSGVRMPVADREMQLRSE--------------------------
A0A6I0ENW6      -AGVRGDERPRRLFWSDREWSRLYQDRESKRAAL--------------------------
A0A6L3A0B7      -AGVRGDERPRRLFWSDREWSRLYQDRESKRAAL--------------------------
A0A0J1B4A0      FLAISANR-----DDQTNDEMLSRAVMQESTRTE--------------------------
A0A142WSB9      GGGGGGG------VLQGPSGKAELDGRLLAARLV--------------------------
M5SZR3          MDDDAEPMGLDRLRMDQKFHSLELEDERDLAEGL--------------------------
M5TW92          MDDDAEPMGLDRLRMDQKFHSLELEDERDLAEGL--------------------------
A0A2S8FKY2      DDSVDEVAENGDGDSNDGEVADLKLSDVEMDEAI--------------------------
A0A517N8P6      -------------VRDIEQMHQAIVEAPNDNLEL--------------------------
A0A432MJP4      AYALGQF------RGDPGESLAISSSAGRSQALA--------------------------
M5UQ35          LVTLNRGDQDDLESVMLSRYLSQQSAKLE-------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      GSNGQIP------QSSGTA------GSYEQLQKELAEVKLKRSITQRMVDNLKAGRPNSE
L0DFG4          GAGHLTQ------GMTGAAIGTSGTGSYEQLQKELADVKLKRAMTQRLVENLKGARPNAE
A0A5C5XXG1      FAGLQIS------ASNTAEFKATMPVRAEEARTR--------------------------
A0A7C7YUM8      -ESLRLE------RTDVLGYKQLLQAEELRLRVAIEESHLTIQAFELALAAIEAGDESAV
A0A7C2AHI6      -EALLLD------RRDSGEFRLMLEQELNRERHGADETRLVASSVRAAREGLLRGDAGAL
A0A518BJJ1      -RLLLKG------RSDGDPYALLLAQRSELLEERAGELAMQIVAVRETIQAIDDGVPGAY
A0A518D182      -ERFAAA------RADGGPYRTLLQQRAVELDERADEARVELAALRAVLTAAEADEQGAF
A0A7V4HWU2      -------------AVADAAGAGGASARLAPRNAF--------------------------
A0A5C5WTY6      FTDMQRD------AASSTEARAELPGEVERARIE--------------------------
A0A5C5Y033      FAGLQVS------ASNSAEFKAAMPAKMEEARAQ--------------------------
A0A5C6G1Y2      FAGLQVS------ASNSAEFKAAMPAKMEEARAQ--------------------------
A0A354PDV6      YASLQVN------AASTADFQATQPARIAEAQTQ--------------------------
A0A5C6FZ02      FAGLQIS------ASNTAEFKATMPVRAEEARTR--------------------------
M5TIT3          FAGLQMN------AADSPEFKAAMPAKAEEARTQ--------------------------
A0A5M6CY44      FTGLQMN------SSNTAEFKAAMPAKIEEARTQ--------------------------
F2AXG2          FAGLQMN------SANTAEFKAAMPAKAEEARTQ--------------------------
M2BB46          FAGLQMN------SANTAEFKAAMPAKMEEARTQ--------------------------
L7CLQ6          FAGLQMN------SANTAEFKAAMPAKAEEARTQ--------------------------
A0A0J1B719      FAGLQMN------SANTAEFKAAMPAKAEEARTQ--------------------------
Q7UF18          FAGLQMN------SANTAEFKAAMPAKMEEARTQ--------------------------
A0A2G1W1E0      FAGLQMN------SANTAEFKAAMPAKMEEARTQ--------------------------
K5E235          FAGLQMN------SANTAEFKAAMPAKMEEARTQ--------------------------
A0A5C6FFI9      FLDMTRG------ESQSETFQAEQPARAEAARAQ--------------------------
A0A5C5WDJ1      FLDMARG------GAQSEAFQAAQPMRAEVAKAQ--------------------------
A0A5C5X547      GQSTNQWVLTEEILEEEYAFDPEIRRLNDEKEAL--------------------------
A0A353FIP5      ------------------------------TSSM--------------------------
A0A7V7MJI7      ------------------------------VIAM--------------------------
A0A5B1CIK7      FAGLQMS------ASNTAEFKSAMPAKMEGARAE--------------------------
A0A5C5WHS2      FAGLQMN------SANTAEFRAAMPAQTEKARAE--------------------------
A0A5C6B6G8      FAGLQMN------SSNTAEFKAAMPAKMEEARTQ--------------------------
A0A5C5ZZN3      FAGLQSN------AADTAEFKAAMPAKMEEARTQ--------------------------
A0A5C5XS91      FAGLQMN------ASNTAEFKAAMPAKVEEAHTQ--------------------------
A0A5C6C4E6      FAGLQMN------ASNTAEFKASMPAKAEEAHTQ--------------------------
A0A2E1VVJ1      ------------------------------LQSL--------------------------
A0A3M2AEL0      ------------------------------TRTM--------------------------
A0A2A2W9R6      LVSIAKER-----KGGDSGMDIARIVANTSSTSK--------------------------
A0A518HKC1      LVSIAKER-----KAKDDGLDIARIVANTSSTSK--------------------------
A0A518L3P0      LISIAKER-----KAGDDSLDIARIVANTSSTSK--------------------------
A0A255R1S0      FMDFAEGRSKVEEKALTEEERMALALERQAQQEE--------------------------
A0A5B9MKP1      LISIKKQR-----QPGSAGESESQAIARSSRQSA--------------------------
A0A351FYP6      ---------------------------AQLDALI--------------------------
A0A0S8J591      ---------------------------LRERLYA--------------------------
A0A532UT69      -------GPYGTN--------------GEKAALE--------------------------
A0A7V9G2R2      LLKV---EFINRH--------------PMVSEQH--------------------------
A0A2D5AWU0      -------RNRRST--------------KQNPNLE--------------------------
L0DC26          MVTPAMIEDAISR--------------DRSIELY--------------------------
M5RT57          IAEVDVEMAVGES--------------QEVLDLR--------------------------
D5SZ21          FMMGELGLDSQEG--------------MAISRMT--------------------------
A0A7X7U1J4      GMHWIWGRQGPAP--------------DQTTVVR--------------------------
A0A7V8E5N8      FHQI---RALEQ--------------------LG--------------------------
A0A356KTN1      LESA---SPIATN--------------HIVLNLR--------------------------
A0A7Y5LV28      FHQT---KSLES--------------------LT--------------------------
A0A7Y5HFQ5      LDQV---SEVFDN--------------REVAEIT--------------------------
A0A7W1FMQ9      MMEI---PEIGQS--------------DLVMIVR--------------------------
A0A7W1NA62      LLRV---DAIGRH--------------PAVLELQ--------------------------
A0A7V9JTP9      LLRV---QAISSH--------------PVVVEQQ--------------------------
A0A7W1FJ38      LLRI---EPIGRH--------------PVVVEQQ--------------------------
A0A1G2YQB7      L---------------------------MVQTTA--------------------------
A0A353P687      L---------------------------MVQTTT--------------------------
A0A356EME5      ETNP---QVQALV--------------QQIW-----------------------------
A0A3L7P4E4      KSGD---GLETSL--------------TPTQKFT--------------------------
A0A3L7PEB5      NSGE---AVEKAL--------------TPMQKFT--------------------------
A0A1U9NL64      SSGT---ENTRLK--------------AELD-----------------------------
A0A2N1UCJ3      FARD---METKLR--------------DELQ-----------------------------
A0A7V2H881      Q-------------------------------MR--------------------------
A0A7C4EK84      GPER---GGGALA--------------VELG-----------------------------
A0A7C3F0T2      LAAP---EEGVLR--------------ADVA-----------------------------
A0A7X7U4K9      TTAS---LRVSLA--------------ARLFELR--------------------------
A0A2E0X4J3      T------LEERSV--------------LALQ-----------------------------
A0A838QZ11      A------LRD-----------------IELE-----------------------------
A0A5C5YU10      N----------LN--------------DDLEALL--------------------------
A0A517MPZ6      QDIS---LENRLQ--------------VDLE-----------------------------
A0A5C6CNV7      NEIR---SESQLS--------------LDLE-----------------------------
A0A518K5H4      R-----------S--------------GDLD-----------------------------
A0A5C6AA28      R-----------G--------------SDLE-----------------------------
A0A2E7ESJ6      ---GHQGLKEKFS--------------SRLALMQ--------------------------
A0A2E9VK20      QTSNSQTVVSGAT---------------ERQQLD--------------------------
A0A3D4PJK1      QTSNSQTVVSGAT---------------ERQQLD--------------------------
A0A355AI52      AFLDSMGLGDRDK--------------QTRISVE--------------------------
A0A354PCQ3      VFQPRRKHPSESEIEQLVDRDPKVAEAKTRISRY--------------------------
A0A0S8GZ23      PYVRETT-----------------------------------------------------
A0A1I3DDV4      GTFGSFSSAQTQD------FQENQATRLKEAETK--------------------------
A0A7V2UF66      ------GAGGWGS--------------QAEARSQ--------------------------
A0A2E0SMM6      LLGQELGLQDRVV----------------VSRLQ--------------------------
A0A3L7SI46      FLLQELGVGANDA--------------YTVAKHQ--------------------------
A0A5B9PJZ8      NM-------------------------GAYTSTH--------------------------
A0A2S8G191      ENAPDAKQDVPLEEDSDVELQNILASDEVIAALK--------------------------
A0A2E7EGG1      VQRVLVALNQK-------------------------------------------------
A0A2E2N5A9      FK----------------------------------------------------------
A0A7C8AGA2      PIIQALT-----------------------------------------------------
A0A7C2FXP7      PMIRVLT-----------------------------------------------------
A0A1P8WP26      VLAEVMGVSGQSV--------------FQTTQIT--------------------------
A0A3L7V1F3      LIEQSMGLGSQDA--------------FLIQRIN--------------------------
A0A2E3GWC6      QQSNTQTVMTGTS---------------ERQQLD--------------------------
F0SLB0          QQSNTQTVMTGTS---------------ERQQLD--------------------------
A0A3L7NDH9      AFLDSVGLSSRDK--------------DTRTSLE--------------------------
A0A7X8IIB9      PSIVALR-----------------------------------------------------
A0A532UD06      SGS------------------------DRETQLR--------------------------
A0A660URN1      FVN------------------------DVQSQLQ--------------------------
A0A517ZCB5      LLKRHAGIASGDV--------------YTQSRMQ--------------------------
A0A225EH48      EKVAPK---------------------VEARNIA--------------------------
A0A518INW8      PSGSGALRDDPQR--------------TAALNLE--------------------------
A0A518JPH9      VGSTGASREDPLR--------------AAAINLE--------------------------
A0A5C5VEK8      SDLD-----------------------RDLERLR--------------------------
A0A532UTJ0      PTVVAFT-----------------------------------------------------
A0A2E2CCW9      TR-GQAANGNASE-GHHLATPGTSQLDRARTALE--------------------------
A0A3C0AGX3      TR-GQAANGNASE-GHHLATPGTSQLDRARTALE--------------------------
A0A518AAQ5      AR-GQAGAAAGGV-ETQALAPGNTQVERARAALE--------------------------
A0A517QBG9      AR-GQAGAAAGGV-ETQALAPGNTQVERARAALE--------------------------
A0A518FTU3      AR-GQTGTAAGGV-ETQALAPGNTQVERARAALE--------------------------
A0A517WHH5      AR-GQAGAVTGGV-ESQAIAPGNTQVERARLALE--------------------------
A0A5A8BGT3      AR-GQAGAATGGV-ESQAIAPGNTQVERARLALE--------------------------
A0A2E7K7A9      AR-GQSGATTGGV-ESQAITPGNTQVERARLALE--------------------------
A0A517PTS5      AR-GQSGATTGGV-ESQAITPGNTQVERARLALE--------------------------
A0A6I6AH34      AR-GQSGATTGGV-ENQAITPGNTQVERARLALE--------------------------
A0A517VTK3      TRGGQPGSTSSA--GASISAPGTSNLDRARTALE--------------------------
A0A517WQT4      TRGGQPGSTSSA--GASISAPGTSNLERARTALE--------------------------
A0A517VID8      TR-GQAANKNTS--EGRIATPATSQLDRARTALE--------------------------
A0A517RK10      TR-GQAGNANAN--QGQIATPNTTQVDRARAALE--------------------------
A0A518IH18      TR-GQAGSANGNTSQGQIATPNTTQVDRARTALE--------------------------
A0A7W0M4Y4      LMVNQLKAEGSTK--------------SEAITVA--------------------------
A0A2D5NDU9      LISPPEELSTPSA--------------EAAILAQ--------------------------
A0A5C5XLF4      QTSNSQTVVSGAT--------------ERQQLD---------------------------
A0A518CHE5      NELLSQEMGLQDR--------------LIVSRLQ--------------------------
A0A1V5N3W2      PTLQMLT-----------------------------------------------------
A0A517NSK8      TMSEAFVQDNPIR--------------QETAKAE--------------------------
A0A5C5Z0D6      VASEAFQAEQPIR--------------QETARAE--------------------------
A0A7W5H7D9      VASEAFQAEQPIR--------------QATAQAE--------------------------
M5UE94          VASEAFQADQPIR--------------QATAQAE--------------------------
A0A3E0MY27      QYGQLRGVV---------------------------------------------------
A0A7V4M591      MLMGILGLGPRDS--------------TAQASLE--------------------------
A0A7X7F3G7      MMMRSFGLSPADI--------------QTQASLE--------------------------
A0A7Y4VQ32      ---------YEDD--------------SIWRDRY--------------------------
A0A2E0X9P6      EDIRELESRLAAQ--------------R--------------------------------
A0A1N6DAJ8      RSIELLKARESAA-----------------------------------------------
A0A2E8FLY0      FLLRRMGLDSQDS--------------WMVMRVR--------------------------
A0A3D2U1E1      VFLRQMGLNPQDS--------------YLDGRTR--------------------------
E8R3W3          DSREIDDLVEEYL--------------QRDRNLL--------------------------
A0A5C5ZM48      EQLRAWR-----------------------------------------------------
A0A5B9WF77      QIREEFTRDPEVI--------------ELVDRI---------------------------
A0A7C4Z5R7      AVAERTR-----------------------------------------------------
A0A1P8WN28      VLERIPGAGATDP--------------KAIEELR--------------------------
A0A3B9CTT0      VMQQVPGRPGLDV--------------KAIETLE--------------------------
A0A518ALT3      ADVRRLEDQIRDI--------------E--------------------------------
A0A286RGB6      PVILQLQLRESEL--------------KNLVAQT--------------------------
A0A7V3TZQ6      PVILQLQLRESEL--------------KNLVAQT--------------------------
A0A3M1QRP3      ASAPAPDRRFSED--------------SVWRTLS--------------------------
A0A517TMV0      AVLAAMGMGPNDL--------------EVLAVQQ--------------------------
A0A3E0MY88      VLMTALGINDRDV--------------VGHTNLE--------------------------
A0A518BBX8      KQTDTKDDSRLNL--------------D--------------------------------
A0A5B9QF68      MMLSSLGLSSEDL--------------NVIEEQQ--------------------------
A0A5B9QGF0      LMLSSLGLSSEDL--------------SVIEEQQ--------------------------
A0A5C6CK24      MMLSSLGLSSEDL--------------SVIEEQQ--------------------------
A0A7C5FXU1      PTYTRLQAQMDAV--------------Q--------------------------------
A0A847YFA1      PVMVQLQMRQAEL--------------K--------------------------------
A0A1C3E6N1      FMMGELGLDSQEG--------------MAISRMT--------------------------
A0A518GJT2      FMMGELGLDTQED--------------MAISRMT--------------------------
A0A2E8B0L9      LVMSGLGLSPEAT--------------DLVNSVE--------------------------
A0A5Q4GFE7      LTMSVMGLNSKDM--------------ETRAQIE--------------------------
A0A257WS34      VLLRELGMGSQDG--------------FILARFE--------------------------
A0A7C4LP10      VLLKELGLGTQDS--------------YTLAKIE--------------------------
A0A2E3RCU8      LLAKGLGFSTDTI--------------HTRSQLE--------------------------
A0A517MLW3      LTAAVLGVAPEQM--------------RSIHVLE--------------------------
A0A5B9QVD0      LTAAVLGVAPEQM--------------RSVHALE--------------------------
A0A3A0DET7      PFLLDMAGDDQQA--------------LRDIELE--------------------------
A0A3B8PNV4      FLLRRMGLDSQDT--------------WMVMRIR--------------------------
A0A3D1DR40      FLLRRMGLDSQDT--------------WMVMRIR--------------------------
A0A2E7RYU8      FLLRRMGLDSQDS--------------WMVMRVR--------------------------
A0A3B8LXG8      FLLRRMGLDSQDS--------------WMVMRVR--------------------------
A0A6M5Z0K7      RVDPLLERELDLD--------------PRIAAAD--------------------------
A0A350CI62      LVEQSMGLGTQDS--------------YHVQRIM--------------------------
A0A4P5WQK6      LVEQSMGLGTQDS--------------YHVQRIM--------------------------
A0A3C1X4W5      LVEQSMGLGTQDS--------------YHVQRIM--------------------------
A0A3D3W3A7      LVEQSMGLGTQDS--------------YHVQRIM--------------------------
A0A7Y5SKC2      LLLSNLGFTREDA--------------QTQGDLQ--------------------------
A0A7X7U104      --QRSRNTYFSTA--------------SEISSLR--------------------------
F0SI78          GQSSAEGVQNASI--------------T--------------------------------
A0A517MDV3      NSDESFVAQQPMR--------------TTAANTE--------------------------
A0A518IQ30      LMLNELGMSPRFA--------------EVADRME--------------------------
A0A517LWP4      LMLNGLGMSPRFA--------------QVADEME--------------------------
A0A518JNW8      LMLNGLGMSPRFA--------------QVADEIE--------------------------
A0A2E3GWX1      LMKIGIGVDSRDQ--------------YVYARLQ--------------------------
F0SG60          LMKIGIGVDSRDQ--------------YVYARLQ--------------------------
A0A2E9VST2      LMKLSAGVDSRDS--------------YAYARLQ--------------------------
A0A356A6X2      LMKLSAGVDSRDS--------------YAYARLQ--------------------------
A0A5C5XLM3      LMKLSAGVDSRDS--------------YAYARLQ--------------------------
A0A7V2UW16      VLRK----------------------------IR--------------------------
A0A518DRX3      LLVSSMGLGPEFA--------------TNLRQIE--------------------------
A0A518DZF9      LLVSSMGLGPEFA--------------TNLRQIE--------------------------
A0A2E7ENQ5      MALGMLGMSTKDE--------------DFAKQLK--------------------------
A0A7V2XSV8      LLQR----------------------------MR--------------------------
A0A847GXG1      MMLSAMGLNTQDA--------------QTRATVE--------------------------
A0A7C5BZF0      LIRQRLGLNAPDT--------------YLQARMY--------------------------
A0A847YGH5      MLLNSLGFNPQDS--------------TARSEAE--------------------------
A0A286RLF2      ILLGVLGFSREET--------------AARLEVE--------------------------
A0A7V3TX18      ILLGVLGFSREET--------------AARLEVE--------------------------
A0A1G3AQE9      VLRNHLGSSADDG--------------LQAA-LE--------------------------
A0A3L7UQT9      ILSKQMGLGEQDA--------------WAVAKLN--------------------------
A0A4P5YBU2      ILSKQMGLGEQDA--------------WAVAKLN--------------------------
A0A7C7V5U8      MMLAGLGLSELDA--------------SRQAMLE--------------------------
A0A3M1VCL4      MLESELGFSQQDA--------------LVLSRVE--------------------------
A0A518AKT8      VLISSLGMSSDDL--------------SSIRERE--------------------------
A0A5C5ZR72      GEVQQR------E--------------RQISQLR--------------------------
A0A7Y5SJZ4      MLRRELGVSEADS--------------QRAQQLH--------------------------
A0A5C5V7Z9      MMLASLGLSHQDL--------------EMLSSQQ--------------------------
A0A5C5YT05      MMLAALGLSHQDM--------------EMLTSQQ--------------------------
A0A518D7F9      MLMSAMGVAPDDL--------------ALIAQQR--------------------------
A0A5C5ZIP0      MLLSALGMGENDV--------------RAMADQQ--------------------------
A0A518KBK3      AMLAAMGMGPNDM--------------EVLAKQQ--------------------------
A0A5C6AKF9      AMLAAMGMAPNDI--------------EVLAAQQ--------------------------
A0A7C2KUQ9      ------------D--------------PGWQELN--------------------------
A0A7C5R0U3      LMLVALGLDAEST--------------ESSRQVE--------------------------
A0A847YCQ7      PWLTAA------M--------------QRKALIE--------------------------
A0A286RD13      PWIAAA------Q--------------ARLSYLE--------------------------
A0A7V3TUJ6      PWIAAA------Q--------------ARLSYLE--------------------------
A0A517TY85      PDVRRL------E--------------EEIEQLQ--------------------------
A0A5B9QEI7      ADVRRL------E--------------ERGDFIH--------------------------
                                                                            

A0A5S9IPR9      ----------------------NQLRDLKTR-----------------------------
A0A533Q9U4      ----------------------ADYARVEND-----------------------------
A0A533Q6B7      ----------------------GESIRIQNE-----------------------------
A0A1U9NNE1      ----------------------EDMAKLERD-----------------------------
A0A2G2JCA2      ----------------------ETFIVPETG-----------------------------
A0A1G2XVR0      ----------------------AKYADLQAN-----------------------------
A0A1G3B0P0      ----------------------AKYADLQAN-----------------------------
A0A1E3X4X0      ----------------------ADYARLEAQ-----------------------------
A0A286U4B3      ----------------------LEYTRLNAK-----------------------------
A0A5C6DDS2      ----------------------LEYTKLQAK-----------------------------
A0A5S9IJB5      ----------------------VQSLVVDQE-----------------------------
A0A2E3GW02      ---------------------TSQLIPLMLE-----------------------------
A0A5B9QNZ7      ---------------------MDSLLTLKVR-----------------------------
A0A1Z8N7H5      ---------------------EQGLLADISS-----------------------------
A0A1U7CZ81      ---------------------MAKYNSLWDE-----------------------------
A0A142YNY8      ---------------------EGQHADFWAQ-----------------------------
A0A1U7GLS6      ---------------------QAEIEGHWRD-----------------------------
A0A1G2YPI3      ---------------------KSRLDELQDR-----------------------------
A0A532UIN2      ---------------------RSKLDQLELR-----------------------------
A0A0S8KNX5      ---------------------TANITELEQE-----------------------------
A0A3D3UVZ8      ---------------------TGNITQLEQD-----------------------------
A0A517NFU9      ---------------------YNRMLDLIQK-----------------------------
A0A5C5YWH4      ---------------------YNRLLDLIQK-----------------------------
A0A3D2TNK4      ---------------------QKKLFTAQQE-----------------------------
A0A7C1Y4F0      ------------------------LRQAETE-----------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ---------------------YQQLLTLSSK-----------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ---------------------EAMLLPLKQQ-----------------------------
M5TW92          ---------------------EAMLLPLKQQ-----------------------------
A0A2S8FKY2      ------------ANDPVSVKLQAELDRFEDV-----------------------------
A0A517N8P6      ---------------------QTQLMDLRVQ-----------------------------
A0A432MJP4      ---------------------SDYVRQLINE-----------------------------
M5UQ35          ---------------------YDKMLELSSK-----------------------------
A0A0S8FY64      --------------DPAVAELYGRLTQIDLD-----------------------------
A0A1N6KFT7      ATVSEDDVAGSFKLDPNVAELYRDLKRAQLR-----------------------------
L0DFG4          GKVTEDHVAGSFKLDPYVAELYRDLKRAQVR-----------------------------
A0A5C5XXG1      ---------------------FAYLLKLNSE-----------------------------
A0A7C7YUM8      ARLASAQGPGGGSE---FESYLISLAELDAR-----------------------------
A0A7C2AHI6      ARLADPKLV--------SDAQRAALAELDAE-----------------------------
A0A518BJJ1      GFLSANSNAPGITVDPLTTGYLSEIARLEGE-----------------------------
A0A518D182      AGLSSSPSS-GATVDPLTLGYLAELGRLQSQ-----------------------------
A0A7V4HWU2      ---------------------EDNLFNVFLE-----------------------------
A0A5C5WTY6      ---------------------ISQVLELSSE-----------------------------
A0A5C5Y033      ---------------------VTRLLMLNAE-----------------------------
A0A5C6G1Y2      ---------------------VTRLLMLNAE-----------------------------
A0A354PDV6      ---------------------YNNVLQLMSE-----------------------------
A0A5C6FZ02      ---------------------FAYLLKLNSE-----------------------------
M5TIT3          ---------------------ITHLLQLSSE-----------------------------
A0A5M6CY44      ---------------------FTHLLQLNSE-----------------------------
F2AXG2          ---------------------ITHLLRLTSE-----------------------------
M2BB46          ---------------------ITHLLRLNSE-----------------------------
L7CLQ6          ---------------------ITHLLRLNSE-----------------------------
A0A0J1B719      ---------------------ITHLLKLNSE-----------------------------
Q7UF18          ---------------------ITHLLRLNSE-----------------------------
A0A2G1W1E0      ---------------------ITHLLQLNSE-----------------------------
K5E235          ---------------------ITHLLQLNSE-----------------------------
A0A5C6FFI9      ---------------------YSRLLDLLQK-----------------------------
A0A5C5WDJ1      ---------------------YNRLLDLIQK-----------------------------
A0A5C5X547      ---------------------EEKFQALAKRLQGSGLEKSRQQYESDLAKIDDDLNFRKS
A0A353FIP5      ---------------------LQELAGLIAQ-----------------------------
A0A7V7MJI7      ---------------------LEQLSEYLVQ-----------------------------
A0A5B1CIK7      ---------------------ITHLLQLNSE-----------------------------
A0A5C5WHS2      ---------------------ITHLLQLNSE-----------------------------
A0A5C6B6G8      ---------------------ITGLLRLNSE-----------------------------
A0A5C5ZZN3      ---------------------ITHLLQLNSE-----------------------------
A0A5C5XS91      ---------------------ITHLLELNSE-----------------------------
A0A5C6C4E6      ---------------------ITHLLELNSE-----------------------------
A0A2E1VVJ1      ---------------------FQALQKVDAD-----------------------------
A0A3M2AEL0      ---------------------LQELGDLKAK-----------------------------
A0A2A2W9R6      ---------------------VNRLMELLSQ-----------------------------
A0A518HKC1      ---------------------VNRLMGLLSQ-----------------------------
A0A518L3P0      ---------------------VNRLMGLLSQ-----------------------------
A0A255R1S0      ---------------------FRRLMALTTR-----------------------------
A0A5B9MKP1      ---------------------AQRLLELTSK-----------------------------
A0A351FYP6      ----------------------REYQTGQTT-----------------------------
A0A0S8J591      ---------------------YQEIVELEKE-----------------------------
A0A532UT69      ----------------------TRLEQLQLR-----------------------------
A0A7V9G2R2      ----------------------KLYYELLAQ-----------------------------
A0A2D5AWU0      ----------------------PELQEIEKD-----------------------------
L0DC26          ----------------------KEKEGLAQR-----------------------------
M5RT57          ----------------------ALIADRKSM-----------------------------
D5SZ21          ----------------------EQLLQEQAK-----------------------------
A0A7X7U1J4      ----------------------NELTRMERD-----------------------------
A0A7V8E5N8      ----------------------QERVHIAEQ-----------------------------
A0A356KTN1      ----------------------NRLSEAELD-----------------------------
A0A7Y5LV28      ----------------------SERDRLTEA-----------------------------
A0A7Y5HFQ5      ----------------------RELRLKEFE-----------------------------
A0A7W1FMQ9      ----------------------AMILRFEGE-----------------------------
A0A7W1NA62      ----------------------QRLYVAEAD-----------------------------
A0A7V9JTP9      ----------------------KQLFDLLDR-----------------------------
A0A7W1FJ38      ----------------------QQLYEAEDA-----------------------------
A0A1G2YQB7      ----------------------SNVANLEQV-----------------------------
A0A353P687      ----------------------SNVANLEQV-----------------------------
A0A356EME5      ------------------------MAETTLR-----------------------------
A0A3L7P4E4      ----------------------REIFQLELE-----------------------------
A0A3L7PEB5      ----------------------REIFQLELE-----------------------------
A0A1U9NL64      --------------------------RLELR-----------------------------
A0A2N1UCJ3      --------------------------SLETE-----------------------------
A0A7V2H881      ----------------------REIRAMQEA-----------------------------
A0A7C4EK84      --------------------------RLELQ-----------------------------
A0A7C3F0T2      --------------------------RLELQ-----------------------------
A0A7X7U4K9      ----------------------LKRREL--------------------------------
A0A2E0X4J3      ----------------------EQVQAIEMQ-----------------------------
A0A838QZ11      ----------------------RQVQELEQT-----------------------------
A0A5C5YU10      ----------------------NQQQELELL-----------------------------
A0A517MPZ6      ----------------------KQIQDIQLQ-----------------------------
A0A5C6CNV7      ----------------------NKIRDLDLQ-----------------------------
A0A518K5H4      ----------------------GQIQMMEQN-----------------------------
A0A5C6AA28      ----------------------GQIQSVEQS-----------------------------
A0A2E7ESJ6      ----------------------DRYMALVLQ-----------------------------
A0A2E9VK20      ----------------------SQLIPLLLE-----------------------------
A0A3D4PJK1      ----------------------SQLIPLLLE-----------------------------
A0A355AI52      ----------------------KQLLEDRAQ-----------------------------
A0A354PCQ3      ---------------------KSIMINMEDS-----------------------------
A0A0S8GZ23      ----------------------AILVQLQME-----------------------------
A0A1I3DDV4      ---------------------FGKLIELQAE-----------------------------
A0A7V2UF66      ----------------------AELELLRAQ-----------------------------
A0A2E0SMM6      ----------------------DQLKADQAE-----------------------------
A0A3L7SI46      ----------------------DELLQDQAE-----------------------------
A0A5B9PJZ8      ----------------------NKYVELKML-----------------------------
A0A2S8G191      ----------------------SQIMQLEAE-----------------------------
A0A2E7EGG1      ----------------------KALRDQALN-----------------------------
A0A2E2N5A9      ----------------------ATKAQAAAR-----------------------------
A0A7C8AGA2      ----------------------SSIMQYEEL-----------------------------
A0A7C2FXP7      ----------------------TNIVELDQA-----------------------------
A0A1P8WP26      ----------------------QDLFDLEAQ-----------------------------
A0A3L7V1F3      ----------------------QELLDLESQ-----------------------------
A0A2E3GWC6      ----------------------SQLLPLLLE-----------------------------
F0SLB0          ----------------------SQLLPLLLE-----------------------------
A0A3L7NDH9      ----------------------KQLFEERTQ-----------------------------
A0A7X8IIB9      ----------------------QDIRRYEQL-----------------------------
A0A532UD06      ----------------------AELRRVEMD-----------------------------
A0A660URN1      ----------------------SELKDLELQ-----------------------------
A0A517ZCB5      ----------------------QELLSAQTE-----------------------------
A0A225EH48      ---------------------IAQFEKLKTA-----------------------------
A0A518INW8      ---------------------HTKVLGLMLR-----------------------------
A0A518JPH9      ---------------------HTKVLGLMLR-----------------------------
A0A5C5VEK8      ----------------------NQAQDLELA-----------------------------
A0A532UTJ0      ----------------------NHITQADQE-----------------------------
A0A2E2CCW9      ----------------------THLMPLLIQ-----------------------------
A0A3C0AGX3      ----------------------THLMPLLIQ-----------------------------
A0A518AAQ5      ----------------------THLMPLLIQ-----------------------------
A0A517QBG9      ----------------------THLMPLLIQ-----------------------------
A0A518FTU3      ----------------------THLMPLLIQ-----------------------------
A0A517WHH5      ----------------------THLMPLLIQ-----------------------------
A0A5A8BGT3      ----------------------THLMPLLIQ-----------------------------
A0A2E7K7A9      ----------------------THLMPLLIQ-----------------------------
A0A517PTS5      ----------------------THLMPLLIQ-----------------------------
A0A6I6AH34      ----------------------THLMPLLIQ-----------------------------
A0A517VTK3      ----------------------THLMPLLIQ-----------------------------
A0A517WQT4      ----------------------THLMPLLIQ-----------------------------
A0A517VID8      ----------------------THLMPLLIQ-----------------------------
A0A517RK10      ----------------------THLMPLLIQ-----------------------------
A0A518IH18      ----------------------THLMPLLIQ-----------------------------
A0A7W0M4Y4      ----------------------EKLFPLLLE-----------------------------
A0A2D5NDU9      ---------------------VEKLGNQRVE-----------------------------
A0A5C5XLF4      ----------------------SQLIPLLLE-----------------------------
A0A518CHE5      ----------------------DQLKVDQAE-----------------------------
A0A1V5N3W2      ----------------------QRVAQLEET-----------------------------
A0A517NSK8      ---------------------YNDYLNLVMR-----------------------------
A0A5C5Z0D6      ---------------------YDEYLQLVMK-----------------------------
A0A7W5H7D9      ---------------------YDEYLSLVMK-----------------------------
M5UE94          ---------------------YDEYLTLVMK-----------------------------
A0A3E0MY27      ----------------------ERLRDQEQE-----------------------------
A0A7V4M591      ----------------------QRLMEDRAA-----------------------------
A0A7X7F3G7      ----------------------QTLLADQAV-----------------------------
A0A7Y4VQ32      ----------------------NAAEESRHG-----------------------------
A0A2E0X9P6      ----------------------DRLTRIRKG-----------------------------
A0A1N6DAJ8      ----------------------IKAIERVYH-----------------------------
A0A2E8FLY0      ----------------------QQLINDQVE-----------------------------
A0A3D2U1E1      ----------------------QQLINDQVA-----------------------------
E8R3W3          ----------------------TAQVRLQTI-----------------------------
A0A5C5ZM48      ----------------------EQQMLMESR-----------------------------
A0A5B9WF77      ----------------------KQVKNELDH-----------------------------
A0A7C4Z5R7      ----------------------AQLSEVQDQ-----------------------------
A0A1P8WN28      ----------------------AKVALLETE-----------------------------
A0A3B9CTT0      ----------------------DKLNDEQGE-----------------------------
A0A518ALT3      ----------------------QQITEIKSK-----------------------------
A0A286RGB6      ----------------------RDVLRPEIA-----------------------------
A0A7V3TZQ6      ----------------------RDVLRPEIA-----------------------------
A0A3M1QRP3      ----------------------AELKKAEFE-----------------------------
A0A517TMV0      ----------------------SRLLDLRME-----------------------------
A0A3E0MY88      ----------------------RTLLQDRAT-----------------------------
A0A518BBX8      ----------------------NQLFPLLLS-----------------------------
A0A5B9QF68      ----------------------KQILASQAE-----------------------------
A0A5B9QGF0      ----------------------KQILTLQAE-----------------------------
A0A5C6CK24      ----------------------KQVLAAQAE-----------------------------
A0A7C5FXU1      ----------------------MRIQELART-----------------------------
A0A847YFA1      ----------------------ALTAQMRDT-----------------------------
A0A1C3E6N1      ----------------------EQLLQEQAK-----------------------------
A0A518GJT2      ----------------------EQLLQEQAK-----------------------------
A0A2E8B0L9      ----------------------RKLLADRAR-----------------------------
A0A5Q4GFE7      ----------------------RRLMEDQTR-----------------------------
A0A257WS34      ----------------------QQLQEYQAQ-----------------------------
A0A7C4LP10      ----------------------QELIADQQS-----------------------------
A0A2E3RCU8      ----------------------QGLIEDIAR-----------------------------
A0A517MLW3      ----------------------QKLLSDRAE-----------------------------
A0A5B9QVD0      ----------------------QKLLNDRAE-----------------------------
A0A3A0DET7      ----------------------RQVQEVEQA-----------------------------
A0A3B8PNV4      ----------------------QQLINDQVE-----------------------------
A0A3D1DR40      ----------------------QQLINDQVE-----------------------------
A0A2E7RYU8      ----------------------QQLINDQVE-----------------------------
A0A3B8LXG8      ----------------------QQLINDQVE-----------------------------
A0A6M5Z0K7      ----------------------KKVSDLRER-----------------------------
A0A350CI62      ----------------------QEILDRQSA-----------------------------
A0A4P5WQK6      ----------------------QEILDRQSA-----------------------------
A0A3C1X4W5      ----------------------QEILDLQSH-----------------------------
A0A3D3W3A7      ----------------------QEILDLQSH-----------------------------
A0A7Y5SKC2      ----------------------RDLLTYKGE-----------------------------
A0A7X7U104      ----------------------AELKRLERD-----------------------------
F0SI78          ----------------------SQLIPLMLE-----------------------------
A0A517MDV3      ---------------------MDSLLSLKVR-----------------------------
A0A518IQ30      ----------------------QRLLADRAL-----------------------------
A0A517LWP4      ----------------------QKLLADRAL-----------------------------
A0A518JNW8      ----------------------QKLLSDRAL-----------------------------
A0A2E3GWX1      ----------------------QQMIEDKAK-----------------------------
F0SG60          ----------------------QQMIEDKAK-----------------------------
A0A2E9VST2      ----------------------QQLIEDEAS-----------------------------
A0A356A6X2      ----------------------QQLIEDESS-----------------------------
A0A5C5XLM3      ----------------------QQLIEDEAS-----------------------------
A0A7V2UW16      ----------------------VEQVQLLQE-----------------------------
A0A518DRX3      ----------------------RQLIDERGQ-----------------------------
A0A518DZF9      ----------------------RQLIDERGQ-----------------------------
A0A2E7ENQ5      ----------------------RELNDDYAR-----------------------------
A0A7V2XSV8      ----------------------EEQVKLLQE-----------------------------
A0A847GXG1      ----------------------RELMDHRAK-----------------------------
A0A7C5BZF0      ----------------------QTLLEDQAR-----------------------------
A0A847YGH5      ----------------------RRILEDQVA-----------------------------
A0A286RLF2      ----------------------RKVVEDRVE-----------------------------
A0A7V3TX18      ----------------------RKVVEDRVE-----------------------------
A0A1G3AQE9      ----------------------KNLVDYRAE-----------------------------
A0A3L7UQT9      ----------------------EELQKLRND-----------------------------
A0A4P5YBU2      ----------------------EELQKLRND-----------------------------
A0A7C7V5U8      ----------------------RELLDAQAQ-----------------------------
A0A3M1VCL4      ----------------------QQLRSDYAE-----------------------------
A0A518AKT8      ----------------------RERLEAERE-----------------------------
A0A5C5ZR72      ----------------------SGLRELRKT-----------------------------
A0A7Y5SJZ4      ----------------------QQLLEDKAE-----------------------------
A0A5C5V7Z9      ----------------------KRLMETQDE-----------------------------
A0A5C5YT05      ----------------------QRLMETQDE-----------------------------
A0A518D7F9      ----------------------QKLLEDEQE-----------------------------
A0A5C5ZIP0      ----------------------TRLFDVEAQ-----------------------------
A0A518KBK3      ----------------------AKLIDLRDE-----------------------------
A0A5C6AKF9      ----------------------SKLIGVRDE-----------------------------
A0A7C2KUQ9      ----------------------VAVYEAEHR-----------------------------
A0A7C5R0U3      ----------------------QDLLAARTE-----------------------------
A0A847YCQ7      ----------------------SQLFEERQR-----------------------------
A0A286RD13      ----------------------TRWFEERQR-----------------------------
A0A7V3TUJ6      ----------------------TRWFEERQR-----------------------------
A0A517TY85      ----------------------DQMSAIKVK-----------------------------
A0A5B9QEI7      ----------------------QQMAEIKSQ-----------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      --FSLYSQ-------------------------------------------------R--
A0A533Q6B7      --ISLYSN-------------------------------------------------R--
A0A1U9NNE1      --VLGDQQ-------------------------------------------------TMV
A0A2G2JCA2      --LNQAVE----------------------------------------------------
A0A1G2XVR0      --KTMLSE-------------------------------------------------K--
A0A1G3B0P0      --KTMLSE-------------------------------------------------K--
A0A1E3X4X0      --VSNLSE-------------------------------------------------K--
A0A286U4B3      --YASELG-------------------------------------------------R--
A0A5C6DDS2      --YAGELD-------------------------------------------------R--
A0A5S9IJB5      --IQSLVT-------------------------------------------------GRN
A0A2E3GW02      --ESMLLE-------------------------------------------------K--
A0A5B9QNZ7      --LREEQS-------------------------------------------------R--
A0A1Z8N7H5      --LKSLSS-------------------------------------------------D--
A0A1U7CZ81      ---------------------------------------------------------R--
A0A142YNY8      ---------------------------------------------------------R--
A0A1U7GLS6      ---------------------------------------------------------R--
A0A1G2YPI3      --LAGSLR-------------------------------------------------Q--
A0A532UIN2      --RADRRR-------------------------------------------------Q--
A0A0S8KNX5      --LVVAKQ-------------------------------------------------T--
A0A3D3UVZ8      --LIIAQQ-------------------------------------------------T--
A0A517NFU9      --ERGFSD-------------------------------------------------A--
A0A5C5YWH4      --EQSLAD-------------------------------------------------A--
A0A3D2TNK4      --LQNLSM-------------------------------------------------H--
A0A7C1Y4F0      --LKDILY-------------------------------------------------L--
A0A6I0ENW6      --ETALQS-------------------------------------------------N--
A0A6L3A0B7      --ETALQS-------------------------------------------------N--
A0A0J1B4A0      --ERLMAA-------------------------------------------------E--
A0A142WSB9      --ESRLSQ-------------------------------------------------L--
M5SZR3          --ERELLT-------------------------------------------------L--
M5TW92          --EQELLT-------------------------------------------------L--
A0A2S8FKY2      --RFTLTE----------------------------------------------------
A0A517N8P6      --AEMLAI-------------------------------------------------Q--
A0A432MJP4      --QQRLAD-------------------------------------------------R--
M5UQ35          --LSFLRL-------------------------------------------------T--
A0A0S8FY64      --LQGALR-------------------------------------------------S--
A0A1N6KFT7      --YDTAKRATRNTNDPSLKYARERKVELESEIEDLWRQRRPLLLRQLTREMANEGDLA--
L0DFG4          --YNTAKRATRNTNDPSLQYARDRKEEIESEIEDLWRQRRPLLLRQLSREMADEGDQA--
A0A5C5XXG1      --KQRLQA-------------------------------------------------K--
A0A7C7YUM8      --LAAARA-------------------------------------------------E--
A0A7C2AHI6      --LARLSG-------------------------------------------------V--
A0A518BJJ1      --IASLQH-------------------------------------------------E--
A0A518D182      --REVLAS-------------------------------------------------T--
A0A7V4HWU2      --EQLLLE-------------------------------------------------E--
A0A5C5WTY6      --RQRLVS-------------------------------------------------V--
A0A5C5Y033      --REKLTA-------------------------------------------------V--
A0A5C6G1Y2      --REKLTA-------------------------------------------------V--
A0A354PDV6      --KQRLTT-------------------------------------------------V--
A0A5C6FZ02      --KQRLQA-------------------------------------------------K--
M5TIT3          --KQRLSS-------------------------------------------------V--
A0A5M6CY44      --KQRLNA-------------------------------------------------V--
F2AXG2          --KQRLTS-------------------------------------------------V--
M2BB46          --KQRLTS-------------------------------------------------V--
L7CLQ6          --KQRLTS-------------------------------------------------V--
A0A0J1B719      --KQRLTS-------------------------------------------------V--
Q7UF18          --KQRLTS-------------------------------------------------V--
A0A2G1W1E0      --KQRLTS-------------------------------------------------V--
K5E235          --KQRLTS-------------------------------------------------V--
A0A5C6FFI9      --ERTLVS-------------------------------------------------V--
A0A5C5WDJ1      --EKALSD-------------------------------------------------T--
A0A5C5X547      LIKRSFKK-------------------------------------------------E--
A0A353FIP5      --ARALEE-------------------------------------------------K--
A0A7V7MJI7      --QTLLAE-------------------------------------------------E--
A0A5B1CIK7      --KQRLTA-------------------------------------------------V--
A0A5C5WHS2      --KQRLTA-------------------------------------------------V--
A0A5C6B6G8      --KQRLTA-------------------------------------------------V--
A0A5C5ZZN3      --KQRLSS-------------------------------------------------V--
A0A5C5XS91      --KRRLSS-------------------------------------------------I--
A0A5C6C4E6      --RQRLAA-------------------------------------------------L--
A0A2E1VVJ1      --AAELAI-------------------------------------------------E--
A0A3M2AEL0      --RIRLRA-------------------------------------------------V--
A0A2A2W9R6      --RQVMRA-------------------------------------------------S--
A0A518HKC1      --RQVMRA-------------------------------------------------T--
A0A518L3P0      --RQVMRA-------------------------------------------------T--
A0A255R1S0      --RDVMRA-------------------------------------------------T--
A0A5B9MKP1      --RRVLVT-------------------------------------------------A--
A0A351FYP6      --LANKSI-------------------------------------------------D--
A0A0S8J591      --DKTRRY-------------------------------------------------R--
A0A532UT69      --LSDRLQ-------------------------------------------------W--
A0A7V9G2R2      --ESLLSQ-------------------------------------------------K--
A0A2D5AWU0      --LLEKEL-------------------------------------------------Q--
L0DC26          --AIDRVY-------------------------------------------------R--
M5RT57          --MHRVES-------------------------------------------------T--
D5SZ21          --MRTALE-------------------------------------------------S--
A0A7X7U1J4      --REDSLQ-------------------------------------------------R--
A0A7V8E5N8      --IASESQ-------------------------------------------------R--
A0A356KTN1      --LAGLRQ-------------------------------------------------R--
A0A7Y5LV28      --LAAARL-------------------------------------------------Q--
A0A7Y5HFQ5      --RARLVA-------------------------------------------------G--
A0A7W1FMQ9      --ESMLAE-------------------------------------------------K--
A0A7W1NA62      --AAKVAQ-------------------------------------------------K--
A0A7V9JTP9      --QITLGQ-------------------------------------------------K--
A0A7W1FJ38      --AKTLEQ-------------------------------------------------K--
A0A1G2YQB7      --LITAKQ-------------------------------------------------Q--
A0A353P687      --LITAKQ-------------------------------------------------H--
A0A356EME5      --EMAALA-------------------------------------------------R--
A0A3L7P4E4      --EALALQ-------------------------------------------------D--
A0A3L7PEB5      --EELALL-------------------------------------------------D--
A0A1U9NL64      --LADLKR-------------------------------------------------Q--
A0A2N1UCJ3      --LENALI-------------------------------------------------Q--
A0A7V2H881      --IDSLGN-------------------------------------------------T--
A0A7C4EK84      --LDLARE-------------------------------------------------K--
A0A7C3F0T2      --LREMKL-------------------------------------------------E--
A0A7X7U4K9      -----LNG-------------------------------------------------E--
A0A2E0X4J3      --IVAEQS-------------------------------------------------R--
A0A838QZ11      --LTAERS-------------------------------------------------R--
A0A5C5YU10      --LMAEQA-------------------------------------------------K--
A0A517MPZ6      --IDALRA-------------------------------------------------T--
A0A5C6CNV7      --IASLQS-------------------------------------------------T--
A0A518K5H4      --LIAQQA-------------------------------------------------K--
A0A5C6AA28      --LVSQQT-------------------------------------------------K--
A0A2E7ESJ6      --QEELEG-------------------------------------------------R--
A0A2E9VK20      --EQAALK-------------------------------------------------R--
A0A3D4PJK1      --EQAALK-------------------------------------------------R--
A0A355AI52      --LDTLQE-------------------------------------------------Y--
A0A354PCQ3      --DLVRVR-------------------------------------------------REY
A0A0S8GZ23      --LSSYKQ-------------------------------------------------R--
A0A1I3DDV4      --MSRLNG-------------------------------------------------L--
A0A7V2UF66      --LLEART-------------------------------------------------R--
A0A2E0SMM6      --LKSKLA-------------------------------------------------T--
A0A3L7SI46      --LQNRLM-------------------------------------------------T--
A0A5B9PJZ8      --EQELLQ-------------------------------------------------Q--
A0A2S8G191      --ILNVEQ-------------------------------------------------TAV
A0A2E7EGG1      --ASS-------------------------------------------------------
A0A2E2N5A9      --VDEVSQ-------------------------------------------------R--
A0A7C8AGA2      --IVIGQQ-------------------------------------------------T--
A0A7C2FXP7      --LIIARQ-------------------------------------------------R--
A0A1P8WP26      --LQTAMK-------------------------------------------------S--
A0A3L7V1F3      --LSDART-------------------------------------------------R--
A0A2E3GWC6      --EQVLLQ-------------------------------------------------R--
F0SLB0          --EQVLLQ-------------------------------------------------R--
A0A3L7NDH9      --LETMLE-------------------------------------------------F--
A0A7X8IIB9      --IRDGQA-------------------------------------------------T--
A0A532UD06      --LENARY-------------------------------------------------H--
A0A660URN1      --LANAKL-------------------------------------------------H--
A0A517ZCB5      --LRNKLS-------------------------------------------------F--
A0A225EH48      --VKEDSP-------------------------------------------------L--
A0A518INW8      --EQALTA-------------------------------------------------D--
A0A518JPH9      --EQALTA-------------------------------------------------D--
A0A5C5VEK8      --LMTEQS-------------------------------------------------K--
A0A532UTJ0      --LISMRL-------------------------------------------------I--
A0A2E2CCW9      --KNRLER-------------------------------------------------D--
A0A3C0AGX3      --KNRLER-------------------------------------------------D--
A0A518AAQ5      --KNRLER-------------------------------------------------D--
A0A517QBG9      --KNRLER-------------------------------------------------D--
A0A518FTU3      --KNRLER-------------------------------------------------D--
A0A517WHH5      --KNRLER-------------------------------------------------D--
A0A5A8BGT3      --KNRLER-------------------------------------------------D--
A0A2E7K7A9      --KNRLER-------------------------------------------------D--
A0A517PTS5      --KNRLER-------------------------------------------------D--
A0A6I6AH34      --KNRLER-------------------------------------------------D--
A0A517VTK3      --KNRLER-------------------------------------------------D--
A0A517WQT4      --KNRLER-------------------------------------------------D--
A0A517VID8      --KNRLER-------------------------------------------------D--
A0A517RK10      --KHRLER-------------------------------------------------D--
A0A518IH18      --KHRLER-------------------------------------------------D--
A0A7W0M4Y4      --KELQSE-------------------------------------------------S--
A0A2D5NDU9      --LLVE------------------------------------------------------
A0A5C5XLF4      --EQTALK-------------------------------------------------R--
A0A518CHE5      --LKSKLT-------------------------------------------------T--
A0A1V5N3W2      --LVMAQQ-------------------------------------------------T--
A0A517NSK8      --EKKLTE-------------------------------------------------N--
A0A5C5Z0D6      --EKKLAE-------------------------------------------------K--
A0A7W5H7D9      --EKKLRE-------------------------------------------------K--
M5UE94          --EKKLRE-------------------------------------------------K--
A0A3E0MY27      --MMKLIK-------------------------------------------------N--
A0A7V4M591      --LARLRS-------------------------------------------------E--
A0A7X7F3G7      --LESMRG-------------------------------------------------R--
A0A7Y4VQ32      --AEVAKE-------------------------------------------------H--
A0A2E0X9P6      --TQKYAE-------------------------------------------------T--
A0A1N6DAJ8      --IARNRS-------------------------------------------------D--
A0A2E8FLY0      --LRNKSG-------------------------------------------------E--
A0A3D2U1E1      --YRNDSA-------------------------------------------------E--
E8R3W3          --KDSMKK-------------------------------------------------F--
A0A5C5ZM48      --VESYRQ-------------------------------------------------TMR
A0A5B9WF77      --LESISR-------------------------------------------------KKS
A0A7C4Z5R7      --INETLA-------------------------------------------------VAA
A0A1P8WN28      --LNGLRR-------------------------------------------------H--
A0A3B9CTT0      --LSVLRR-------------------------------------------------H--
A0A518ALT3      --PRPRIS-------------------------------------------------D--
A0A286RGB6      --AR--------------------------------------------------------
A0A7V3TZQ6      --AR--------------------------------------------------------
A0A3M1QRP3      --VESARD-------------------------------------------------Q--
A0A517TMV0      --LQKVAP-------------------------------------------------F--
A0A3E0MY88      --VQGLLE-------------------------------------------------N--
A0A518BBX8      --ERELAV-------------------------------------------------D--
A0A5B9QF68      --LSSLSK-------------------------------------------------F--
A0A5B9QGF0      --LSSLSK-------------------------------------------------F--
A0A5C6CK24      --LSSLSN-------------------------------------------------F--
A0A7C5FXU1      --AQPEIA-------------------------------------------------QQF
A0A847YFA1      --VRPEFA-------------------------------------------------NRY
A0A1C3E6N1      --MRTALE-------------------------------------------------S--
A0A518GJT2      --MRTALE-------------------------------------------------S--
A0A2E8B0L9      --LDTARD-------------------------------------------------Y--
A0A5Q4GFE7      --LESLQQ-------------------------------------------------H--
A0A257WS34      --LQSLLA-------------------------------------------------K--
A0A7C4LP10      --LQNLLG-------------------------------------------------K--
A0A2E3RCU8      --LKSLSS-------------------------------------------------D--
A0A517MLW3      --VMRLEK-------------------------------------------------H--
A0A5B9QVD0      --LQTLAA-------------------------------------------------H--
A0A3A0DET7      --LASERA-------------------------------------------------R--
A0A3B8PNV4      --LQNKSG-------------------------------------------------E--
A0A3D1DR40      --LQNKSG-------------------------------------------------E--
A0A2E7RYU8      --LQNKSG-------------------------------------------------E--
A0A3B8LXG8      --LQNKSG-------------------------------------------------E--
A0A6M5Z0K7      --IQEFEL-------------------------------------------------R--
A0A350CI62      --LTEARQ-------------------------------------------------K--
A0A4P5WQK6      --LTEARQ-------------------------------------------------K--
A0A3C1X4W5      --LTEARQ-------------------------------------------------K--
A0A3D3W3A7      --LTEARQ-------------------------------------------------K--
A0A7Y5SKC2      --MRNLQN-------------------------------------------------H--
A0A7X7U104      --KADCLQ-------------------------------------------------Q--
F0SI78          --ESMLLE-------------------------------------------------K--
A0A517MDV3      --LREERS-------------------------------------------------R--
A0A518IQ30      --LQSQAK-------------------------------------------------H--
A0A517LWP4      --LQSQAK-------------------------------------------------H--
A0A518JNW8      --LQSQAK-------------------------------------------------H--
A0A2E3GWX1      --LRDKLN-------------------------------------------------NK-
F0SG60          --LRDKLN-------------------------------------------------NK-
A0A2E9VST2      --LRDKLN-------------------------------------------------GK-
A0A356A6X2      --LRDKLN-------------------------------------------------GK-
A0A5C5XLM3      --LRDKLN-------------------------------------------------GK-
A0A7V2UW16      --QRELAK-------------------------------------------------T--
A0A518DRX3      --LNNMLA-------------------------------------------------H--
A0A518DZF9      --LNNMLA-------------------------------------------------H--
A0A2E7ENQ5      --LESIQD-------------------------------------------------Y--
A0A7V2XSV8      --RQELLK-------------------------------------------------S--
A0A847GXG1      --LQALLA-------------------------------------------------H--
A0A7C5BZF0      --LENLVT-------------------------------------------------QRG
A0A847YGH5      --LNALRD-------------------------------------------------H--
A0A286RLF2      --LARLLQ-------------------------------------------------E--
A0A7V3TX18      --LARLLQ-------------------------------------------------E--
A0A1G3AQE9      --WETKRK-------------------------------------------------N--
A0A3L7UQT9      --WNDRRN-------------------------------------------------V--
A0A4P5YBU2      --WNDRRN-------------------------------------------------V--
A0A7C7V5U8      --MKKIQA-------------------------------------------------H--
A0A3M1VCL4      --LQRRLA-------------------------------------------------F--
A0A518AKT8      --MQSLSP-------------------------------------------------Y--
A0A5C5ZR72      --VKHP------------------------------------------------------
A0A7Y5SJZ4      --LQSLSE-------------------------------------------------M--
A0A5C5V7Z9      --LRRLTP-------------------------------------------------H--
A0A5C5YT05      --LRRLSP-------------------------------------------------H--
A0A518D7F9      --LRRVAP-------------------------------------------------F--
A0A5C5ZIP0      --LSRLEP-------------------------------------------------F--
A0A518KBK3      --LGRLEP-------------------------------------------------F--
A0A5C6AKF9      --LRRVEP-------------------------------------------------F--
A0A7C2KUQ9      --LETEGA-------------------------------------------------R--
A0A7C5R0U3      --LQSVLP-------------------------------------------------Y--
A0A847YCQ7      --VAPG------------------------------------------------------
A0A286RD13      --AAQG------------------------------------------------------
A0A7V3TUJ6      --AAQG------------------------------------------------------
A0A517TY85      --SRTKIG-------------------------------------------------D--
A0A5B9QEI7      --PRLKKD-------------------------------------------------V--
                                                                            

A0A5S9IPR9      YKP--AH-PS---IKKTINNIAQVKKQIFH------------------------------
A0A533Q9U4      YGM--KH-PK---IAGLKAELDTMRDNIMK------------------------------
A0A533Q6B7      YGP--KH-PK---VVQLNTELHTMRNHIIK------------------------------
A0A1U9NNE1      SGN-----PR---LEQRKEILTALKTRLDQ------------RREDIGKKFEELIEEQIN
A0A2G2JCA2      -----QH-PD---VLTLRARIATNGSTALEYEKTAVNFKDNATYQKLQKQILADKEDLAK
A0A1G2XVR0      YGE--KH-PN---IANIDLQLKEIENRIKL------------------------------
A0A1G3B0P0      YGE--KH-PN---IANIDLQLKEIENRIKL------------------------------
A0A1E3X4X0      YGP--RH-PQ---MVRLLTQMEAIKDKIDF------------------------------
A0A286U4B3      VKE--DH-PL---VQRLKTEKSLIEQEIKD------------------------------
A0A5C6DDS2      VKE--DY-PL---VQRMKAEKDFIEQQINS------------------------------
A0A5S9IJB5      LGI--NH-PQ---VVALKSKKKVIEERLTA------------------------------
A0A2E3GW02      LGE--QH-PK---VSEVRRRTEVMRTLLSQ------------EAGERTSTKPA-------
A0A5B9QNZ7      LGS--EH-PR---VLELRDTVRDVEQFLEA------------KNQALQPQQDSPE-----
A0A1Z8N7H5      FGP--AH-PR---IIEIQNRIQTTKQYIEY------------HDAELKTQLDE-------
A0A1U7CZ81      YGE--IR-QL---VMAEDASFAASAAAAGS------------GTVATNALTIEA------
A0A142YNY8      YPE--IR-AQ---ILAELEGRPTPTNPVRD------------ESIK----SIPE------
A0A1U7GLS6      YHD--IR-RR---VLAAGDGPMAASGP-GE------------PRQK----TVQE------
A0A1G2YPI3      MTP--GH-PV---VIAIESDISRSKAQIAN------------LDDE----FSQAQLAV--
A0A532UIN2      LKS--SH-PA---VMALETEIAHVKAQIA-------------------------------
A0A0S8KNX5      LSP--TN-PE---IELKAELIQTLKAHLEE------------RRQE----ASKAFDDLVE
A0A3D3UVZ8      LTA--EN-PE---LIRKNELLKTLKKHLED------------RKQE----ASNAFDNLVA
A0A517NFU9      FGA--GH-PL---VEAVRQEIEITRRFISS------------NQPA----ETKV------
A0A5C5YWH4      FGP--GH-PL---VEAARQEAEITRQFIAK------------NAPT----NAKV------
A0A3D2TNK4      YGP--NH-PR---IIELQQDVRSLDQYINN------------YHSG----AGDRLE----
A0A7C1Y4F0      CTE--EH-PS---VQAIKSKIDRINKELE-------------------------------
A0A6I0ENW6      MGE--NH-PR---MREMKAALELAEGSLRQ------------REEA----LLAGGEPAVA
A0A6L3A0B7      MGE--NH-PR---MREMKAALELAEGSLRQ------------REEA----LLAGGEPAVA
A0A0J1B4A0      FGE--NH-PS---VRALRTELDNMRRFVDE------------SREN----RPEEDKRVE-
A0A142WSB9      VGD--NH-AD---LKNVRSEITTILSAYRS------------QGIV----APTI------
M5SZR3          FGP--GH-PT---LASVRLRIEEAKNFYKT------------LEKE----YEEHHVAIRE
M5TW92          FGP--GH-PT---LASVRLRIEEAKNFYKT------------LEKE----YEEHHVAIRE
A0A2S8FKY2      -AA--YE-RY---RQTNSAEINAIETSLKE------------RRAH----LEKLVIERIA
A0A517N8P6      FAA--NH-PQ---RLTVEQKLKATEKALRE------------LQQT----RNNV------
A0A432MJP4      FGA--DY-SR---VRDIEEQIARVQQVAAD------------SRR---------------
M5UQ35          LGG--GH-PS---VREVENEIESLKQYVAK------------QQQD----KPEV------
A0A0S8FY64      FGL--KH-PE---VVALNDEREHVLSGLRE------------AMAR----AVDSIHSEY-
A0A1N6KFT7      LQK--AE-AE---LTSLAAEEASLYETLKE------------SKEK----SIEGLKTRHE
L0DFG4          IQK--AE-AE---LTSLEAEENSLYETLKE------------SKEK----AIASLREKHE
A0A5C5XXG1      FGA--SH-PD---VQDIDDEIRLVRKFIDE------------SNED----TVAE------
A0A7C7YUM8      MLA--SN-PA---LIALEGSRQELVAALVE------------QVAG----ALAGARVTQR
A0A7C2AHI6      ATE--DN-PD---VLRLEAAREDLLARLAS------------ELES----AETALTELAA
A0A518BJJ1      FLP--GY-PP---LAQAIAALDELRAKVRD------------SLRG----RLTGLQRLFE
A0A518D182      YTV--EH-PE---RARIERAIVELRARLTQ------------NLAQ----RAEALAALAD
A0A7V4HWU2      YGP--DH-PK---VKAARKRMNLMRTHMAS------------VAP---------------
A0A5C5WTY6      FGS--KH-PK---VADIEKQITLTKQFLFD------------QAKR----EEDS------
A0A5C5Y033      FGS--GH-PK---VREINNEIQLVEDFVRK------------SKEQ----TSPE------
A0A5C6G1Y2      FGS--GH-PK---VREINNEIQLVEDFVRK------------SKEQ----TSPE------
A0A354PDV6      FGP--SH-PK---VKDIQDQIDLVKNFLDE------------KKDG----TSVG------
A0A5C6FZ02      FGA--SH-PD---VQDIDDEIRLVRKFIDE------------SNED----TVAE------
M5TIT3          FGA--AH-PK---VQELEGEIALVKQFLQD------------KQDL----MNPA------
A0A5M6CY44      FGP--GH-PK---VQEIEGEIELVKQFLQD------------NEEL----TNPD------
F2AXG2          FGP--GH-PK---VQELESEITLVKEFLQD------------QKDL----TSPA------
M2BB46          FGP--GH-PK---VQELESEITLVKEFLQD------------QKDL----TSPA------
L7CLQ6          FGP--GH-PK---VQELESEITLVKEFLQD------------QKDL----TSPA------
A0A0J1B719      FGP--GH-PK---VQELESEITLVKEFLQD------------QKDL----TSPA------
Q7UF18          FGP--GH-PK---VQELESEITLVKEFLQD------------QKDL----TSPA------
A0A2G1W1E0      FGP--GH-PK---VQELESEITLVKEFLQD------------QKEL----TSPA------
K5E235          FGP--GH-PK---VQELESEITLVKEFLQD------------QKEL----TSPA------
A0A5C6FFI9      YGV--SH-PL---IKSTREEIDVIERFVAA------------NAPA----ALEE------
A0A5C5WDJ1      FGP--EH-PL---VEAAREETMITRQFIDA------------NRPE----NTAR------
A0A5C5X547      YER--EN-RR---LQEQFEQDQLAYELDWR------------RIEA----ERLR------
A0A353FIP5      HTE--KW-PP---LIRLRGQIKKLRTNISN------------A-----------------
A0A7V7MJI7      HTD--KW-PP---LRELNAQIDNLRARIRS------------N-----------------
A0A5B1CIK7      FGP--GH-PK---VQDIQGQIEGVKEFLQS------------NENL----AESA------
A0A5C5WHS2      FGP--GH-PK---VQDIQSEIESVKAFLQE------------NDEL----AEPA------
A0A5C6B6G8      FGP--GH-PK---VQELENEIQLVKQFLQD------------NEEL----TNVS------
A0A5C5ZZN3      FGP--AH-PK---VQELESEITLVKQFLQD------------NQDL----TSPT------
A0A5C5XS91      FGA--AH-PK---VLEIQNQIDLVKEFLQD------------KQEL----TNPA------
A0A5C6C4E6      FGA--GH-PK---VQEIENQIALVKQFLQE------------KREL----TTPS------
A0A2E1VVJ1      YTD--EW-PA---LKELRERSVELRGSIRD------------N-----------------
A0A3M2AEL0      YTD--QW-PE---LVELNQRIEELEGRLLL------------A-----------------
A0A2A2W9R6      YGA--GH-PS---VVALDTEIASIEKFTPQ------------EGDE----SSEK------
A0A518HKC1      YGA--GH-PS---VVALDTEIASIQKFAPQ------------EGDE----PSEE------
A0A518L3P0      YGA--GH-PS---VVALDTEIASIQKFSPQ------------DGDE----QPDS------
A0A255R1S0      FGD--SH-PS---VRSLDSEIVNLRKYVDN------------FRAG----SEKD------
A0A5B9MKP1      FGM--GH-PS---VVALDAEIRAFEKIGEL------------SDAE----QAGG------
A0A351FYP6      LGE--GH-PT---IKSLKAAMESLNQQIDN------------------------------
A0A0S8J591      -----DQDRL---SRNMEVRVEQVNQQIAV------------------------------
A0A532UT69      VTR--EF-PA---ITALEAEILRTKSKIAE------------QDTKFA------------
A0A7V9G2R2      YLE--KH-PR---MIEIHQQQATKRTQLDQ------------VVEMVKNSI---------
A0A2D5AWU0      LQRRERD-QGDLLLAELRDEVAVLKERKRD------------ILLQYARNY---------
L0DC26          IARNKND-PA---IKKHRDDLEAARAGLAA------------QHRKLYPIVARQLQD---
M5RT57          AAGGRND-PS---YLRLEAEVEGYEASLKR------------AVASSRPKITDQLKS---
D5SZ21          YGP--NH-PK---VMELRDAIQAKEQWMASRRQVTIDRLKQLRMEELTPRL---------
A0A7X7U1J4      LRP--DH-PA---VLAMDAEIKRMRIRLDE------------QNAGFARTV---------
A0A7V8E5N8      LKD--GH-PR---MIDLKAQLASVEAKIRE------------AVQGCLLAL---------
A0A356KTN1      FSD--EW-HE---VRIARARRDQIKLQLQS------------EIEKIRERL---------
A0A7Y5LV28      YKE--RH-PR---VLELETGIREVEGQIRA------------AIEGALVAL---------
A0A7Y5HFQ5      YAE--DA-EQ---VRAVDLDIRTLEERRRN------------LIATIVGKI---------
A0A7W1FMQ9      YKD--RH-PR---MVELRGHLTAKRQQLNE------------AVTSSADAI---------
A0A7W1NA62      YLD--KH-PR---ALEAKERIAVERANLDQ------------AIAAASATV---------
A0A7V9JTP9      YGE--RH-PR---IIEIDQEIAAKRQHLGE------------SMAMAKATI---------
A0A7W1FJ38      YGG--KH-PR---MIEANELITSKRQRLVE------------TVAQARSGI---------
A0A1G2YQB7      LAS--TN-PE---LARKESLLSALKQRLEE------------LKEQASKNFDEMATM---
A0A353P687      LAP--TN-PE---LARKESLLNALKQRLEE------------LRQQADKNFDEMAEK---
A0A356EME5      NPS--QD-PQ---CVKLSQDLERNKKSLEQ------------MRRELATQYQVQYRT---
A0A3L7P4E4      HGE--DH-PK---VRSIRKRIEMTRKYLSN------------ELSD--QIAPPAKKM---
A0A3L7PEB5      LGE--DH-PK---VQSIRKRIEMTRKYLSN------------ELDETSSTTGPAKKI---
A0A1U9NL64      VTE--DH-PS---VIALEEKIASIETDLEE------------S------------DQ---
A0A2N1UCJ3      CSE--GH-PT---VKALKSRIEAAQNKLAA------------Q------------IE---
A0A7V2H881      YGP--MA-PR---LGNTAERVEARKKELEA------------E------------EA---
A0A7C4EK84      LGP--EH-PE---VRMKELAVQALRQRLAE------------QDQLT-AAASSERDG---
A0A7C3F0T2      CTD--TH-PG---VAALEKKLAEQRQRLAD------------L------------EK---
A0A7X7U4K9      FTV--NH-PR---VASIDDEIQQIETRLSE------------L------------DG---
A0A2E0X4J3      WGE--GH-PR---VEVLLTSLETLQLRLAE------------K-----QAEIAENRA---
A0A838QZ11      WGE--GH-PR---VKLLRES-------LAE------------Q-----SKKLTKKQA---
A0A5C5YU10      WGD--AY-PT---VKSIQRSLDQSGLRIEA------------K-----RESIEAEKE---
A0A517MPZ6      WGD--GH-TR---VKLALQSKAAMEERLAK------------Q-----LEATEERKK---
A0A5C6CNV7      WGD--GH-PR---VRIMLESREKLQARLDK------------Q-----QADIEKNKE---
A0A518K5H4      WGP--GY-PA---VRLLEESLAKLRERRAE------------Q------------QQ---
A0A5C6AA28      WGP--GY-PS---VRLLQDSLDKLRSKQAE------------Q------------QQ---
A0A2E7ESJ6      YGK--DH-PD---VLTVRRQLERYETTYPE------------LVNGTIKP----------
A0A2E9VK20      YGS--GH-PD---VINVRKRIDLVKSYYRQ------------MGIDLPTMTTKVNPATGE
A0A3D4PJK1      YGS--GH-PD---VINVRKRIDLVKSYYRQ------------MGIDLPTMTTKVNPATGE
A0A355AI52      YGP--NH-PK---VIERTRKIEQMQGYLAQ------------FDVIGSPRSFGGDDTQ--
A0A354PCQ3      YEE--NR-AK---MKDWEQRLQEAKLAARD------------PAIEKLNRLADEELARRT
A0A0S8GZ23      LTL--KN-PE---IERITKSIETFEKDLEI------------YRAKAGEKFDEAMVR---
A0A1I3DDV4      FGP--NH-PT---VENLRKNIEIVEGLLKE------------SQAKTQNNPLFEKL----
A0A7V2UF66      VTD--SH-PL---IETLQRRITEAERRLAE------------------------------
A0A2E0SMM6      LDY--NH-PD---VVVLTNRISAAEESLNQ------------RLQSTNNEYHQQHNRK--
A0A3L7SI46      LGP--KH-PT---IRQLEDRIQQTQTWLSE------------RRHVVSSAMKDVRERE--
A0A5B9PJZ8      YGS--NH-PE---LKNVRKQIAMVDSMRMQ------------ELSSLRGEENELQ-----
A0A2S8G191      PGI--QE-QY---VGKYRDTIVELEEHVRL------------RKDQIVKGRAQ-------
A0A2E7EGG1      RGG--TD-PR---IIKLNQDIESLESTLES------------LRDTNRPRIREEMKA---
A0A2E2N5A9      YGP--GH-PE---LIAAKADLDAATASLKT------------QVSQVVSG----------
A0A7C8AGA2      MTP--EN-PE---LKQRKEVLETLKERLTQ------------RQEEVAGQFEKNLEAETA
A0A7C2FXP7      LTA--TN-PE---LRLKENLLATLQSKLDE------------QIAKTGKMCDDMLAERAT
A0A1P8WP26      YGA--KH-PT---IIDLQNQIATKRNFMTQ------------NPAMRMQAAEENSRGY--
A0A3L7V1F3      YGE--NH-SK---IKALTENIQLKKKYLEE------------YPRQQQQEMKRLAETE--
A0A2E3GWC6      YND--GH-PD---VINIRKRIDIILSYYRK------------RGIELPVNPANGKAIVGP
F0SLB0          YND--GH-PD---VINIRKRIDIILSYYRK------------RGIELPVNPANGKAIVGP
A0A3L7NDH9      YGP--QH-PK---VIERTNKIRKIEQYLDQ------------FDGVAAPREFAGDDEK--
A0A7X8IIB9      MLE--TN-PE---MQRRKQVLEELQQELEK------------QRQEVTARYEKNLLAE--
A0A532UD06      CTE--DH-PS---VKAIQSEIHRINKELNE------------QAKE--------------
A0A660URN1      CTE--DH-PS---IEAIRGRIKYIKQLLGE------------KAKN--------------
A0A517ZCB5      YGP--KH-PE---ILELQDKIRITQQYLTD------------QPRMTSESVKRASTED--
A0A225EH48      YAR--EK-DH---LAKLEEDLRTTLEEFRS------------K-----------------
A0A518INW8      YGD--DH-PL---VQRVRDELASVRQYIRE------------KAPEGIEELVASNL----
A0A518JPH9      YGD--EH-PL---VQRVRDELTSVRNYINE------------KAPTGLEEIVSSGM----
A0A5C5VEK8      WGD--EY-PT---VKSIQRSLDQAEQRIVQ------------KEADIAK-----------
A0A532UTJ0      LQP--EN-PD---LKRKAELLETLKNHLKQ------------REQEASQAFDERVTKEIA
A0A2E2CCW9      FQK--NH-PD---LDAVNRSIETIINLYRR------------QGLDISADNLESGEFQVA
A0A3C0AGX3      FQK--NH-PD---LDAVNRSIETIINLYRR------------QGLDISADNLESGEFQVA
A0A518AAQ5      FKK--NH-PD---LDAVNRSIETIVNLYRR------------QGLEISAENLESGEFQVS
A0A517QBG9      FKK--NH-PD---LDAVNRSIETIVNLYRR------------QGLEISADNLESGEFQVS
A0A518FTU3      FKK--NH-PD---LDAVNRSIETIVNLYRR------------QGLEISAENLESGEFQVS
A0A517WHH5      YKK--NH-PD---LDAVNRSIDTIINLYRR------------QGIEISADNLESGEFQVS
A0A5A8BGT3      YKK--NH-PD---LDAVNRSIDTIINLYRR------------QGIEISADNLESGEFQVS
A0A2E7K7A9      YKK--NH-PD---LDAVNRSIDTIINLYRR------------QGIEISADNLESGEFQVS
A0A517PTS5      YKK--NH-PD---LDAVNRSIDTIINLYRR------------QGIEISADNLESGEFQVS
A0A6I6AH34      YKK--NH-PD---LDAVNRSIDTIINLYRR------------QGIEISADNLESGDFQVS
A0A517VTK3      FGE--NH-PD---LDAVNRSIKTIVNLYRK------------QGIEISADNLNSGDFKLS
A0A517WQT4      FGE--NH-PD---LDAVNRSIKTIVNLYRK------------QGIEISADNLNSGDFKLS
A0A517VID8      FQK--NH-PD---LDAVNRSIETIINLYRR------------QGLDISAENLESGEFQVA
A0A517RK10      YQK--NH-PD---LDAVNRSIETVINLYRR------------QGLDISAENLESGDFKIA
A0A518IH18      FQK--NH-PD---LDAVNRSIETVINLYRR------------QGLDISAENLESGDFKIA
A0A7W0M4Y4      LGP--GH-PR---IVAIDKQIAMTRTHLDS------------LLNLGGGTG---------
A0A2D5NDU9      LQP--EH-WR---VAALDRDIAALNSQLSK------------MRSVDAENLES-------
A0A5C5XLF4      YGS--GH-PD---VINVRKRIDLVKSYYRQ------------MGIDLPTMTTKVNPVTGE
A0A518CHE5      LDY--NH-PD---VMVLTNRIQSAEDALQQ------------RLQSNQSSYHVQQNRR--
A0A1V5N3W2      LAP--TN-PE---IEQQTKTLEAFKERTQK------------QREDLEKTFDEMVAKELT
A0A517NSK8      FGD--DH-PT---VVSIREQITMMRKFIDD------------KAAEVGDGAVIEKMKPDE
A0A5C5Z0D6      FSE--GH-PQ---VVSIREQIDLMRQFIDE------------NSAKITASEIRERMEPAE
A0A7W5H7D9      FSD--GH-PQ---IVSLREQIAMMRKFIDD------------NSAKITASDTRERMQPAE
M5UE94          FSD--GH-PQ---IVSLREQIEMMRKFIDN------------NSSKIQARDAQERITPAE
A0A3E0MY27      --P--DRSEV---MKRLREQIAEAEKDLAK------------READVTLEIEEQEIIP--
A0A7V4M591      VGP--KH-PE---LVALRDRIAMTEQFLGG------------YQDRLQERIAELRKGR--
A0A7X7F3G7      VGM--SH-PS---MIAQQEKVRLAREYLQR------------NQERAAESISRLQNEQ--
A0A7Y4VQ32      FGD--GH-PT---MKKWQADVAHAEKMLAK------------REAELDDPRFAPIPVNSE
A0A2E0X9P6      LAD--VH-DA---QSALNERKREVQEELSS------------ARRAERQLQRDRDIVE--
A0A1N6DAJ8      --------PS---LKKYRDELEAARAELVA------------QRRKLYPIIQQQLQD---
A0A2E8FLY0      FGP--NH-PA---IQRLVARIRDRQKWLAD------------RPKNLIKQMQQLSTAQ--
A0A3D2U1E1      LGP--NH-PR---MQMLSARIKARQQWLSK------------RPTDISAQMSSLAKDR--
E8R3W3          RNT--QD-PS---YKKLETELRYREIDFLR------------LQNEAREAIRRDLEASRL
A0A5C5ZM48      RPE--QS-RE---YRDLNAGLQDIVSAMAG------------RVEMLRSQVMSESIGS--
A0A5B9WF77      DPS--RK-AA---QTQLSKLEKQYYDLWET------------KKGQIRERLLVTTSGV--
A0A7C4Z5R7      RGL--KE-PT---LQPLIKQREALEAVLES------------RRKEWEGRLEAQ------
A0A1P8WN28      FGS--GH-SD---IIRREQQLVGQKQRLAN------------MQLQLGENVNVGVRDPQ-
A0A3B9CTT0      YGS--GH-PE---IISRTSKIQLFEQRVKA------------ARADLDRRLQIGIRGPE-
A0A518ALT3      TWE--KD-PD---YLRVNALLIETRRSLTA------------LREHARTE----------
A0A286RGB6      YGN--RYVQE---LADVQSRIKARREEIRQ------------ELEQRRVRDLDEEIEN--
A0A7V3TZQ6      YGN--RYVQE---LADVQSRIKARREEIRQ------------ELEQRRVRDLDEEIEN--
A0A3M1QRP3      FGE--SH-PT---MVRLRRQVDFYKQQLAE------------RERELELAPPATVGVKRD
A0A517TMV0      YGP--AH-PQ---VATLQQQVAGVEQYLAS------------YRSDTTGRPGGLADAE--
A0A3E0MY88      LGP--NH-PR---VKEMTEKIRMTERHLAE------------YGERIRAQVGTLQSTT--
A0A518BBX8      FGP--DH-PK---LKMLRDRIQLARNFFAR------------PTAAFAAFSGDHESAETL
A0A5B9QF68      YGP--NH-PR---ILDLQNRIANSQQYVRD------------YRANLGNPSNGMAESH--
A0A5B9QGF0      YGP--NH-PR---ILDLQTSIANSERYVRE------------YRANLGNQSNGMAQNH--
A0A5C6CK24      YGP--NH-PR---ILDLQKSIANSERYVRE------------YRANLGKQQNGMVQQH--
A0A7C5FXU1      AAR--YQ-ED---LKRISEQLEKRRGELLE------------E-----------------
A0A847YFA1      EGR--YA-RE---LAEVEAKIQARREELKQ------------E-----------------
A0A1C3E6N1      YGP--NH-PK---VIELRDAIQAKEQWMAS------------RRQVTIDRLKQLRMEE--
A0A518GJT2      YGP--NH-PK---VMELRDAIQSKEQWMAS------------RRQVTIERLKQLRTEE--
A0A2E8B0L9      LGP--TH-PE---VQELVRNIRNAEQHIQE------------FQANVNRRLDGVQSEQ--
A0A5Q4GFE7      YGR--AH-PK---VIELMQQIQAGRQYLMN------------YQEMVNQRLAGLSDGR--
A0A257WS34      LGP--AH-PE---VQALEERIAATQNYIVN------------RNVIVTERLKEMRSNE--
A0A7C4LP10      LGP--AH-PD---VVQLESKIAATQRYLSN------------RNIAVAESIKQLSANE--
A0A2E3RCU8      FGP--SH-PK---IIEIQNRIQTTKQYIEY------------HDAQLKTQVDNLESNQ--
A0A517MLW3      LGP--TH-PS---MVALQGEISNAETYLSD------------FQARVNGRSSNQSGGQ--
A0A5B9QVD0      YGP--TH-PE---IQQLNAEIANGQNYLEN------------FQERVNGQVSQTSGQQ--
A0A3A0DET7      WGE--GH-PR---VKLLRQSLAELRDKLTK------------MQEI--------------
A0A3B8PNV4      YGP--NH-PL---IQKLTARIRDRQKWLTE------------RPKSVVDQMQKLSKAQ--
A0A3D1DR40      YGP--NH-PL---IQKLTARIRDRQKWLTE------------RPKSVVDQMQKLSKAQ--
A0A2E7RYU8      YGP--NH-PL---IQKLTTRIRDRQKWLAE------------RPKSVVDQMQKLSEAQ--
A0A3B8LXG8      YGP--NH-PL---IQKLTTRIRDRQKWLAE------------RPKSVVDQMQKLSEAQ--
A0A6M5Z0K7      AAP--TT-TA---RGMFQQPLAEAEKAAAA------------IRAERRKELVARNQKL--
A0A350CI62      YGA--KH-AR---IRALETELAVKEKYLRE------------FPELQRTRTDTMTREV--
A0A4P5WQK6      YGA--KH-AR---IRALETELAVKEKYLRE------------FPELQRTRTDTMTREV--
A0A3C1X4W5      YGA--RH-AR---IRALEAELQVKEKYLAD------------FPEMQRTRTDTMTRDV--
A0A3D3W3A7      YGA--RH-AR---IRALEAELQVKEKYLAD------------FPEMQRTRTDTMTRDV--
A0A7Y5SKC2      LGP--AH-PK---VAALADKIRETEQYLLG------------YQDRVRERLEQLENSH--
A0A7X7U104      LKS--DA-PA---ISALDAEISQIEKQIAD------------LDSD--------------
F0SI78          LGE--QH-PK---VSEVRRRTEVMRTLLSQ------------EAGERTSTKPASARPD--
A0A517MDV3      LGD--AH-PK---VQDLQDAVQDVEQFLTA------------KRDAIKPLADSPEVRS--
A0A518IQ30      FGP--VH-PK---IQMLQQKIADSERYLAE------------YRAKMQAANGPGQEQQ--
A0A517LWP4      LGP--VH-PT---IQMLQQKIADSERYLLE------------YRAKINAANGPQQEQQ--
A0A518JNW8      LGP--VH-PK---IQMLQQKIADSERYLLE------------YRAKMNAANGPQQEQQ--
A0A2E3GWX1      LGP--NH-PE---VQELQQRIDGTNEWLEN------------RSAQVAEGSDKINAE---
F0SG60          LGP--NH-PE---VQELQQRIDGTNEWLEN------------RSAQVAEGSDKINAE---
A0A2E9VST2      LGP--NH-PE---ILELKERVKAARDWMNG------------RGQQASQDSKQLTHD---
A0A356A6X2      LGP--NH-PE---VLELQERVKAARDWMNG------------RGQQASQDSKQLTRD---
A0A5C5XLM3      LGP--NH-PE---VLELQERVKAARDWMNG------------RGQQATQDSKQLTRD---
A0A7V2UW16      YKD--RH-PR---LAAVQSRLDSLEESLRE------------EAERVAEGL---------
A0A518DRX3      YGE--AH-PK---VIALRNSIVSGEQYMAD------------IRFKAETQQNSIAGQQ--
A0A518DZF9      YGE--AH-PK---VIALRNSIVSGEQYMAD------------IRFKAETQQNSIAGQQ--
A0A2E7ENQ5      YGS--NH-PT---FIEVRQSILKKEEYLAE------------HGTE-GAEIDGFQNQQ--
A0A7V2XSV8      YRE--KH-PR---LLALQSRIDVIDESLKR------------EAERVAAGM---------
A0A847GXG1      YGE--AH-PK---VVEVMQSVRAAEEYLGN------------YQALAEQRLSGLDDQR--
A0A7C5BZF0      YGW--AH-PE---VLALQEKIRRTQEFLQN------------YPQWIKSRTEAISSSE--
A0A847YGH5      LGD--NH-PR---VQQLVQRIAANQLFLQG------------FQQRLRERLGAIEAGE--
A0A286RLF2      FGN--NH-PR---VQALQQRIAANEAFLLA------------YQDRLRARLDNLNIPE--
A0A7V3TX18      FGN--NH-PR---VQALQQRIAANEAFLLA------------YQDRLRARLDNLNIPE--
A0A1G3AQE9      LGD--NH-PE---LIALEDKIRVTEQSLLE------------YPGRIRQRM---QDAG--
A0A3L7UQT9      LGD--NN-PD---LLELAQRIRAHEDLVNN------------YFQRAKMNLTA-NSAD--
A0A4P5YBU2      LGD--NN-PD---LLELAQRIRAQEDLVNN------------YFQRAKMNLTA-NSAD--
A0A7C7V5U8      LGP--SH-PD---YQATRERIRELEGYLDN------------FHTRVVERLAQIQEHQ--
A0A3M1VCL4      LGP--NH-PR---ILSLRDRIRANEQYVTQ------------YRAGMAQQLRAATETH--
A0A518AKT8      LGP--NN-PR---MLELKARIDGIDQYLTN------------YRTAAGQRIAGMTGNE--
A0A5C5ZR72      --Q--SN-RD---YMALSERVRQEEQSLSE------------FKDKLRQSLLLSARMS--
A0A7Y5SJZ4      CGP--AH-HR---VRQIQMRIQGAEEYLGS------------LSSNASSPGRQIANED--
A0A5C5V7Z9      YGP--NH-PR---VVSLTEQAAALQQYLSN------------YHAASGSRYASINNQD--
A0A5C5YT05      YGP--NH-PQ---IKELTEQVAALQQYLSS------------YHAASGSRYASINNGD--
A0A518D7F9      LAE--NN-PT---VTALNERIAATKQYLAG------------RHVGAGEALGGIGDSE--
A0A5C5ZIP0      YGP--AH-PE---VVALSTQAQAIKKYLAE------------YRNGASGRADFLGQEE--
A0A518KBK3      YGP--SH-PQ---VATLKSQIDSTQQFLAS------------YRSDASGRPTGLTAAE--
A0A5C6AKF9      YGP--SH-PQ---VVTLRSQIEATEQYLAS------------YRSDASGRPTGLSREE--
A0A7C2KUQ9      LGD--AN-QR---MAELRAEVEHRKRLRAM------------RERDLHNLWKTNPGRALA
A0A7C5R0U3      LGP--AH-PR---VRQLQEQIARQEAFLSR------------TRQLPRLLATQDPRQL--
A0A847YCQ7      --I--EA-PT---VRRLSEELQALEAATAQ------------RRAELEPALTEYAREQIE
A0A286RD13      --E--KA-PS---AQRIQEEMETLRKGLEQ------------RRAELTPQLVEFAREQLA
A0A7V3TUJ6      --E--KA-PS---AQRIQEEMETLRKGLEQ------------RRAELTPQLVEFAREQLA
A0A517TY85      SWS--SD-PE---YLSLEAAAKEANAALEQ------------LKATARAESLAARRAD--
A0A5B9QEI7      TWE--ED-PQ---YIQLQEQAKNVEAELKE------------LKELVKRELIALRREE--
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      RSSEFQVAE---------------------------------------------------
A0A2G2JCA2      LKIDLKT-----------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      KEAAEAGTKQLVA-----------------------------------------------
A0A3D3UVZ8      KESAVAGNKQLVA-----------------------------------------------
A0A517NFU9      ---------------------QSRK-----------------------------------
A0A5C5YWH4      ---------------------ATKK-----------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      AGAVSDGSLDPAMRLKELDYLAKRG-----------------------------------
A0A6L3A0B7      AGAVSDGSLDPAMRLKELDYLAKRG-----------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------EKEDLAAVAQGAAAKSGNK-----------------------------------
M5SZR3          YADEAVDVGGYRKWKDASGTMEVSARLISEEESKVTLEREDNGKRVTLATASLSGDDQRL
M5TW92          YADEAVDVGGYRKWKDASGTMEVSARLISEEENKVTLERENNGKRVTLATASLSSDDQRL
A0A2S8FKY2      QQQAEGDVRKNSMMTTSLKLPEVDN-----------------------------------
A0A517N8P6      -------------SPEKIDVVKRQD-----------------------------------
A0A432MJP4      ---------------------SVES-----------------------------------
M5UQ35          -------------------ADDEVV-----------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A1N6KFT7      TLVKTLGADAPESIEAKSQVDRATE-----------------------------------
L0DFG4          NLTKTLGPNSPETIQAKADVDQATE-----------------------------------
A0A5C5XXG1      ------------------APFGENS-----------------------------------
A0A7C7YUM8      GLEALRADYTASIKTWPITERGTIR-----------------------------------
A0A7C2AHI6      DRDALADSYAETLGELPLEERGKVD-----------------------------------
A0A518BJJ1      DRSELAKTAALAATDLPDANARVDR-----------------------------------
A0A518D182      DRDELAATARDAAMAQSGRDLESID-----------------------------------
A0A7V4HWU2      ---------------------GAEG-----------------------------------
A0A5C5WTY6      ---------SQA---------SSPT-----------------------------------
A0A5C5Y033      ---------MTF---------GSQA-----------------------------------
A0A5C6G1Y2      ---------MAF---------GSQA-----------------------------------
A0A354PDV6      ---------A-----------GAGM-----------------------------------
A0A5C6FZ02      ---------APF---------GENS-----------------------------------
M5TIT3          ---------SAF---------GSST-----------------------------------
A0A5M6CY44      ---------GLM---------ADTM-----------------------------------
F2AXG2          ---------EMF---------GDSA-----------------------------------
M2BB46          ---------EMF---------GDSA-----------------------------------
L7CLQ6          ---------EMF---------GDSA-----------------------------------
A0A0J1B719      ---------EMF---------GDSA-----------------------------------
Q7UF18          ---------EMF---------GDSA-----------------------------------
A0A2G1W1E0      ---------EMF---------GDSA-----------------------------------
K5E235          ---------EMF---------GDSA-----------------------------------
A0A5C6FFI9      ---------EKS------------T-----------------------------------
A0A5C5WDJ1      ---------EQK------------D-----------------------------------
A0A5C5X547      ---------ALKAQGGGTLIVGDTG-----------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A7V7MJI7      ------------------------------------------------------------
A0A5B1CIK7      ---------SMF---------GEST-----------------------------------
A0A5C5WHS2      ---------AMF---------ADST-----------------------------------
A0A5C6B6G8      ---------TGF---------SDTM-----------------------------------
A0A5C5ZZN3      ---------SAF---------GESA-----------------------------------
A0A5C5XS91      ---------MAF---------TDTA-----------------------------------
A0A5C6C4E6      ---------LSF---------NESS-----------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      ---------KES----------EFD-----------------------------------
A0A518HKC1      ---------KES----------DFD-----------------------------------
A0A518L3P0      ---------AKS----------EFD-----------------------------------
A0A255R1S0      ---------AGEEIVETVEAGRVFD-----------------------------------
A0A5B9MKP1      ---------AGE---------KAFD-----------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A7V9G2R2      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A7X7U1J4      ------------------------------------------------------------
A0A7V8E5N8      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A7Y5LV28      ------------------------------------------------------------
A0A7Y5HFQ5      ------------------------------------------------------------
A0A7W1FMQ9      ------------------------------------------------------------
A0A7W1NA62      ------------------------------------------------------------
A0A7V9JTP9      ------------------------------------------------------------
A0A7W1FJ38      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7V2H881      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A7X7U4K9      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A838QZ11      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      SELV--------------------------------------------------------
A0A3D4PJK1      SELV--------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      AQAE--------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A7V2UF66      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      KNRK--------------------------------------------------------
A0A7C2FXP7      N-----------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A2E3GWC6      NGQV--------------------------------------------------------
F0SLB0          NGQV--------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A7X8IIB9      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      E-----------------------------------------------------------
A0A2E2CCW9      ET----------------------------------------------------------
A0A3C0AGX3      ET----------------------------------------------------------
A0A518AAQ5      KM----------------------------------------------------------
A0A517QBG9      KM----------------------------------------------------------
A0A518FTU3      KM----------------------------------------------------------
A0A517WHH5      KM----------------------------------------------------------
A0A5A8BGT3      KM----------------------------------------------------------
A0A2E7K7A9      KV----------------------------------------------------------
A0A517PTS5      KV----------------------------------------------------------
A0A6I6AH34      KV----------------------------------------------------------
A0A517VTK3      NV----------------------------------------------------------
A0A517WQT4      NV----------------------------------------------------------
A0A517VID8      KT----------------------------------------------------------
A0A517RK10      KV----------------------------------------------------------
A0A518IH18      KV----------------------------------------------------------
A0A7W0M4Y4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A5C5XLF4      PELV--------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      E-----------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
A0A7W5H7D9      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7V4M591      ------------------------------------------------------------
A0A7X7F3G7      ------------------------------------------------------------
A0A7Y4VQ32      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          GNRL--------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A7C4Z5R7      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A7V3TZQ6      ------------------------------------------------------------
A0A3M1QRP3      DEFA--------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A518BBX8      LSKS--------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A847YFA1      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A7Y5SKC2      ------------------------------------------------------------
A0A7X7U104      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      ---G--------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7V2UW16      ------------------------------------------------------------
A0A518DRX3      ------------------------------------------------------------
A0A518DZF9      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A7V2XSV8      ------------------------------------------------------------
A0A847GXG1      ------------------------------------------------------------
A0A7C5BZF0      ------------------------------------------------------------
A0A847YGH5      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A7V3TX18      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
A0A4P5YBU2      ------------------------------------------------------------
A0A7C7V5U8      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      --RQ--------------------------------------------------------
A0A7Y5SJZ4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A7C2KUQ9      DATT--------------------------------------------------------
A0A7C5R0U3      ------------------------------------------------------------
A0A847YCQ7      KGRT--------------------------------------------------------
A0A286RD13      KGRA--------------------------------------------------------
A0A7V3TUJ6      KGRA--------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      -------------YAKRIIMQ-----EEEKYENFKSRRAYY------------QKKLKEL
A0A533Q9U4      -------------EVEQICDS-----IATEYEVAINRETTL------------VTILEQQ
A0A533Q6B7      -------------EVERLCNH-----ITIEYEIAKSNEATL------------LSLFEQQ
A0A1U9NNE1      --------------------------LKAELAKVRENERRI------------REKLEGT
A0A2G2JCA2      -------------IGKEDLEARYLASKEEELSHVEIRLNGL-----NISVTKIQEMLDKE
A0A1G2XVR0      -------------ETLSLITK-----VETDYNVLLASEESY------------EKAYNEQ
A0A1G3B0P0      -------------ETLSLITK-----VETDYNVLLASEESY------------EKAYNEQ
A0A1E3X4X0      -------------EVKKIISS-----IETKYKVARAKEDSI------------RESLEKQ
A0A286U4B3      -------------EQGWLGKA-----IKAEYQEAVGKEKGL------------RQHLEEL
A0A5C6DDS2      -------------EQGWVAKA-----IKAEYQEAVGKERGL------------RQRLEEL
A0A5S9IJB5      -------------EVLGIMQS-----LKDQYYRYKKEEDRL------------KKLVVAQ
A0A2E3GW02      ------------SARPDLLTLYMQS-LQEELRTNQEKLKEL------------DNLFLSE
A0A5B9QNZ7      ------------IRSGTLVKAYAKV-IDKDLEDIRKQIEFT------------QQQIKQD
A0A1Z8N7H5      ------------LESNQLGPLLLQM-AQQGLDKARQKESIL------------QASLDEA
A0A1U7CZ81      --------------------------LRARVELSRHQLDTL------------NQLVLSM
A0A142YNY8      --------------------------LRADVEALERERKAI------------TEALAQA
A0A1U7GLS6      --------------------------LKDEVSELESRQASL------------QKVLDEV
A0A1G2YPI3      --------------------------SKQESLAAKETEDQI------------AKYYEDQ
A0A532UIN2      ------------DLDAEFARAQLAV-AEQQYVSAKKKEGQI------------AKYHNEQ
A0A0S8KNX5      --------------------------KRSELEQTRQYEKGL------------RETLSKE
A0A3D3UVZ8      --------------------------KRSELEQTREYEKRL------------QETLSQQ
A0A517NFU9      ------------FDAAEMLSTYTSL-LSNDIAELEKRKEFL------------LQESTLE
A0A5C5YWH4      ------------LDPAEMLKTYTSL-LQNDISELEKRKEIL------------LADSEVE
A0A3D2TNK4      ------------AMGKSIPKEVVVNLLRQSTQQAIEKEKQI------------RQAYQQA
A0A7C1Y4F0      ------------EEAEDFAEAYVEV-MRLRWVTAKQREDDV------------RASFESQ
A0A6I0ENW6      ------------EEQAKLLRDMITT-LEKQITDIAGAASEL-------------------
A0A6L3A0B7      ------------EEQAKLLRDMITT-LEKQITDIAGAASEL-------------------
A0A0J1B4A0      ------------AKPADILASYYQV-LQSDISEMEKREEQL------------LELSEKE
A0A142WSB9      ------------KAGVDLPHVYLYI-LESQLEEFKIREDLL------------AARRTEA
M5SZR3          LAKIRADRIRKHEELSEMVEMGLTQ-LRQELDRTVRTQELL------------RGIYDTE
M5TW92          LAKIRADRIRKHEELSEMVEMGLTQ-LRQELDRTVRTQELL------------RGIYDTE
A0A2S8FKY2      ------------TIPE----------LKVRIGVLRQQQREL------------SKEVADL
A0A517N8P6      ------------EAAQALLTTYVSS-LRKKQDLINEDVADT------------TKRLEDV
A0A432MJP4      ------------VEVDDLILS-----IEQAVASVEALQQEY------------TDRFRED
M5UQ35          ------------VSTVDMLGHYFNV-LKSDVREYEARERDL------------GSLAEVE
A0A0S8FY64      -----------------------------------------------------AVLVARE
A0A1N6KFT7      ------------QLGGLGKDGLQSE-LHDRMASIEHSLKSIGSMREEYETKLKEDLVAAK
L0DFG4          ------------QLGGLGKDVLQSE-LRDRMTSIEHSLKSIGTMREEYEIKFKDDLVSAK
A0A5C5XXG1      ------------VNPESLLKAYVGF-LNHDMATIAERKSEL------------TALANQA
A0A7C7YUM8      ------------ESVGTLRERVRAS-LAAQVRGLSDHIVAV------------EHTITEH
A0A7C2AHI6      ------------AAVRLLEQRILGN-LESRLAGINDDIRSI------------DARIAGV
A0A518BJJ1      ------------AALEDLRERVERQ-LASRLDAVALENDEL------------GRYVAVL
A0A518D182      ------------AALAATRARIADH-LASRREALGRQYTEL------------DRVCADL
A0A7V4HWU2      ------------SGPDDFIKVYLES-LRQEVKLHEQRLEGL------------NTLFDTE
A0A5C5WTY6      ------------LDPEAMLKAYVGF-LRNDLASHLERKTEL------------QRLVELA
A0A5C5Y033      ------------IKPDALLRAYIGF-IEHDIAAIGERRKEL------------IALTTDA
A0A5C6G1Y2      ------------IKPDALLRAYIGF-IEHDIAAIGERRKEL------------IALTTDA
A0A354PDV6      ------------LSPEALLKAYVGF-LEHDLATLTQRKREL------------TILAGNA
A0A5C6FZ02      ------------VNPESLLKAYVGF-LNHDMATIAERKSEL------------TALANQA
M5TIT3          ------------LSPEGLLKAYVGF-LQHDLATLSERRKEL------------TFLAADA
A0A5M6CY44      ------------LTPEGLLNAYTGF-LQNDLAALAERRKEL------------GFLTADA
F2AXG2          ------------LTPEGLLKAYVGF-LQHDLAALSERRKEL------------EYLADEA
M2BB46          ------------LTPEGLLKAYVGF-LNHDLAALSERRKEL------------TYLADDA
L7CLQ6          ------------LTPEGLLKAYVGF-LNHDLAALSERRKEL------------TYLAADA
A0A0J1B719      ------------LTPEGLLKAYVGF-LQHDLAALSERRKEL------------TYLAADA
Q7UF18          ------------LTPEGLLKAYVGF-LNHDLAALSERRKEL------------TYLAADA
A0A2G1W1E0      ------------LTPEGLLKAYVGF-LNHDLAALSERRKEL------------TYLAADA
K5E235          ------------LTPEGLLKAYVGF-LNHDLAALSERRKEL------------TYLAADA
A0A5C6FFI9      ------------MNPRTMLTTFTRL-LKNDIAEYEMREAIL------------VETSSEE
A0A5C5WDJ1      ------------MDPAEMVMTYVML-LKNDISEFEMRKAVL------------LSESQKE
A0A5C5X547      ------------ENQDQLMAQFNEVDLRSRIKKIIEQEAEL------------EAMSSSL
A0A353FIP5      --------------------------VEARGVALKKQIVSL------------DRAISRW
A0A7V7MJI7      --------------------------VEARAASLKDKDSSL------------EDILSRW
A0A5B1CIK7      ------------LTATGLLKAYVGF-LNHDLATLGEQRKEL------------NFLAADA
A0A5C5WHS2      ------------LTPTGLLRAYVGF-LNHDMSALNEQRKEL------------TFLAADA
A0A5C6B6G8      ------------LTPESLLKAYIGF-VNHDIAALGERRKEL------------IFLSEDA
A0A5C5ZZN3      ------------LTPEGLLKAYVGF-LQHDLAALAERRKEL------------TFLASDA
A0A5C5XS91      ------------LNPEGLLKAYVGF-LNHDLATLTERRKEL------------TFLAADA
A0A5C6C4E6      ------------LSPEGLLKAYVGF-LNHDLATLTERRKEL------------TYLSADA
A0A2E1VVJ1      --------------------------LASRLEGLRSQESTL------------LTALDEY
A0A3M2AEL0      --------------------------VQDTLAALEAQQVSL------------QDTISRL
A0A2A2W9R6      ------------VPPAEILATYYTV-LKSDISEFAKRESEL------------LALSEQE
A0A518HKC1      ------------VPPAEILAAYYAV-LKSDINEFAKRETEL------------LALSEQE
A0A518L3P0      ------------VPPAEILATYYAV-LKSDINEFARRESEL------------LALSQQE
A0A255R1S0      ------------VPPSEILKTYYSV-LKGDIAGLKKREEEL------------VAQSEQE
A0A5B9MKP1      ------------VPPSEILGTYYAV-LKSDLNEFARREAEL------------LALSDQE
A0A351FYP6      -----------------RIKGILAG-LELRVNSSLAQVREL------------QKSVDDA
A0A0S8J591      -------------ENDRMRRAAQSD-AAQKLATAQANYEFL------------SDMLLTN
A0A532UT69      -------------------QTQLAV-AEQQYLNAREKENEI------------ARYYDEQ
A0A7V9G2R2      ---------------------------LADYDKIQAQLPTL------------AERVKKE
A0A2D5AWU0      ----------------------KID-AEIAYNEAKNRETSL------------DLDVTSL
L0DC26          -------------AGRESSGSKTTL-LQHRISILSKLEGAM------------EDDVKRL
M5RT57          -------------LAELDRRDTLHE-LEARLETQLVLENLL------------GLRYKEM
D5SZ21          ----------------------LQM-ARQRVQHSQQHEASV------------SAQFDIE
A0A7X7U1J4      ----------------------VAL-AEQEYRIAKGRVEEL------------EKQYEQQ
A0A7V8E5N8      ---------------------------QNDLKAAESEETAL------------GEEVKRL
A0A356KTN1      ---------------------------RSERDEKVAVEQGL------------LERDRNL
A0A7Y5LV28      ---------------------------QKDLTAVLTEEKAL------------SEEIRAT
A0A7Y5HFQ5      ---------------------------EATWETTKAETEEI------------LRLRDER
A0A7W1FMQ9      ---------------------------RARERDLVAQAATL------------ADEIISA
A0A7W1NA62      ---------------------------ETNERTIAAQAADL------------GKRIDGD
A0A7V9JTP9      ---------------------------QAEYQQLESQMQDL------------STRVAQQ
A0A7W1FJ38      ---------------------------ETSQQSLKLQYDEL------------MARTAEA
A0A1G2YQB7      -------------EFKESDLLEMQS-YNDKLNQLSKHEQQL------------RDMLKSE
A0A353P687      -------------EFKESDMLEIQE-YKYKLEQISLHQQQL------------RDMLVHE
A0A356EME5      -------------AISAKREADLAS-KKFEIESRRRMEEAL------------RERYEKE
A0A3L7P4E4      -------------DFL---QVYIES-LHQQKKAGEERLLQL------------NSLFEEE
A0A3L7PEB5      -------------DFL---EVYVES-LQQQKKAGEERLLHL------------NQLFEEE
A0A1U9NL64      -------------EFA---SAQLAV-ARERHMAAKKQLDEV------------STFFEEQ
A0A2N1UCJ3      -------------EFA---KNYIEL-LEIEYDAAKQKEAEL------------SASYEQY
A0A7V2H881      -------------SMV---QAILGD-VAMRLESIRKVIDQN------------KQYLQAE
A0A7C4EK84      -------------EFA---EAYRAA-VLHALQTARARQQQI------------QQAFEQQ
A0A7C3F0T2      -------------RLA---EAQLLA-ASRRLEALKEKEAQI------------RKSFESQ
A0A7X7U4K9      -------------EFV---AMQIAA-AEQRYWAAARKEGEI------------VQLYETQ
A0A2E0X4J3      -------------TMI---AAYVDS-VKSAYELLEHKYAEL------------QRSYDRQ
A0A838QZ11      -------------AVI---EAYVES-VRQAYELLDQKRTEL------------QAAYDRT
A0A5C5YU10      -------------AAL---RAYAFN-VKERFEFHTNKLNGL------------RSKYQDQ
A0A517MPZ6      -------------AIV---SAYVET-VSQEHQLLEQKREEL------------QRSYDKQ
A0A5C6CNV7      -------------AIV---SAYVET-MSQEYQLLEQKRAEL------------QRNYDSQ
A0A518K5H4      -------------ATL---NAYVDG-LRQNYELLAQRRDEL------------QKAYDKQ
A0A5C6AA28      -------------AIL---NAYVDG-LRQDYELLTQRRDEL------------QRAYDKQ
A0A2E7ESJ6      -------------SRQELFDY-----VTRYLASLKQKQIQL-----KGQYESLTGLFNQE
A0A2E9VK20      -------------TGNDPIATYVVA-LEQQQAELKNRIGEL------------QKLFDRS
A0A3D4PJK1      -------------TGNDPIATYVVA-LEQQQAELKNRIGEL------------QKLFDRS
A0A355AI52      -------------LANTVANI-----LNQRLESAERQEEWL------------QKSFERA
A0A354PCQ3      ------------FDRRLAEVQRQAE-AEQGEINRKLSRDQL-----VTKIAVLREQYDEE
A0A0S8GZ23      -------------FMEQKREADLTK-AKVQLANYQAMESEY------------SRRLVEE
A0A1I3DDV4      -------------TPELLLNAYTGF-LRHDLSALDQRKREL------------LTLAAEA
A0A7V2UF66      -------------AEKKAVEAELAA-ATERLRACEARETQI------------RKSYEEQ
A0A2E0SMM6      -------------QAERLLRI-----AEQKLSQLKGRYTAL------------KKSYDEE
A0A3L7SI46      -------------LGPKLLEM-----VKQRLYQAGAHEQAI------------REDFEII
A0A5B9PJZ8      -------------GKPDMVADFVER-VAGQIAMISAQEKSL------------EESILDE
A0A2S8G191      -------------WQAANFKASVDK-ARSEVVLLEQMEKQL------------VDSVTTF
A0A2E7EGG1      -------------MSGLQRQQELAM-LKTQLETQKLIVQSM------------RSNYDAM
A0A2E2N5A9      --------------------------IQRNYQLAVANEQSQ------------QALFDSN
A0A7C8AGA2      ------------RRVAE---------LKIQLEQTVQYEKRI------------REKLAKQ
A0A7C2FXP7      -------------SGKKELAA-----ARIQLQQTAAHEKRF------------DEILSKE
A0A1P8WP26      -------------LGPKLIEK-----TEQRLRMARQQVAQI------------GQDIRAE
A0A3L7V1F3      -------------LAPRMIQY-----LRQQMESNQQNEDAI------------RAQLDTE
A0A2E3GWC6      ------------EPGSDMISTYMTA-LTQQQAEMKNRLDEL------------QKLYDES
F0SLB0          ------------EPGSDMISTYMTA-LTQQQAEMKNRLDEL------------QKLYDQS
A0A3L7NDH9      -------------FAQMISQI-----LDQKVSAAVQHETWL------------TQSFEQA
A0A7X8IIB9      --------------AKRVREEELEA-LRGELNRLITYENKI------------AAQLAEQ
A0A532UD06      -------------FADAYIEV-----MQLRWLAAKQREDEL------------MTSFESQ
A0A660URN1      -------------FADAYLEV-----MRLRWTTAGQREDEL------------LASFDAE
A0A517ZCB5      -------------LGPRLLQM-----ARHRYLMAANQEQQL------------LAEFERE
A0A225EH48      -------------VEADIRAA-----LKREIKSDIEREKQF-----VTYKTTLTKKLGEE
A0A518INW8      -------------SPTEILDAFSTL-LKNDVKELTKQLAQL------------TEEAKAV
A0A518JPH9      -------------TPSQILTAFSTL-LNNDIKDLSKRQQHL------------MEEAATV
A0A5C5VEK8      -------------SKEMALKAYAFD-IKERYEFQTNKLNEL------------RSRYQEQ
A0A532UTJ0      -------------AGHKELVA-----ARSKLDETTVIEESL------------RQAISEE
A0A2E2CCW9      -------------KDVDFVNVYLKS-MEQQLKELENRELEL------------TKLFTQE
A0A3C0AGX3      -------------KDVDFVNVYLKS-MEQQLKELENRELEL------------TKLFTQE
A0A518AAQ5      -------------KDVDFVNIYLKS-MEQQLKELENRETEL------------TRLFNQE
A0A517QBG9      -------------KDVDFVNIYLKS-MEQQLKELENRETEL------------TRLFNQE
A0A518FTU3      -------------KDVDFVNIYLKS-MEQQLKELENRETEL------------TRLFNQE
A0A517WHH5      -------------KDVDFVNIYLKS-MEQQLKELENRETEL------------TRLFDQE
A0A5A8BGT3      -------------KDVDFVNIYLKS-MEQQLKELENRETEL------------TRLFDQE
A0A2E7K7A9      -------------KDVDFVNIYLKS-MEQQLKELENRETAL------------TRLFDQE
A0A517PTS5      -------------KDVDFVNIYLKS-MEQQLKELENRETAL------------TRLFDQE
A0A6I6AH34      -------------KDVDFVNIYLKS-MEQQLKELENRETAL------------ARLFDQE
A0A517VTK3      -------------KEADFVNIYLKS-MEQQLKELHNREQEL------------TKLFDEE
A0A517WQT4      -------------KEADFVNIYLKS-MEQQLKELHNREQEL------------TKLFDEE
A0A517VID8      -------------KDVDFVNVYLKS-MEQQFKELENRELEL------------TKIFDQE
A0A517RK10      -------------KDVDFVNVYLKS-MEQQLKELNNRETEL------------TKLFDQE
A0A518IH18      -------------KDVDFVNVYLKS-MEQQLKELNNRETEL------------TKLFEQE
A0A7W0M4Y4      -------------QPKDLLDVYMDS-MRYEIETTRVQLEKL------------NEIFDDE
A0A2D5NDU9      -------------YAATLLAA-----LDRRVASIQAERQVL------------LPLLADA
A0A5C5XLF4      -------------TGNDPIATYVVA-LEQQQAELKNRIGEL------------QKLFDRS
A0A518CHE5      -------------QAQRLLEI-----AEQKLVQYEERYRAL------------KESYLSE
A0A1V5N3W2      -------------NSQLQLDK-----AKAELEQIIVQENIL------------RDTLTKE
A0A517NSK8      -------------MLQTYVGL-----LENDLAGLQREREVL------------VRRSEAE
A0A5C5Z0D6      -------------MLQTYVGL-----LKNDLSGIQKRREVL------------IRRSGAE
A0A7W5H7D9      -------------MLQTYVGL-----LRNDLAGLVQQREVL------------QRRSDVE
M5UE94          -------------MLQTYVGL-----LKNDVMGLQRQRQVL------------QTRSEQE
A0A3E0MY27      -------------PEVAQLNL-----LQNSLTATQEHLAKL------------QEQSKTL
A0A7V4M591      -------------LGPWLLEV-----VRQRLEEIREKEAQL------------QACYDEA
A0A7X7F3G7      -------------LGPLLVEM-----VRQQLQEAVEQEQSL------------RVQFQAA
A0A7Y4VQ32      -------------ASSEIRVYDKPS-LTRAIAEADFRRGQL------------GTAMEGQ
A0A2E0X9P6      --------------------------KKQELQSLATRRVKL------------AERLEEQ
A0A1N6DAJ8      -------------MGRDDDDSSEAL-LPHRISILAKLETLL------------ASDVKRL
A0A2E8FLY0      -------------LTPSLIDM-----ARQRLSYAQSRETAL------------RQDFERE
A0A3D2U1E1      -------------LTPTLIDM-----SAQKLRYAELREQAL------------RDDFNRE
E8R3W3          ------------SSSPRSATPNDLF-ANATLEQIERSLRED-----YEWAELLQQDLQQQ
A0A5C5ZM48      -------------MKPSGPSEESEA-IDLRLAALDLQEDYL------------RKSLEAE
A0A5B9WF77      -------------ASNGERGESIPE-LMQQIAVLKTKKDKL------------TELYKKF
A0A7C4Z5R7      -------------MQEKALEE-----TQGKLREAEQFLALQ-----EESEKLQREDVQER
A0A1P8WN28      -------------VGQWLIKQ-----IEAEVQATRQYEQSL------------KHEYSVV
A0A3B9CTT0      -------------AGQWLMDS-----LQAELNSIQQFESSL------------QEEYNEV
A0A518ALT3      -------------LAQQQLERNKQE-SEQAILSKQQEITTL-----AKKLELLEIRRQEH
A0A286RGB6      --------------------------LNFELSILAQQQDQL------------QKEVENV
A0A7V3TZQ6      --------------------------LNFELSILAQQQDQL------------QKEVENV
A0A3M1QRP3      ------------GMSPRELRWELED-LRAELTNLEAHIARK------------QKEFTST
A0A517TMV0      -------------LGPMLMGM-----LDQAWRQAVQREQQI------------TESFAAA
A0A3E0MY88      -------------FGPTLTHM-----MEQALASAWHRENQL------------RAAFAEA
A0A518BBX8      ------------GSAAEAVEMHLDY-LNQKLDYLKVAEDRL------------DELYKEE
A0A5B9QF68      -------------LGPVVKRM-----LEQSVQQAWQKEQQM------------SASFEEA
A0A5B9QGF0      -------------LGPVVKRM-----LEQSVEQTWQKEQQM------------SASFEEA
A0A5C6CK24      -------------IGPVVKRM-----LEQSVQQTWQKEQQM------------SDSFEEA
A0A7C5FXU1      -------------LRRRRRKA-----LDDELAEHKFRMSVL-----LQQQQELEKEVEAA
A0A847YFA1      -------------LEKKRLAT-----LDEELESLKFELAIL-----EQQQSQLQQQVEEV
A0A1C3E6N1      -------------LTPRLLQM-----ARQRVQHSQQHEASV------------SAQFDIE
A0A518GJT2      -------------LTPRLLQM-----ARQRVQHSQQHEASV------------STQFDIE
A0A2E8B0L9      -------------MAPMLLGM-----VEERLSKTWELEADL------------EREYVAA
A0A5Q4GFE7      -------------LGPMLLAR-----VEEQLSNLREHEERL------------DLQYEQA
A0A257WS34      -------------LAPRLLQM-----AQQRLLQAQARENSL------------RLQFDQA
A0A7C4LP10      -------------LGPRLLKM-----AAQRYQQAAAQEEAL------------RQQFDQA
A0A2E3RCU8      -------------LGPVLLRM-----AQQGLNKAKQKESIL------------HASLEEA
A0A517MLW3      -------------FAALLGDL-----VQQKLNESTQHEALL------------RKEYDTL
A0A5B9QVD0      -------------FARLLGDL-----VVQKLDEAKQHEALL------------AAEYEAL
A0A3A0DET7      -------------VIEAYVES-----VRQQYELLDQKRSEL------------QAAYDAS
A0A3B8PNV4      -------------LTPSLIDM-----SRQRLRYAESREVAL------------RQDFERE
A0A3D1DR40      -------------LTPSLIDM-----SRQRLRYAESREVAL------------RQDFERE
A0A2E7RYU8      -------------LTPSLIDM-----SRQRLRYAESREAAL------------RQDFERE
A0A3B8LXG8      -------------LTPSLIDM-----SRQRLRYAESRETAL------------RQDFERE
A0A6M5Z0K7      -------------VGENLKQL-----VADCEAERNALEQRL-----RDC----QDYANGL
A0A350CI62      -------------LAPRLVQY-----LSQQILKLELNEKAV------------GERLAAE
A0A4P5WQK6      -------------LAPRLVQY-----LSQQILKLELNEKAV------------GERLAAE
A0A3C1X4W5      -------------LAPRLVQY-----LNQQILKLELNEKAV------------SERLAAE
A0A3D3W3A7      -------------LAPRLVQY-----LNQQILKLELNEKAV------------SERLAAE
A0A7Y5SKC2      -------------LGPMLIDL-----VQQKTTQAWQLESSL------------GAQFNQA
A0A7X7U104      -------------FARSHLAV-----AQQEYQAALAREEEL------------AKSVEEK
F0SI78          -------------LLTLYMQS-----LQEELRTNQEKLKEL------------DNLFLSE
A0A517MDV3      ------------TLVNAYAKV-----IEKDLEDVTQRIVFV------------KEEIAKE
A0A518IQ30      -------------LGEMLLSM-----IREALAETQANEQQL------------EHEYALA
A0A517LWP4      -------------LGEMLLSM-----ISEALTETQANEEQL------------EREYAIA
A0A518JNW8      -------------LGEMLLSM-----IGEALAETQANEEQL------------EREYAIA
A0A2E3GWX1      -------------LGPRLLQM-----AKQRYQHAMLNEQEI------------TTRFNHE
F0SG60          -------------LGPRLLQM-----AKQRYQHAMLNEQEI------------TTRFNHE
A0A2E9VST2      -------------MGPQMLEM-----AKQRYQHAVTLEQDI------------YQRFMQE
A0A356A6X2      -------------MGPQMLEM-----AKQRYQHAVTHEQDI------------YQRFMQE
A0A5C5XLM3      -------------MGPQMLEM-----AKQRYQHAVTHEQDI------------YQRFMQE
A0A7V2UW16      ---------------------------RGTFEEAKGRELKA------------AAALEAA
A0A518DRX3      -------------LAPLLTSL-----IAQRLAETRANEKQL------------LVEYQSS
A0A518DZF9      -------------LAPLLTSL-----IAQRLAETRANEKQL------------LVEYQSS
A0A2E7ENQ5      -------------LGEMLLSS-----IQGKLNTAIVHEQNL------------EREFQIA
A0A7V2XSV8      ---------------------------RAAYEEARTREAKS------------KETLEAA
A0A847GXG1      -------------LGPMLIAM-----VEERLGSLWEHENKL------------GRQYSQA
A0A7C5BZF0      -------------LASTLSDI-----LMQKVNEARSLELSL------------SQQYEEA
A0A847YGH5      -------------LGPTLQAL-----MQQRLAECVEKENSL------------SRQYEIA
A0A286RLF2      -------------LSQMLLGT-----LRQRVNELWQKEMSL------------QAQYELA
A0A7V3TX18      -------------LSQMLLGT-----LRQRVNELWQKEMSL------------QAQYELA
A0A1G3AQE9      -------------LGPMLIGL-----VHHKLAEAQWLEATL------------QEDFQQA
A0A3L7UQT9      -------------LGPQLLGM-----ARQRYQLAMSRQHTL------------QQQFDRE
A0A4P5YBU2      -------------LGPQLLGM-----ARQRYQLAMSRQHTL------------QQQFDRE
A0A7C7V5U8      -------------LGPLLVDM-----LQKKLELTRRRESLL------------RRQCEDA
A0A3M1VCL4      -------------IKPRLRQM-----AIRRLMVALEEERSL------------VEQFEQL
A0A518AKT8      -------------LGPMMQEL-----LRQSIAQTLEQEKQK------------EAAFVAA
A0A5C5ZR72      ------------KSGKTLADT-----KREELEMLSALEASV------------REKYEAE
A0A7Y5SJZ4      -------------LAPLLLTI-----ARQRCQQAVEQEASV------------LRSYEEE
A0A5C5V7Z9      -------------LGPMIKRT-----LEQSVAQAIERERVL------------SSSFDEA
A0A5C5YT05      -------------LGPMIKRT-----LEQSVAQAMEQERIL------------AESFEDA
A0A518D7F9      -------------LGPLLISM-----LQQSAQQLARLETQL------------TDSFEAA
A0A5C5ZIP0      -------------LGSMLSTM-----LNQALAQAGERERQL------------DHSFELA
A0A518KBK3      -------------LGPFLVGM-----LNQAMSQSVERERQL------------EEAFQVA
A0A5C6AKF9      -------------LGPLLIGM-----LNQALAQSNERERQL------------AEAFEVA
A0A7C2KUQ9      -----------------AGAA-----LGGEVRQLEHRLKLL-----KYQESLKVADLEKE
A0A7C5R0U3      --------------GPLLRSL-----VQERLTAAQVRESKL------------MESYQVA
A0A847YCQ7      ------------GLPPTEAER-----LQNEIAAAELEKAVL-----EDELKLALEQFEKE
A0A286RD13      ------------VAPPTETEQ-----IQAEIAQAELEKAVL-----EDELKVALEQFEKE
A0A7V3TUJ6      ------------VARPTETEQ-----IQAEIAQAELEKAVL-----EDELKVALEQFEKE
A0A517TY85      -----------------QEGE-----QRKLLAAKEQELAAW-----IMKRKLLSEKLAAH
A0A5B9QEI7      -----------------RKAE-----QEALVGAKQQELGLL-----SKKREMLSAKLAEQ
                                                                            

A0A5S9IPR9      ---EEQNLAFHQK-ILMYEDINAEV----------AALRDRYNDY-REKMKEYDS-QRSY
A0A533Q9U4      ---KNEVFALGDK-AIQYGVLKREA----------DTNRQMYETL-LTRMKETNL-TEDL
A0A533Q6B7      ---KNEVFTQGDR-SIQYGVLKREA----------DTNRQMYETL-LTRIKETNL-AEDF
A0A1U9NNE1      ---NAELITLGKR-HLAIKDHQEQL----------ELTKELYDAI-NRKIQKIEMESQRP
A0A2G2JCA2      ---MKLAKKTSGD-TFELEIKQREL----------EELSDIHRMI-ESRILKIRT-EQRA
A0A1G2XVR0      ---SLVVFDLNRK-ITVYRRLQREA----------DSERAFYDIL-LKRMKESNI-AGDL
A0A1G3B0P0      ---SLVVFDLNRK-ITVYRRLQREA----------DSERAFYDIL-LKRMKESNI-AGDL
A0A1E3X4X0      ---KEEALRLNKK-AIKYGILKREA----------DTNKDLYEIL-LTRLKEASM-TGAL
A0A286U4B3      ---KRENNRLEGK-SISYKVLKREV----------DANTQLYEGL-LQRMKQATV-SSQI
A0A5C6DDS2      ---KRENNELEGK-SIGYKVLKREV----------DANTLLYEGL-LQRMKEAAV-SSEI
A0A5S9IJB5      ---QREALIFSQK-VTQYQLLKKKY----------NALEETYLSV-KQRLGQLEL-DKDS
A0A2E3GW02      ---RTHSSNLTMD-ENRGRVLREDL----------NRTKKLYDVV-LEKLQEISL-VDET
A0A5B9QNZ7      ---EQESVDLVDD-ELRDQQIRDEL----------YATKQLQLAV-IDRLRQLNV-MQSY
A0A1Z8N7H5      ---RFXAVAHQRD-TSHITMLAQNV----------SRLRRLHDAI-IDQIAGVDL-RQGH
A0A1U7CZ81      ---EIERKATQSD-TYAAERLKADI----------ETLVEQYKHI-SEKFENLKF-AGTT
A0A142YNY8      ---ELETKESNSE-TYTARYLQAEI----------DSMTHDQQIV-HRRLEDLKF-RTDR
A0A1U7GLS6      ---KLESKESNSA-TYQAQFLQNEI----------RVMVDDERVV-NRKLQELEF-STNK
A0A1G2YPI3      ---RKQAVALNQQ-INKYTLLQSDW----------EQTKKDCDIL-NDRMKELSV-TEDV
A0A532UIN2      ---RKQALDLNEQ-LAQYTILQSDW----------EQTRRLCDIL-DERIKELNV-TEDV
A0A0S8KNX5      ---DTETIDLGRT-QLTIQELQDGL----------LLAKEMYDTV-QRRIQDLEMQRKRP
A0A3D3UVZ8      ---DTQTIGIGRK-QLTIQELQEGL----------ESTKEAYQIV-LKRIQDLELQRKRP
A0A517NFU9      ---MRLAKEVESD-FMKGSSMKSKL----------TRAQSRYDEV-ILRLQELKL-SRSY
A0A5C5YWH4      ---MRMAKQVEGD-FMKGASLRARH----------SRAQMRYDEV-IRRLQELNL-SRSY
A0A3D2TNK4      ---RAEAAAYSGS-LVQFRALERAV----------ARDEAKSDIL-TDKIANIDF-RQNQ
A0A7C1Y4F0      ---YNDAKGFGVL-AARYSLLQSEL----------SRAERICEIV-DNRIKELNVTAQDV
A0A6I0ENW6      ------------------KMQDHEI----------EHITLKYEAV-QKRVEEIQS-ELIS
A0A6L3A0B7      ------------------KMQDHEI----------EHITLKYEAV-QKRVEEIQS-ELIS
A0A0J1B4A0      ---SKLAKEVETT-FLLGSSLKANL----------DRAQARYDEV-FQRLHEINL-TNDY
A0A142WSB9      ---EGTAKESSLF-DAADQKRKDEI----------AAKQKELESV-RMQIADYNQ-SRSQ
M5SZR3          ---YVSAKELTDY-EIAEEEFQSNM----------EHTRQLYDGV-VAQLQAASL-SRDY
M5TW92          ---YVSAKELTDF-EIAEEEFQSNM----------EHTRQLYDGV-VAQLQAASL-SRDY
A0A2S8FKY2      ---EKEVRTFGRS-SVEVEMKRSEI----------ASLDEILQQL-NTEIERTNI-ELR-
A0A517N8P6      ---RAKALKLMEF-EGENASFLRRI----------ARYQETLDLY-DTQLEKANL-PGMN
A0A432MJP4      ---LEQARQILND-QAEEENIRAQL----------DRQQRLFNTV-VDQLKQAQL-VGEY
M5UQ35          ---AKAAKEVQMA-FMEGNSLKANL----------DRAQARYDEV-FQRLQEINL-TNDY
A0A0S8FY64      ---QELVRVLLEE-TRVALEQARKVHVYSRLERDAERQARVFDVI-VDRMREVDL-TKDV
A0A1N6KFT7      ---QSELGLLEEE-RLH-----GNL----------DRQKALYNTV-LDQLKQAQL-VSDY
L0DFG4          ---QSELERLEEE-RLH-----GNL----------ERQKALYNTV-LDQLKQAQL-VSDY
A0A5C5XXG1      ---ETDARELIEY-ELTDVVLRKEV----------ERNEALFDGV-VQQLRDVDI-ASGL
A0A7C7YUM8      ---DQRLGRLPQS-QLALAQAIRAQ----------ETHSEIVAFL-LKSEQEAQI-TAAA
A0A7C2AHI6      ---QAELAQLPEE-QRRLADPLRRV----------AAYGEIVRFL-LKSQQEAQL-SEAA
A0A518BJJ1      ---EERLGNLPEQ-QRRLASPMRRL----------ETHKQIAAFL-LTSLQEAEI-TRAS
A0A518D182      ---EAQLGALPEK-ERLLAAPLRRL----------ETHKELTALL-LKSLQEAQI-ARAS
A0A7V4HWU2      ---RNSAKALAAY-QVQDETFRNEI----------SRTQQLFGVV-VKRLDEINL-IKDY
A0A5C5WTY6      ---EEQAREFVAF-ERSDRLLQNEI----------DRQRALFDGV-MERVVNMNS-AGDT
A0A5C5Y033      ---ESKAKELIEF-ELKDLVLQKKI----------ARHEAIFDGI-VGQLQELNT-ASGL
A0A5C6G1Y2      ---ESKAKELIEY-ELKDLVLQKKI----------ARHEAIFDGI-VGQLQELNT-ASGL
A0A354PDV6      ---ESQAKTLIDY-ELQDMVLRKKI----------ERQEKLFDGV-VQQLRELDT-ASGL
A0A5C6FZ02      ---ETDARELIEY-ELTDVVLRKEV----------ERNEALFDGV-VQQLRDVDI-ASGL
M5TIT3          ---ETKAKELIEY-ELTEMVLQKKI----------LRQEALFDGV-IQQLRDLDT-ASGL
A0A5M6CY44      ---EKKAKELIEY-ELRDLVLQKNI----------ERQEALFDGI-VTQLRELDT-ASSL
F2AXG2          ---GKEAQTLITY-ELNDMMLRKAI----------ARQEALFDGV-VKQLHDLDT-TSEL
M2BB46          ---GTKAKELIEY-ELRDMMLRKAI----------ERQEALFDGV-VQQLQNLDT-TSEL
L7CLQ6          ---ESKAKELIEY-ELNDMILQKKI----------AREEALFDGV-VQQLRELDT-AKGL
A0A0J1B719      ---ETKAKELIEY-ELTDMILQKKI----------GRQEALFEGV-VQQLRALDT-ASGL
Q7UF18          ---ETKAKELIEY-ELTDMILQKKI----------GRQEDLFEGV-VQQLRELDT-ASGL
A0A2G1W1E0      ---ETKAKELIEY-ELTDMILQKKI----------GRQEDLFEGV-VQQLRELDT-ASGL
K5E235          ---ETKAKELIEY-ELTDMILQKKI----------GRQEDLFEGV-VQQLRELDT-ASGL
A0A5C6FFI9      ---LQLAKDVENA-FLEGNAKKAKV----------TRAQIRYDEV-IRRLQELNL-AGSY
A0A5C5WDJ1      ---MLLAKEVEAD-FMKAGALRAIR----------SRAQSRYDQV-IERLQELEL-SRSY
A0A5C5X547      ---RDNFKLLGKT-SADVEMLRGDI----------ASLEQVVSNL-AAELERTRV-ESKG
A0A353FIP5      ---QGQLDALPAV-ERKLAKFQRKA----------NAYEQIYTYL-LGKEQEARI-AAGA
A0A7V7MJI7      ---QKELDTLPAT-ERELAKFQRRA----------TSVEQIYIYL-LGEEQQARI-AVNA
A0A5B1CIK7      ---ETKAKDLIEY-ELNDMVLRKKI----------ERQEALFDGV-VQQLRDLDT-ASGL
A0A5C5WHS2      ---EEKAKALIEY-ELKDLVLQKKI----------SRQEALFDGV-VQQLRDLDT-ASGL
A0A5C6B6G8      ---ETKAKELIDY-ELQDMVMLKKI----------DRQEALFEGV-VSQLRDLDT-ASGL
A0A5C5ZZN3      ---ETKAKDLIEY-ELTDMILQKKI----------ARQEALFDGI-VQQLRELDT-ASGL
A0A5C5XS91      ---ERKAKELIEY-ELTDMVLQKKI----------TRQEALFEGI-VQQLRDLDT-ASGL
A0A5C6C4E6      ---ERKAKELIEF-ELTDMVLQKKI----------TRQEALFDSI-VQQLRDLDT-ASGL
A0A2E1VVJ1      ---DVRLDGLPRA-QRELIRLQREA----------SSHEAVYLIL-MQRLQEAKI-AQAA
A0A3M2AEL0      ---RENLEELPAT-ERQLARFSRRA----------AAFEQIYTLL-LTRLQEAQI-TEAA
A0A2A2W9R6      ---SKLAKEVELS-FLKGTAFKANL----------DRAQARYDEV-FKRLQELNL-TNDY
A0A518HKC1      ---SKLAKEVELS-FLKGTALKANL----------DRAQARYDEV-FKRLQELNL-TNDY
A0A518L3P0      ---SKLAKEVELS-FLKGTALKANL----------DRAQARYDEV-FKRLQELNL-TNDY
A0A255R1S0      ---AKVAKEVELS-MLEGTSLKANL----------ERAQARYDEV-FKRLQELNL-TNDY
A0A5B9MKP1      ---TKLAKQVELD-FLKGASLKANL----------DRAQNRYDEV-FKRLQELNL-TNDY
A0A351FYP6      ---KAKEAKVQEE-GREYFDAKRKL----------SNTTRMRDTI-LFRIMQEEV-DLDL
A0A0S8J591      ---RQRLTQISRD-MLQLEGLRKQQ----------ENIEEMRAVL-DKAAETVKT-YRSY
A0A532UT69      ---RQQALSLNEQ-VAEYTMLQSDW----------EQTKKLCDIL-NERIKELDV-TEET
A0A7V9G2R2      ---ETELTTYRDN-VLKLQSLSDQT----------RVQQQMYEQL-LKRIGEERV-SKRL
A0A2D5AWU0      ---QEELGKTNRA-LQQIDNYESEF----------DSIRDFSEHL-KSRLNELDV-ENQT
L0DC26          ---NGRTRSITQN-SVDLFSIQEEI----------ANADEVARTI-GKEVEALTV-ELQ-
M5RT57          ---LGTAGESGNK-LLELEFARAEL----------EREERVFDLI-AERSMALTT-ESR-
D5SZ21          ---RQNALSLNGE-LAKLEILQMDT----------KRLRAFYDLV-LERIRGIDL-GKDK
A0A7X7U1J4      ---RREAVQLNNQ-IAQYTLLQSDY----------EQTKGLCDLL-DSTIQRLDV-TTEV
A0A7V8E5N8      ---EAQMAETGNS-LRRFRRLQEEL----------TANKELYASY-LKRQGETSA-TAGT
A0A356KTN1      ---REESRVFARR-SRLYESLKNEV----------DANRTFYEEF-ASRLKDLLH-AAPL
A0A7Y5LV28      ---ETLLAAAGTR-LTDYRRLEGEV----------TAAKELYASY-VKRHGESSA-TAGT
A0A7Y5HFQ5      ---RAEQQKLAGL-AVEWAGLEAER----------DRIRAELADL-GAQLSAVQG-ISGF
A0A7W1FMQ9      ---KSTLAAYRES-LLELRTMEQDR----------ATQEKISDQL-AARLGEETI-TTRL
A0A7W1NA62      ---QTGLGAYRES-LIDLAAMSEER----------STRQGLFESL-LQRLGEEEV-ASNL
A0A7V9JTP9      ---EIKLNAYRQD-LISLEALEQET----------HSREKLFEQL-LTRLGEEEV-SSRL
A0A7W1FJ38      ---QKELALYRGN-LASFQALEAET----------RSREVMFNRL-LTRMDEEEV-ASRL
A0A1G2YQB7      ---DSKTIELGRK-QLAMQDVKEQL----------DSSKQMLETI-QKRVGELEM-ERKR
A0A353P687      ---DSKTIELGRK-QLAMQDVKEQL----------DNSKDMYSTI-QKRIGELEM-ERKR
A0A356EME5      ---LKKVAPGVAD-MVSIEFEQAEL----------TRATDVLNLI-EQRVVELRT-ERQA
A0A3L7P4E4      ---QRIAKEQLDL-QIKDKRYRNDI----------ARSELTFNAI-VSQFKDADL-AVKA
A0A3L7PEB5      ---KRIAKEQLDL-QIQDKRYRNDI----------ARSELAFNTI-MTQLKDTDL-AIKG
A0A1U9NL64      ---RAAAMDLNDQ-LAQYTILESEY----------QQSKKLNDIL-DERIKELNI-TEDV
A0A2N1UCJ3      ---KQESQSLNIK-ATEYAIIETKL----------EQSKRFCEIL-DDRIKELNV-SEEA
A0A7V2H881      ---QAQVLKVNDK-QAQFDRIEADI----------RRLETYNNQL-GDQLKSIDL-AETA
A0A7C4EK84      ---QKEAMELNSK-AAVFATLEAEV----------RRIEKLCDIL-DTRIKELNL-TGNT
A0A7C3F0T2      ---RQEMVDLNAQ-VAQFTRLRSEW----------EQAKRACEAI-DDRIRQINV-NEDT
A0A7X7U4K9      ---RQQAAQLNEK-QADYEVLDSEI----------QELAEWLKNL-RADYRNATW-REDA
A0A2E0X4J3      ---FSEAKQVSAL-ALKLASLQEAI----------ERSESENELV-DEQIKEVNL-TEKV
A0A838QZ11      ---FESATEVSAQ-LTQLESLKESY----------ERTEKLCDIL-DERIKEVNL-SEEA
A0A5C5YU10      ---FEAAKESSAN-SLKLFSLEETY----------ARAISDSDEV-EERIKELDL-NKKV
A0A517MPZ6      ---FKLAMQVNSQ-AAKLTTLENSL----------ARTVRDVDRV-DEQIKGINL-TEDV
A0A5C6CNV7      ---FKLALQVNSQ-AAKLALLEESL----------ARTARLTDIL-DERIKEVNL-IEDV
A0A518K5H4      ---FALATEVSQQ-AAKLADLQEAY----------EQTSEYCDTL-NKQIREVNL-SENV
A0A5C6AA28      ---FALATAVSQQ-AAKLDALQEAH----------DRTARMCDIL-DERIKEVNL-SEEV
A0A2E7ESJ6      ---EDAAKELQIL-QAKDEQFQNEI----------ARTQQLFEVV-VKSLEEISL-VSDY
A0A2E9VK20      ---ADQAKDFAQY-EEREQTLSDEL----------KRIKSLHDIV-ANRVEVLSL-APDE
A0A3D4PJK1      ---ADQAKDFAQY-EEREQTLSDEL----------KRIKSLHDIV-ANRVEVLSL-APDE
A0A355AI52      ---KEESIGLTSD-ISQLDIVETDL----------NWLRQLRNTL-LNQIASVDI-RQEN
A0A354PCQ3      ---LTRMEQFGGT-SAELQFAQEEL----------AVSNSVLMKL-RDRVAAIRT-ERRQ
A0A0S8GZ23      ---LEQNKDMGNV-QFEIRTRQAEM----------ARDQSEYNLV-LERIDDIEI-KRQR
A0A1I3DDV4      ---EKNSKSLIEF-ELKDKMIQAEM----------TRKQTLYDSI-VEQLREMDT-AAGL
A0A7V2UF66      ---RQQAIGLNAQ-IARFTMLQSEL----------DQTKKLCDLL-DQRIKEMDI-SEEA
A0A2E0SMM6      ---EEAGRESTLV-MSMIKQKETDQ----------ERILHQHDTL-LQKIREVDL-DDRA
A0A3L7SI46      ---RSQALSLNGQ-MAQIDIMEMDL----------KRMRLYYDLI-LEQMKKIDI-GADS
A0A5B9PJZ8      ---QRKAAQTSVN-IERLLALQRER----------DRLELYSDNT-IDKLGEVEV-LKDF
A0A2S8G191      ---EKEAKQFGRS-SIDVEMMRTEI----------DSLEGILSRL-GHEIENTKI-ELKS
A0A2E7EGG1      ---VEDISQSGGQ-TLDLKFKQAEL----------NRKQQVFDSI-SERAAQIAT-EMYA
A0A2E2N5A9      ---KYQIQNLSSK-EFKVRELALEV----------EANRALYDTF-LVRLKETAA-TADQ
A0A7C8AGA2      ---DKDTIGLGRK-QFAIDDQKAQL----------ARSQEMYDAV-NKRIDEIQL-ERKR
A0A7C2FXP7      ---DTETIELGRK-QLAIQEMQEQL----------ALTKETYGAI-RRRIQELNM-EKKR
A0A1P8WP26      ---KTQAMELSMT-LREIQDINREI----------ERRHEYRASL-TDKMDLIDL-TGDT
A0A3L7V1F3      ---KNKAQRLGQI-LADLARNEREN----------LRLSERIQEY-QNQVDGIGI-NKDK
A0A2E3GWC6      ---TKQAKSFARF-ESQDQSYKEDL----------QRIRSLHDVV-TRRIEELSL-AHDE
F0SLB0          ---TKQAKSFARF-ESQDQSYKEDL----------QRIRSLHDVV-TRRIEELSL-AHDE
A0A3L7NDH9      ---KQDSIGLASE-MARLDIADHDL----------RWLRELRNTI-LNQIASVDL-RQEH
A0A7X8IIB9      ---DQSTIQIGRT-QLDINDLREQY----------ENSRNIYNEI-TRRIEELNI-ERDR
A0A532UD06      ---HQAARELSVK-AAQYAVLQSEL----------NRAERICEIL-DNRIKELNV-TEDT
A0A660URN1      ---RKAAQDLGVK-AAEYSVLQSEL----------KRTERLCDIL-DNRIKELNV-TEDV
A0A517ZCB5      ---RDNALQLNQQ-LAEIQIAELEI----------QRMRTYDDVL-LDAITNIDL-NKDN
A0A225EH48      IKRLEKELELARGANVQGIIDLGDL----------GPLKEQRAAMEKERLDLDLL-DRSD
A0A518INW8      ---RVAAKEVESE-YLEGTALKAKM----------TRAQQRYDVV-MERLQELEL-TSDY
A0A518JPH9      ---RVAAKAAESE-FLEGTALKAKM----------TRAQQRYDVI-MGRLQELEL-TSDY
A0A5C5VEK8      ---FEEAKESSAN-SLKLMSLQEAY----------ERAVSQADVV-EQRIKELDL-TT-Q
A0A532UTJ0      ---DTETITVGRK-QLTIQELQETL----------EFNKETYASV-VRRIQDLEL-QRDR
A0A2E2CCW9      ---SELAKKVGNF-QVIDQSYNEEI----------AQLKSQRDNI-FKQLLVERV-SQGN
A0A3C0AGX3      ---SELAKKVGNF-QVIDQSYNEEI----------AQLKSQRDNI-FKQLLVERV-SQGN
A0A518AAQ5      ---TELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESI-FKQLLLEKV-AKGN
A0A517QBG9      ---TELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESI-FKQLLLEKV-AKGN
A0A518FTU3      ---VELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESI-FKQLLLEKV-AKGN
A0A517WHH5      ---TELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESI-FKQLLLEKV-AKGN
A0A5A8BGT3      ---TELAKKVGNY-QVVDQAYNEEI----------AQLKSQRESI-FKQLLLEKV-AKGN
A0A2E7K7A9      ---TELAKKVGNY-QVVDQAYNEEI----------AQLKTQRESI-FKQLLLEKV-AQGN
A0A517PTS5      ---TELAKKVGNY-QVVDQAYNEEI----------AQLKTQRESI-FKQLLLEKV-AQGN
A0A6I6AH34      ---TDLAKKVGNY-QVVDQAYNEEI----------AQLKTQRESI-FKQLLLEKV-AQGN
A0A517VTK3      ---TELAKKIGNY-QVVDQAYNEEI----------AQLKSQRDNI-FKQLLVEKV-SQGN
A0A517WQT4      ---TELAKKIGNY-QVVDQAYNEEI----------AQLKSQRDNI-FKQLLVEKV-SQGN
A0A517VID8      ---TELAKKIGNF-QVVDQSYNEEI----------SQLKSQRDNI-FKQLLVERV-SQGN
A0A517RK10      ---TALAKNVGNF-QVVDQSYNEEI----------AQLKSQREDI-FKQLLLEKV-SQGD
A0A518IH18      ---TALAKKVGNF-QVVDQSYNEEI----------AQLKTQREEI-FKQLLVEKV-SQGD
A0A7W0M4Y4      ---NAAARQLDTV-LTRDRQLREEI----------KRKDSLLAAV-VKQLEQMTL-FSTN
A0A2D5NDU9      ---EREVLAVSEH-ELEYNQLNSRA----------ERTKQTLDNA-YAQLQRINI-DPDS
A0A5C5XLF4      ---ADQAKDFAQY-EEREQTLSDEL----------KRIKSLHDIV-ANRVEVLSL-ASDE
A0A518CHE5      ---EEKGRESTLV-MLKIKQLETHQ----------TRIMAQHDTL-LQKIREVDL-DDRA
A0A1V5N3W2      ---NADTIDLGRK-QLAIQEQQDQL----------ALNQELYETI-RRRIQELEV-ERKR
A0A517NSK8      ---LVSAKKLEEE-EMMAESLKLEL----------VRKQALYEKM-SDTLSELNF-VRDY
A0A5C5Z0D6      ---LILAKELEQV-EMQTETMRREV----------LRRQELFKDT-QDTLKELNF-VRDY
A0A7W5H7D9      ---LAKAKELEQV-EMQAESLRREM----------LRRQEVFEDT-QDTLKELNF-VRDY
M5UE94          ---LKLAKQLEQA-EVQAESMRRDL----------ERRQAIFDDT-QSTLKELNF-VRDY
A0A3E0MY27      ---QQRINELTVF-KPELERRKDEL----------ERLESVSNEL-GLRLQKLQL-ELSV
A0A7V4M591      ---RQQAVGLSGH-LLHIQGLEREE----------KRFSDEYDEL-FRKITELDL-RRDG
A0A7X7F3G7      ---QADASRRTGQ-IARLTMLQREV----------KRLYDLSDAL-VSQIASLDL-RQDG
A0A7Y4VQ32      ---KTQVDDVNQK-AQTVEQLNLEI----------TKLQTDLNEV-TARLNVLRL-EGTA
A0A2E0X9P6      ---LAELKSGGAQ-SAQLEFAKAEL----------AREEKVFELI-AARKLALQT-EL-D
A0A1N6DAJ8      ---SERSASITQN-SVDLFSVQEEI----------ANADEIARTI-GKEVEALTV-EL-Q
A0A2E8FLY0      ---NRIVSSYEFQ-MSRIKLLNFDL----------ARKRELAVAL-IDQINRTDL-GKER
A0A3D2U1E1      ---SQVVSSFEAL-MGRIRLLNFDL----------ARKRELAIAL-ATRISRTDL-GKER
E8R3W3          ---TRLLVTHNSN-SFKIEQIKEEL----------NTADRISELL-SNRIEEMRV-EL-D
A0A5C5ZM48      ---QRKRRDNAGG-LLEVEFMRAEL----------TLAEEMQQEV-ASRITRMQV-ES-Q
A0A5B9WF77      ---EVTQKDSHAD-TVQAAFLNTEL----------ANLTTAGQQI-ERRLLQLKF-TQDK
A0A7C4Z5R7      ---KAALARLHEKPSAEWESLRGEV----------ARAETSLQRV-GAEMQALKM-EP-P
A0A1P8WN28      ---EADALELSGK-LAGIQVAEREV----------ETLRELHSSL-LKRLNSINP-DHGS
A0A3B9CTT0      ---RAEALNISNK-LASIDFKEREI----------ESLTELRSSL-LNRLNSIKI-SENA
A0A518ALT3      ---VAELEKGGAR-SAELDIVKSEL----------EREQNVFELI-SARKLALET-ER-G
A0A286RGB6      ---RRSAETFGKG-SIEVEFLRAEV----------ELARKTLQTI-AEERNRLAI-EL-R
A0A7V3TZQ6      ---RRSAETFGKG-SIEVEFLRAEV----------ELARKTLQTI-AEERNRLAI-EL-R
A0A3M1QRP3      ---FESAGALSKA-LRELQTMREQY----------EQIRRTRQQQEIERFAPASI-RKIA
A0A517TMV0      ---RAEASKQSGD-LVRVEMLQREI----------NRIEEHNKLS-YEKMQSIDL-QQVS
A0A3E0MY88      ---KEDAVRLNRD-LHEIQFLEREI----------GQLSNLYGAL-ADRIASVDL-AKDQ
A0A518BBX8      ---YDEARKIAAY-DIKDEAFRKEI----------DQTQQLYDSI-ITRLQDAGL-VTQS
A0A5B9QF68      ---RQEAAKHSGD-LVQLRMLEREV----------TRLEAQYDLL-FEKISTVNM-RQMQ
A0A5B9QGF0      ---RKEAARHSGD-LVQLHMLEREV----------TRLEAQYDLL-FEKISTVDM-RQMQ
A0A5C6CK24      ---RQEAAKHSGD-LVQLRMLEREV----------TRLEAQYDLL-FEKISTVDM-RQMQ
A0A7C5FXU1      ---RREAEQFGVR-SLDVEMMRAEA----------RVLENLLQRI-GDERQKLAI-EL-R
A0A847YFA1      ---RKTAETFGKG-SIEVEFLRAEV----------DLARKTLATI-AEERNKLRI-EL-R
A0A1C3E6N1      ---RQNALSLNGE-LAKLEILQMDT----------KRLRAFYDLV-LERIRGIDL-GKDK
A0A518GJT2      ---RQNALALNGE-LAKLEILQMDT----------KRLRAFYDLV-LERIRGIDL-GKDK
A0A2E8B0L9      ---EASAIRLNDR-HAELSIVESQV----------QRLSNVHDML-LDRIANVDL-NSEG
A0A5Q4GFE7      ---ESEAVMLNDR-MAEMKMIEHDL----------ARMRNLHDTL-LNRIANIDI-GHSR
A0A257WS34      ---HAAALAMNSQ-LAELERIESDV----------KRMRTYYDHV-LDRIKDIDL-GA-D
A0A7C4LP10      ---HAQALALNST-LAELQRLENEV----------SRIRKYYDTI-LDQMKNVDF-GA-D
A0A2E3RCU8      ---RFKAVTHQRD-TAHITMLEQNV----------MRLRRLHDAI-IDQIASVDL-RHGE
A0A517MLW3      ---EKEVVAMNGS-LSEMLLSQREV----------DRLSRAYDAL-LEKIHGVDL-GQDQ
A0A5B9QVD0      ---EKEVVAMNGN-LSEMLLTQREV----------ERLNRSYDTL-LEKIHGVDL-GSDQ
A0A3A0DET7      ---FAAATQASSL-LVQLNSLQEAY----------ERTANMCDIL-DERIKEVNL-TEEF
A0A3B8PNV4      ---NRTVSSYEYQ-MSRIKLLNFDL----------ARKRELSVAL-IDQINRTDL-GKER
A0A3D1DR40      ---NRTVSSYEYQ-MSRIKLLNFDL----------ARKRELSVAL-IDQINRTDL-GKER
A0A2E7RYU8      ---NRTVSSYEYQ-MSRIKLLNFDL----------ARKRELSVAL-IDQINRTDL-GKER
A0A3B8LXG8      ---NRTVSSYEYQ-MSRIKLLNFDL----------ARKRELSVAL-IDQINRTDL-GKER
A0A6M5Z0K7      ---NAQITNLGID-AIEVENKRNRI----------ARAEQFLGMI-WEQKERLTL-EIQG
A0A350CI62      ---QAKAQKLSQT-LTELGDLDRQI----------EHLYDQQKSL-QSQSDGIGL-NK-D
A0A4P5WQK6      ---QAKAQKLSQT-LTELGDLDRQI----------EHLYEQQKSL-QSQSDGIGL-NK-D
A0A3C1X4W5      ---QSRAQKLSQT-LTELGDLDRQI----------EHLYEQQSSL-QSQSDGIGL-NK-D
A0A3D3W3A7      ---QSRAQKLSQT-LTELGDLDRQI----------EHLYEQQSSL-QSQSDGIGL-NK-D
A0A7Y5SKC2      ---QAEAVALNDR-LAQVQILEHDL----------NWLRELHDVM-LNRMAGLEL-KNEG
A0A7X7U104      ---RQQAIVLNNQ-VSQYTLLQSEY----------EQTRKMCDLL-DERIKELSV-IEET
F0SI78          ---RTHSSNLTMD-ENRGRVLREDL----------NRTKKLYDVV-LEKLQEISL-VDET
A0A517MDV3      ---ESDSVDLVDD-ELRDQEIRDEL----------FATKQLQLAV-IDRLRQLNV-MQGY
A0A518IQ30      ---EAEAVKLNGR-MTSLQLVENEL----------QRLRNWHDTL-LNQIANIDL-QTEG
A0A517LWP4      ---EAEAVKLNGR-MTSLQLVENEL----------QRLRNWHDTL-LNQIANIDL-QTEG
A0A518JNW8      ---EAEAVTLNGR-MTSLQLVENEL----------QRLRNWHDTL-LNQIANIDL-QTEG
A0A2E3GWX1      ---KTLAADMNQR-LVLLQMAERDL----------ARLQSDYDML-RERINALDL-NQ-Q
F0SG60          ---KTLAADMNQR-LVLLQMAERDL----------ARLQSDYDML-RERINALDL-NQ-Q
A0A2E9VST2      ---KQVASQMNQR-LMMLQLAERDL----------SRLQNDYDMM-RDRINTIDL-NK-Q
A0A356A6X2      ---KQLASQMNQR-LMLLQLAERDL----------SRLQSDYDMM-RDRINTIDL-NK-Q
A0A5C5XLM3      ---KQLASQMNQR-LMLLQLAERDL----------SRLQSDYDMM-RDRINTIDL-NK-Q
A0A7V2UW16      ---KAEKVQFDRD-RIELARLEREA----------EATRSLFQNI-LKRIQETSV-SSQL
A0A518DRX3      ---EAEAVSLNDR-VAALQLVDNEV----------QRLRRLHETL-LNQISKIDI-NQNQ
A0A518DZF9      ---EAEAVSLNDR-VAALQLVDNEV----------QRLRRLHETL-LNQISKIDI-NQNQ
A0A2E7ENQ5      ---QNQAVEVNGK-VARVAIIEHDL----------RMLRELHDTL-RNRIANLDI-RQDQ
A0A7V2XSV8      ---KEEKVQFDRD-LIELGKLQREA----------EATRSLFANI-LKRVQETSV-SAQF
A0A847GXG1      ---EEEAVQLNDR-MAELRMVEHDL----------TRLRNLHDAL-LTRINNIDI-GKDQ
A0A7C5BZF0      ---QSEAVALTGT-LARIDILAREV----------EWLRNLRQAL-LQRITDIDL-QQKG
A0A847YGH5      ---RAEAGQLAGG-LAQMEMLKNDI----------AGLRELYGGL-VKRLTNIEL----T
A0A286RLF2      ---RQEAANLAGG-LAQLEMLKNDI----------TGLRELYGGL-VRRITSLDL----A
A0A7V3TX18      ---RQEAANLAGG-LAQLEMLKNDI----------TGLRELYGGL-VRRITSLDL----A
A0A1G3AQE9      ---QNRAMEIDGQ-VARLDNLDREV----------ERLRRLHDVL-CDRINDLDL-SREG
A0A3L7UQT9      ---KSEVANHNTL-MANLIIVEMER----------NRLQANDESL-LKQIEKLQL-V-SG
A0A4P5YBU2      ---KSEVANHNTL-MANLIIVEMER----------NRLQANDESL-LKQIEKLQL-V-SG
A0A7C7V5U8      ---QRAATHLTSR-LEEIRNLQRQM----------DQLWAQQDWL-LQQIEDIRL-KREG
A0A3M1VCL4      ---KKQAIELNNR-HLQMEILSLEL----------NRLRSLNDLF-LERIKELDL-GSDS
A0A518AKT8      ---RTEAAKQSSQ-LVELRTCERDL----------VRLENLHDSL-IDRLDSADI-YQSQ
A0A5C5ZR72      ---LAKVQEGGGK-NVELEFAKSEL----------AREAKVFEMI-ASRKLALQ--TESK
A0A7Y5SJZ4      ---KGRAIALEQN-VAAVEIAEHDV----------QRLRNFYDVV-VERIKNVDL-SQDS
A0A5C5V7Z9      ---RIEAAKQSGE-LVELDMRSREV----------ERLESLHDVL-FEKIAAVDI-HQVQ
A0A5C5YT05      ---RVNAARQSGD-LVELDMRKREV----------ERLESLHDVL-FEKIAAVDI-HQVQ
A0A518D7F9      ---RAHALEQSSG-LIRLSMLERDV----------ARLEKLHDVL-FEKLETVDT-HQLQ
A0A5C5ZIP0      ---RDEAARQSGD-FVKLEMLSREV----------ERLEKLHDLL-FNKIATVDI-RQVQ
A0A518KBK3      ---RADAARQSGD-LVKVDMLDREV----------ERLEKLHDLL-FEKIATVDI-HQVQ
A0A5C6AKF9      ---RSEASRQSGD-LVKLEMLNRDV----------ARLEKQYDAV-CDKISAIDM-TQVQ
A0A7C2KUQ9      ---QELHRGTLTS-SQALEREMAEV----------SRKQGLYESA-VQRLSELD--IEGR
A0A7C5R0U3      ---EREAAALQDR-WSEFQLVQHDL----------ELLRKLHDTL-VNRLAQLDL-TREQ
A0A847YCQ7      ---AADAERFGRY-SADLEAERAEL----------ERLKAIADRT-GDELERWN--VELE
A0A286RD13      ---AAEAEQLGKY-SADLEAERAEV----------ERLKAIAARM-GDELERWN--IELA
A0A7V3TUJ6      ---AAEAEQLGKY-SADLEAERAEV----------ERLKAIAARM-GDELERWN--IELA
A0A517TY85      ---VKERESGGAQ-SAELEFKKSEL----------EREESVFELI-AARKLALQ--TEQR
A0A5B9QEI7      ---MNELKSGGAQ-SAELEFAKAEL----------EREESVFELI-AARKLALQ--TEQR
                                                                            

A0A5S9IPR9      QFD--ILNPIDSAGIPGRPFSP-------NRTQNYLVGTFLGVML-GVIFVFLIEFLDQS
A0A533Q9U4      KTS--NIKVLDHAEVPIKPIKP-------KKALNILLGIIAGLGC-GVGIAFVMEYMDNT
A0A533Q6B7      KVS--NIRVIDYAEVPLGPYKP-------NKSINTLVGIITGLAC-GVGIAFLMEYMDKT
A0A1U9NNE1      ARV--SVAYYASSVIAKD-----------KRQKLAIVAVLGSICC-GGFLGVMIDRSDKR
A0A2G2JCA2      PS---RVALLPEIPVPTVPIEK-------LPYKNMLMIFMVGLAA-PFGLAVLKEALTVK
A0A1G2XVR0      QTS--NVSILDPAMEPRTPIGA-------SRNSQIMKGVMIGLAL-GIGLAFFLDYLDNT
A0A1G3B0P0      QTS--NVSILDPAMEPRTPIGA-------SRNSQIMKGVMIGLAL-GIGLAFFLDYLDNT
A0A1E3X4X0      KTS--NIRILDAAVVPRHPIKP-------RVKLNIILAIIVGLTL-GVGLAFFLDYLDRT
A0A286U4B3      KTT--NVQIVDRAALPTRPVKP-------KKRLNVFLSMVVGLVM-GTGIAFFLEYLDNT
A0A5C6DDS2      KTT--NIQVVDKAVLPTTPIKP-------KKKLNVLLSMIVGLTL-GTGIAFFLEYLDNT
A0A5S9IJB5      QGEEENIYIASPPRIPKTPIWP-------KTLYILVGAFLFSCFS-GLGLCFALEFLDNS
A0A2E3GW02      SVL--TATVVNHP-SDGSEVRL-------KVFNYAGMGGMGGLAI-GMLVGLLLEYSDKR
A0A5B9QNZ7      GGF--VTEILRAP-EFGELAWP-------ILPLVLAAGLCFGSLL-GGGLALLVDLGDRS
A0A1Z8N7H5      GEI--QATIIKDATASGQIVSP-------KISRIIVCWILGTLGI-GFVLVYVQDTIDDR
A0A1U7CZ81      D-V--DVGLIDAAIAVSEPTNN-------KRIKYVVIVPSVILCL-VLGLFALLEVKAER
A0A142YNY8      DMV--RVSLYDRAAVPRVPSSS-------KRIKLMAAAPMGIMAL-VLGIFSLLEVKAER
A0A1U7GLS6      DMV--RVEQHDPAVPPKRPSDD-------KRLKLMAAVPVGVLAV-LIGLFSLLEIKAER
A0A1G2YPI3      GAL--NISILEYARPADKPSKP-------EKAKYMAMALVMGLML-GGGLGLLRDFMDQT
A0A532UIN2      GAL--NISILEVARAADKPSEP-------EKAACLAKALIMGFML-GIGLALLRDWMDHR
A0A0S8KNX5      ARI--SVAYYADI----ARVLD-------KRVKYSAALVFTALVC-GMGLAHLRDKADQS
A0A3D3UVZ8      TRI--SVHYNADI----ASIND-------KRVKYSVALVFGSLVC-GMGLAYLRDKADQS
A0A517NFU9      AGF--STDLLESPEVSQSAAWP-------KLPIIAAIGLFLGMTL-GLLLAVGSELMDST
A0A5C5YWH4      AGF--STDLLASPEVSRGAAWP-------KLPIICALGLFLGAML-GLALAITTELLDST
A0A3D2TNK4      API--RATVVREPIANNNPVTP-------QIRLIAAVCLLGGTCV-GVVMAYAQDVLADR
A0A7C1Y4F0      ESL--RISILEVARAADRPSKP-------QKAKVMAMALALGLLM-GGGLAFLRDWLDFR
A0A6I0ENW6      GPA--RIEPAGQVKVSSRPKND-------RRPLFSGVLVFGWLAA-GLALAYFRAAMDPS
A0A6L3A0B7      GPA--RIEPAGQVKVSSRPKND-------RRPLFSGVLVFGWLAA-GLALAYFRAAMDPS
A0A0J1B4A0      SGF--STDLIVMPLPASVPVWP-------SRTKIAALGILAGGML-GLALALLAEMTDRT
A0A142WSB9      EGY--KVSQLSQV-RIERSLKQ-------VLKVFGACGLL-GLIS-VFALAYVREWYDTS
M5SZR3          GGF--KANVISPP-GFSWKVKP-------EALIVFPMAIFVGTFF-GFGLACLAELANRT
M5TW92          GGF--KANVISPP-GFAWKVKP-------EALIVFPMAIFVGTFF-GFGLACLAELANRT
A0A2S8FKY2      GAP--RITLLSEAKTGTVTDKK-------KPIMITAAAALAGFVL-PGGLLLLRDFRKKH
A0A517N8P6      SGL--HVKVLRPA-GLGMLVGP-------LLSRALVMGGFLGLVA-GGALAFLWDWSERT
A0A432MJP4      SGV--VTQTIEPPHALRKAVRP-------RVLLTLCMALMSGLVL-GTMAALAADGLDSR
M5UQ35          TGF--STDLLVTPSPAMLPVWP-------AKSKIAAIGILLGAML-GAALAMIAELLDRT
A0A0S8FY64      GVT--NVSFVERASPPQAPVRP-------NKQVNLILGALLGVLL-GVGLAYGLEYLDDT
A0A1N6KFT7      SSI--SCQVIEPPSALPYPVQP-------RVKMTLLMGLMTGLFL-GIGLAYLADRLDPR
L0DFG4          SSI--SCQVVDPPSALPSPVQP-------RVRMTLALGLMGGLLL-GMGLALLVDRLDPR
A0A5C5XXG1      RGY--LYELLETPRI-GAKSWP-------SLPLCGLGGLMLGVFA-GLTLAVANDVRDGR
A0A7C7YUM8      TSA--AAVLIDPAVPPRSRSFP-------RAAIFLVLGAVLGLFL-GCALAFLSHTLRSA
A0A7C2AHI6      TLP--SAVLIDPAKPPRFRSSP-------RLVLSLIVASILGLAA-GLLLAFLRQNLAGC
A0A518BJJ1      TVA--AADFIDAAAAPDLRYSP-------RIGFTLMLSSVLGLGL-GLGLAWLRESLRRS
A0A518D182      ALS--SADFVDRAAAPDRRYAP-------RIGFTLGLGLVAGVLA-GLALLLVREHLAES
A0A7V4HWU2      AGV--NMQVISPP-ARGVQVAP-------KLPNIMAVAALCGMLA-GFGLGYCIELMDRR
A0A5C5WTY6      ASF--TQEILEDP-RVGELVWP-------KPLLCLALGLLGGVLV-GSGVGVSREFMDQR
A0A5C5Y033      SGF--LYEFLEVP-RLGKRVWP-------NVPLCSLGGLVLGLLC-GMVLAVGNELRDSR
A0A5C6G1Y2      SGF--LYEFLEVP-RLGKRVWP-------NVPLCSLGGLVLGLLC-GMVLAVGNELRDSR
A0A354PDV6      SGY--VYELLETP-RPGIRSWP-------KLSICALGGLMLGLFG-GLFLSIANDLRDSR
A0A5C6FZ02      RGY--LYELLETP-RIGAKSWP-------SLPLCGLGGLMLGVFA-GLTLAVANDVRDGR
M5TIT3          SGY--LYEFLEVP-RLGVKSRP-------KKSLCALGGLMLGLFM-GLSLAVANEIQDGR
A0A5M6CY44      SGY--LYEFLEVP-RVGEPVWP-------KLPLCAVGGLALGLCG-GLALAFGTDVRDRR
F2AXG2          TGY--LYEILSIP-RTGEKSWP-------KLPLCGLGGLMLGLFS-GLFLAVANDVRDGR
M2BB46          TGY--LYEILTIP-RTGEKSWP-------KLPLCGLGGLMLGLFS-GLFLAVANDVRDGR
L7CLQ6          TGY--LYEFLAVP-RTGEKSWP-------KLPLCGLGGLMLGLFS-GLFLAVANDVRDGR
A0A0J1B719      TGY--LYEFLAVP-RTGEKSWP-------KLPLCGLGGLMLGLFS-GLFLAVANDVRDGR
Q7UF18          TGY--LYEFLAVP-RTGEKSWP-------KLPLCGLGGLMLGLFS-GLFLAVANDVRDGR
A0A2G1W1E0      TGY--LYEFLAVP-RIGQKSWP-------KLPLCGLGGLMLGLFS-GLFLAVANDVRDGR
K5E235          TGY--LYEFLAVP-RIGQKSWP-------KLPLCGLGGLMLGLFS-GLFLAVANDVRDGR
A0A5C6FFI9      AGF--STDLLSNPEPAKSPAWP-------RLPIVLVLGSFLGFFL-GIATGISAELLDTT
A0A5C5WDJ1      AGF--STDLLASAEVPMNPVWP-------RLSIVLAIGLVNGAIL-GLILVVAAETLDST
A0A5C5X547      QSK--RIEVMAYATRAQKDDPK-------KQIALTIGVGLAGLFA-PLILLMWRDITKQH
A0A353FIP5      AVE--AISIVDWAVPPLLRASP-------RLTLSSLAGILLGLFL-GSFFALWRESSQKK
A0A7V7MJI7      AIA--SVNVVDWAVPPLNRTSP-------SLPLNLMVAGMLGLFL-GAAWGLWREAATRT
A0A5B1CIK7      SGY--LYEFLEVP-RLGEKSWP-------KLPICGLGGLMLGTFG-GLFFAVANEFRDRR
A0A5C5WHS2      SGY--LYEFLEVP-RLGKKSWP-------KLPICGLGGLMLGLFS-GLVLAVANEVRDRR
A0A5C6B6G8      SGY--LYEFLELP-RIGRKVWP-------SLPICGLGGLMLGLAT-GVFLAFANEIRDGR
A0A5C5ZZN3      SGY--LYEFLEVP-RMGVKSWP-------KLPLCALGGLMLGLFG-GLFVAVANDVRDGR
A0A5C5XS91      SGY--LYEFLEVP-RRGEKSWP-------KLSLCGLGGLMLGLFS-GLFLAVANDLRDGR
A0A5C6C4E6      SGY--LYEFLEVP-RRGEKSWP-------KMSLCGLGGLMLGMFS-GLFLAVANDLRDGR
A0A2E1VVJ1      TIE--QVEIIDRALPPRLRALP-------NVRANLVVGILLGLAI-GSILALARESFTRR
A0A3M2AEL0      SLA--TVDVIDWAIPPDSRSRP-------ILAMNTALGLLLGLVA-AFALGLYREGRVRK
A0A2A2W9R6      SGF--STDLLVMPAPANFPVWP-------SKSKIAIMGVMGGIML-GLGLAMLAELADRT
A0A518HKC1      SGF--STDLLVMPVPASLPVWP-------AKSKIAMMGIMGGIML-GLGLAMLAELADRT
A0A518L3P0      SGF--STDLLVMPVPASLPVWP-------AKSKIAMMGIMGGIML-GLGLAMLAELADRT
A0A255R1S0      SGF--ATDLLVQPVPARFPIWP-------SKSKIAMAGLMAGGML-GLALAVLAELIDRT
A0A5B9MKP1      SGF--STDLLVMPVPASVPIWP-------SKSKIAMMGIMGGLML-GLGLAMLAELADRT
A0A351FYP6      PKTS-SVEIIDKADTPLRAVRP-------NVPLNISLGVIVGLIL-GVGLAFFIEYLDTS
A0A0S8J591      EDI--KARVISQADIPKGKFSP-------NPALNLPLGLVVGLMV-GIIAAFFFEYLNTT
A0A532UT69      GALN--ISVLELARPANAPSEP-------QKTRYMATALLAGLML-GGGLALARDWMDQT
A0A7V9G2R2      DAQY--LSLVDAPAAGTDAVNI-------NPTMALVMALLLASIT-AIAVPNAIEMIDRR
A0A2D5AWU0      GALN--ILVIDYGRPSNTPASP-------DRVSMMAYALAGGVGL-AFAIVMLRSFSDKK
L0DC26          APPR--IRLLEKAELPHTKDEI-------RQIKMAGMAGCGAFAL-TLLGISLWETRARR
M5RT57          APGR--IVLLQPAEPTLHPVAS-------FPLRNMAIAAFLSGCL-PFGLALLWELSTKP
D5SZ21          GIRT--A-VVGEPKVNPRPVHP-------KLSLTVAVSLMAGISL-GLALVYLADLLDDR
A0A7X7U1J4      GMMN--VDILERAEPSAKPSHP-------QAAKTMGVSLCLGLCG-GMALSFVREWRDQH
A0A7V8E5N8      GTQS--VRILDPAKPPPSPWKP-------NNRQNLIIAAFLGLLL-SGGSVLVAEQLDNR
A0A356KTN1      AVAN--ARIIDRAKGAWR-VRP-------SHSRNVILGLLFGFGL-GAVIALIFERLSDR
A0A7Y5LV28      GVSS--VRIIDNARPTKEPWKP-------KIPLNLALGCLAGLVL-GGGATLLADQLDNR
A0A7Y5HFQ5      DLAP--AALRERASVSRAQVEP-------RPARDITLALVLALML-GVGTAYLLEQFNDS
A0A7W1FMQ9      EVPD--LAVTMLPKVRSEPATA-------RKGPFLVLALVFGSVV-FVGTCVAVDLLDRR
A0A7W1NA62      GSQK--VTLIDPATAGAAPVNI-------RRSLFLAFALVAGAIA-GGLTALLMEALDRR
A0A7V9JTP9      DTNR--VLIVDPAKATLEPVNI-------KKTLFVAAAAFLGLAA-GALTALLVENLDRR
A0A7W1FJ38      DAKQ--VVQIDPPKTDLRPVNI-------RKTLFAAGALAAGLVA-AVLAALGAEALDRR
A0A1G2YQB7      ------LARISVAYLASTAPYQ-------DRRMQFSIALMMAGCVSGMGLALLTNKLDVR
A0A353P687      ------LARISVAYLANTAPYQ-------DRRMQYSLAITMGSLVFGLGLALITNKLDLR
A0A356EME5      PAR---VVLFDEATPPDAPLVE-------IPLAKMGLAAMVAFCV-PFGLALGWERIVRR
A0A3L7P4E4      GYHR--TQVLAPATR-GYQVEP-------NFQKCIIVGSVAGIAV-GLLLGLLVEAADKS
A0A3L7PEB5      GNYR--TQVLAPATR-GVQVEP-------NFQKTMIMGSALGVLV-GLLLGFLVEAADKS
A0A1U9NL64      GALN--ISILEVARAPKDPSKP-------QKARVAAMALVLGLMA-GGGLALLRDFMDKR
A0A2N1UCJ3      GALN--ISILETARPAEFATSP-------KKAPTLAASLILGLLF-GLALAITRERLDWR
A0A7V2H881      GTMN--VFVVQQAKPAGLQIEP-------DLLMLLFKGGMVGLVL-GIGLALLREFLDTR
A0A7C4EK84      GALN--ISILETAQVPDRPVKP-------HKSRVAGMALVLGLML-GIAAALAVEWTDQR
A0A7C3F0T2      GLLN--ITILEVATPAGAPSSP-------NRQRTMAMALLVGLMV-GIGLAVALDWMDQR
A0A7X7U4K9      EIEPLKIRVMEYADTPSVPSWP-------KKNRVLAVALLIGIFT-GGAVAVLRDWLDQT
A0A2E0X4J3      GATK--VNIMEVALPALEPSYP-------SRPKFLAAGVMLGSLM-GFGLGWLRNLLDHR
A0A838QZ11      AGMDNIVSILEVAAPSVEPSYP-------SRARFLGGGLLLGGLV-GFGLAWLRELMDQR
A0A5C5YU10      GAMN--VSIIETASAPKLPTYP-------SRAKFLGAGVMLGALS-GFGLAWLRDMLDHR
A0A517MPZ6      GAMN--VSIMEVARASSEPTYP-------IPARFLAIGALLGGLT-GFGLAWLRDLMDHR
A0A5C6CNV7      GAMN--VSILEVAGPTTVPTYP-------NRTRFLGVGGLLGGLV-GFGLAWLRNLMDHR
A0A518K5H4      GAMN--VSILEVATP-GIQTFP-------GRRKTLSLGLAFGSML-GFGLAWLRSMLDQR
A0A5C6AA28      GAMN--VSILEVAGP-GMQTFP-------DRPKTLSLGLAFGAML-GFGLAWLRNLLDHR
A0A2E7ESJ6      EGY--NYQTLAKPTVGDK-VAP-------LLLKVMPIAALFGVVV-GFGIAYLVDVADKA
A0A2E9VK20      GYQ-----LTQISPSRAEPDIK-------HVIKIVGGCLVMTLMS-TYAFLFLREMRDTS
A0A3D4PJK1      GYQ-----LTQISPSRAEPDIK-------HVIKIVGGCLVMTLMS-TYAFLFLREMRDTS
A0A355AI52      GGV--RTTVVREPVVAERPVSP-------KLSLTILAVLTGGLAS-GIGIIFVIDTLDDR
A0A354PCQ3      DG---AVRTLTLATPPSSPVTA-------LPVKHMGMAASAAMMV-PFLFGLLWEL---R
A0A0S8GZ23      -----PARITISDEASTGPPVT-------KREKLLAALAIGALAL-GISFALLMGKIDKT
A0A1I3DDV4      SGY--IHEVLEEPQAGEE-VWP-------ALNICVAGGMFLGLCL-GVLVAICNDQFDNR
A0A7V2UF66      GAL--YITVLEVASPSYSPSSP-------NRVKVMSIALVFGLML-GVGLALGLDFLDQR
A0A2E0SMM6      EVL---AKIVKKPEISRDPISP-------NKVRTALFSLIMGISL-GVGVIVVLEALDDR
A0A3L7SI46      GL---KISVPTVAKVVPSAVAP-------KISTTVFLCTLFGLMS-GMAIIYVIDVLDDR
A0A5B9PJZ8      KW---RKMSELNPASVAEQVAP-------SLPLCLGGGLFLGTLL-GFLFAGVKEMAEKT
A0A2S8G191      DS---RVTFFQDAQPPKSKNP--------RSFAKIGMFGFAGMMI-PVAGFVFWDLRSQR
A0A2E7EGG1      PS---RVELVQKATTPEVPVQN-------LPWKMLLVSVLASISL-PFGLFLIWERTLKR
A0A2E2N5A9      NSV--NVHVVDRAMVPEEPVKP-------NRPLIVAVAGLIALFF-VAGTGVVKDVLNDT
A0A7C8AGA2      -----PARISVAYQASSVPAQG-------KRRKLAAALGFGGLAL-GAILALLLDKADKS
A0A7C2FXP7      -----PARISVAYKAEVIPITD-------KRIKLTLAALMGAFAL-SFMAALLRDKADTS
A0A1P8WP26      FI---RTEISSPPRVNQLPVSP-------RPVIVGFLSIFFGTAG-GLGIIWVLDIMDDR
A0A3L7V1F3      MV---ITSIPRKPTLSTRPVNP-------RLAITGILSLMLGSIA-GLGIIWVLDIMDDR
A0A2E3GWC6      GYQ------LQQISPSQAELDF-------KRILKIVGGITIMLLVATYGLLFLLALRDTT
F0SLB0          GYQ------LQQISPSQAELDF-------KRILKTVGGITIMLLVATYGLLFLLALRDTT
A0A3L7NDH9      GGV--KMSVVREPLVPSKPVSP-------NLLLTLVAVLVGGGAV-GIGMIVVVDVLDDR
A0A7X8IIB9      -----KPRISVASWARSVSSEG-------KKMKLILASPFGGLAI-GLAFAFLLAKLDRR
A0A532UD06      GAL--NISVLEVARPARNPSEP-------QKRKIMATALALGLVF-GTCLAFLRDWIDYR
A0A660URN1      GAL--NISILEVAYPAIHPSRP-------QKAKIMMAALVLGLML-GFALALVRDWMDYR
A0A517ZCB5      HL---RTAVISEPQVNPVPVSP-------RLTVVAMLCLIIGTGG-GLATVYLMDIIDDR
A0A225EH48      S----RIQLRQPAVVSQLLNIQ-------KKILCGIAAFFAGFLL-IALAVAFLEWRSRR
A0A518INW8      AGY--TIDLLSPPGPGSL-VWP-------VLAKILLNGGLAGLLV-GGLLAFWAEHADQT
A0A518JPH9      AGF--TIDLLSPPGVGGQ-IWP-------KLSKILMNGALAGLLV-GGLLAFWAEYADQT
A0A5C5VEK8      APV--NVSIIETASVAPDPSYP-------SRPKFLGAGVMLGALC-GFGIAWLRDMLDHR
A0A532UTJ0      PK---RISVYYHADVANIN----------DKRIKLSVAVIFGALVCGMGLAYLRDKADLS
A0A2E2CCW9      SGY----MLTQLAPVKDELVIK-------RQLKFLMAGAAGGLGL-ILAFSYFREMRDTT
A0A3C0AGX3      SGY----MLTQLAPVKDELVIK-------RQLKFLMAGAAGGLGL-ILAFSYFREMRDTT
A0A518AAQ5      SGY----TMTQLSPVKDELVIK-------RQLKFLMAGGAAGLGL-VLALSYFREMRDTT
A0A517QBG9      SGY----TMTQLSPVKDELVIK-------RQLKFLMAGGAAGLGL-VLALSYFREMRDTT
A0A518FTU3      SGY----TMTQLSPVKDELVIK-------RQLKFLMAGGAAGLGL-VLALSYFREMRDTT
A0A517WHH5      SGY----TMTQLSPVKDELVIK-------RQLKFLMAGGAAGLGL-VLAFSYFREMRDTT
A0A5A8BGT3      SGY----TMTQLSPVKDELVIK-------RQLKFLMAGGAAGLGL-VLAFSYFREMRDTT
A0A2E7K7A9      SGY----TMTQLSPVKDELVIK-------RQLKFLMAGGAAGLGL-VLAFSYFREMRDTT
A0A517PTS5      SGY----TMTQLSPVKDELVIK-------RQLKFLMAGGAAGLGL-VLAFSYFREMRDTT
A0A6I6AH34      SGY----TMTQLSPVKDELVIK-------RQLKFLMAGGAAGLGL-VLAFSYFREMRDTT
A0A517VTK3      SGY----TLTQLSPVKDVLVIK-------RQLKFLLAGGAVGLGL-VLAISFFREKQDTT
A0A517WQT4      SGY----TLTQLSPVKDVLVIK-------RQLKFLLAGGAVGLGL-VLAISFFREKQDTT
A0A517VID8      SGY----ILTQLAPVKDELVIK-------RQLKFLMAGTAAGLGL-ILAFAYFREMRDTT
A0A517RK10      AGY----TLTQLAPVKDELVIK-------RQLKFLMAGGAVGLGL-VLAISYFREMRDTT
A0A518IH18      GGY----TLTQLAPVKDELVIK-------RQLKFLIAGGAVGLGL-VLAISYFREMRDTT
A0A7W0M4Y4      GI---RTQIIAEPAEGFRTPE--------ERTKHMAVGGALGLLF-VVILAYLLESNDKS
A0A2D5NDU9      GKT--VAHVLDYAEPNEAKLAS-------GQPIRLPTGILLGLLA-GIALAWFQGMLDTR
A0A5C5XLF4      GYQ-----LTQISPSRAEPDIK-------HVIKIVGGCLVMTLMS-TYAFLFLREMRDTS
A0A518CHE5      SVL---AKTVKKPEISRYPISP-------NKIRTAMFSLILGIAM-GIGVIVVLEALDDR
A0A1V5N3W2      -----PARISVAYNASSLPLPS-------KRIKLMGAALFGALAA-GIFLAFVRDKADKN
A0A517NSK8      AGF--DTDVIGDADIQEQSSWP-------DPKIVLPLGMIAGLAL-GVMLAFIADLCDTT
A0A5C5Z0D6      AGF--STDVIGDAETQRRPSWP-------NPLIVLALGIFAGGLL-GFGTALLADVMDTT
A0A7W5H7D9      AGF--STDVIGDAEPQERPSWP-------KPIIVLALGLFAGGLL-GFGMALLSDLMDTT
M5UE94          AGF--STDVIGDAESQERPAWP-------RPLIVLALGIFAGGMF-GMGMALLADLMDTT
A0A3E0MY27      QKP--KVSLRGEATVPAMYDSS-------NRDRYTVLAALAGFGL-AIVGVSLYEFQFRR
A0A7V4M591      SEV--RTAVIEQPEPILRPVSP-------RLTYVVLLVLVGGFGA-GLGLVHLLDALDDR
A0A7X7F3G7      HDV--RAKVTAPPVANQRPVSP-------RLAFVALVAIASGLGI-GFAAVYVLDVLDDR
A0A7Y4VQ32      AKQIGRVTVSAHAVLPAEPYRD-------RRILLTLMSLCGAVVL-GVGTALLRVALDPS
A0A2E0X9P6      APD--RITLKQSAAVPARPLNP-------IPYELLLVVCAASLAT-PFAVGALREVSVRR
A0A1N6DAJ8      APP--RIRLLEKAELPRTKDEI-------RQIKMAGMAGCGAFAL-ALVGVSFWEFRSRR
A0A2E8FLY0      GGL--RTKIVSQPKAAKSPVTP-------RLLVVALCALTTGLGL-GLGLIYVLDYFDDR
A0A3D2U1E1      GGL--RTKIVSQPKVAKAPVSP-------RLLIVAFAAIVGGLGS-GLGLIYVLDYFDDR
E8R3W3          APP--RITLINPADAVRIVGDP-------TKRLKLSGMIGAGVFFASLVGIALLEFYSNR
A0A5C5ZM48      AID--RVELLREGEIEQTPVVG-------MPWKKMAAAALGCWFL-PFAVALIAERSLRR
A0A5B9WF77      SAV--TIPRIDRAKAPRDSFNN-------KRLKFMAIVPVVVLGA-LLGLFLLLEIRAER
A0A7C4Z5R7      LPA--RVNLMEKAEPPQTNSRD-------KTLRLAGAAGVGVFGL-VFLAVAFLEYRARR
A0A1P8WN28      GAF--KVAPLSDPRIPKFAVYP-------VLTNTLVMFCVAAVAL-ALGVIYVIDLMDDR
A0A3B9CTT0      THF--KVAVLSDAMVPRTPSLE-------SLNSRLIFYCVLAVMA-AMGVIYVLDLMDDR
A0A518ALT3      APT--RASLMHTASPPRLSIEP-------IPFKLLAIACLSALIA-PLGLATVREVVVKR
A0A286RGB6      AKP--RITVVQRAEVPRVADSD-------RRIQLAIMGGLAGFIL-PGAVLLWWDVRRKP
A0A7V3TZQ6      AKP--RITVVQRAEVPRVADSD-------RRIQLAIMGGLAGFIL-PGAVLLWWDVRRKP
A0A3M1QRP3      DAR--PSGAADVDKRPKLSLAA------------VFGAAFAGLLA-GLARAYFTGALFEV
A0A517TMV0      API--QTTIVEEPLPSERPASP-------QLRMVLAASLLGGLVL-GVGVVYTQDLLDDR
A0A3E0MY88      GDI--RSEIIKEPAASRVPVSP-------RLKTVAAACLFSGLVI-GGVVIFVLDTLDDR
A0A518BBX8      GGY--EAKIIAPPELGEQ-VWP-------MAIIIFPVAGLLGIMS-GLGLVYLVDMADTS
A0A5B9QF68      API--QATVVREPVPDRVPVSP-------QIRFLVFFCLASGTAV-GAVIVYVQDVLDDR
A0A5B9QGF0      API--QATVVREPVPDRVPVSP-------QIRFLVFICLASGIAV-GTAIVYVQDILDDR
A0A5C6CK24      API--QATVVREPVPDRVPVSP-------QIRFLVFICLASGTAV-GTVIVYVQDVLDDR
A0A7C5FXU1      SRP--RITLIQRATPPAVPDQE-------RRVQLTVLASLGGMAL-PIVGILWWDVRRRR
A0A847YFA1      SKP--RITLVQRAESPRLSDQD-------RRLQLSLLGGLGGFCL-PGLAILWWDTRRKT
A0A1C3E6N1      G-I--RTAVVGEPKVNPRPVHP-------KLSLTVAVSLMAGISL-GLALVYLADLLDDR
A0A518GJT2      G-I--RTAVVGEPKVNPRPVHP-------KLSLTVAVSLMAGISL-GLALVYLADLLDDR
A0A2E8B0L9      GDV--RVSMVNEPKANERPVSP-------RLALTGILSLIGGLGI-GCALVYVMDLVDDR
A0A5Q4GFE7      SDV--RVAVVSEPKASDRPVSP-------KLPLVAMLCLVGGLGI-GLALVYVIDVLDDR
A0A257WS34      DGL--RIRVVSEPRVNEQPVSP-------KLSTTGILCLFLGTTL-GLGVIYLRDAIDDR
A0A7C4LP10      NSL--RVRIVSEPKVLLFPVSP-------KLSSTGLLALALGTVV-GLGLIYVLDAIDDR
A0A2E3RCU8      GEI--RATIIKEAAASGQIVSP-------RLSRVIVFWFLATIGI-GFALVYVQDTIDDR
A0A517MLW3      AAV--RVAVIGKPKALIAAVSP-------RLRLVVLAAGFFSTLL-SVGLVYIADLRDDR
A0A5B9QVD0      AAV--RVAVIGDPKAGMGAVAP-------RLKVTAALALMLAMGI-SVGLVFFLDLRDDR
A0A3A0DET7      GAM--NVSILEVAGPATIPSYP-------SRARFLAVGLMLGGVV-GFGLAWLRELLDHR
A0A3B8PNV4      GGL--RTKIVSHPKAAKLPVTP-------RLLVVALCALACGLGA-GLGMIYILDVLDDR
A0A3D1DR40      GGL--RTKIVSHPKAAKLPVTP-------RLLVVALCALACGLGA-GLGMIYILDVLDDR
A0A2E7RYU8      GGL--RTKIVSHPKAAKLPVTP-------RLLVVALCALACGLGG-GLGVIYILDVLDDR
A0A3B8LXG8      GGL--RTKIVSHPKAAKLPVTP-------RLLVVALCALACGLGG-GLSVIYILDVLDDR
A0A6M5Z0K7      DKT--TKSIARKRVREVAPAEKGEILNKFGRHIEAAGGGVFGVLF-GLLTISVLDHRRNR
A0A350CI62      TFL--STKVSSRPTVPIRPVSP-------RLPIAVLLSLLIGTGT-GLAVIWVLDIMDDR
A0A4P5WQK6      TFL--STKVSSRPTVPIRPVSP-------RLPIAVLLSLLIGTGT-GLAVIWVLDIMDDR
A0A3C1X4W5      TFL--STKVSSRPTVPIRPVSP-------RLPIAVLLSLLIGTGT-GLAVIWVLDIMDDR
A0A3D3W3A7      TFL--STKVSSRPTVPIRPVSP-------RLPIAVLLSLLIGTGT-GLAVIWVLDIMDDR
A0A7Y5SKC2      LDV--RTTVVDEPVVRKNPVSP-------KLVMTFLLCLLAGLGV-GLLAVYLLDVLDDH
A0A7X7U104      GAL--NITVLETAEPALEPSEP-------QKPKAMAMALGLGLFA-GVGLALLREWKDQR
F0SI78          SVL--TATVVNHP-SDGSEVRL-------KVFNYAGMGGMGGLAI-GMLVGLLLEYSDKR
A0A517MDV3      GGF--VTEILRAPEFGEL-VWP-------IIPLVLIAGLCFGSMT-GGGLGLLIDLGDRS
A0A518IQ30      GDI--RVSVVGEPVASPNAVAP-------QLKVIGLLSLFAGCGI-GIAIAYITDLLEDH
A0A517LWP4      GDI--RVSVVGEPVASPGAVAP-------RLRIIGVLSIFAGCAI-GIAIAYVTDLLEDR
A0A518JNW8      GDI--RVSVVGEPVASPGAVAP-------RLKVIGLLSIFAGCGI-GIAIAYITDLLEDR
A0A2E3GWX1      TSL--RTRITKHAEPNPAPVSP-------RLTLTLAMSIVAGMGL-GALTVLLMDLLDDR
F0SG60          TSL--RTRITKHAEPNPAPVSP-------RLTLTLAMSIVAGMGL-GALTVLLMDLLDDR
A0A2E9VST2      SSL--RTRITKHAEPNRIPVTP-------KLTSTLMLSIFAGLFL-GATTVLLLDLLDDR
A0A356A6X2      SSL--RTRITKHAEPNRTPVTP-------KLTNTLLLSILAGLFF-GATTVLLLDLLDDR
A0A5C5XLM3      SSL--RTRITKHAEPNRTPVTP-------KLTSTLMLSILAGLFF-GATTVLLLDLLDDR
A0A7V2UW16      ELT--NISVADRPVTPEAPAGP-------NRRMHLMLGLMAGIAL-GLAAAFLVEQLDPT
A0A518DRX3      SDV--RVAVVGEPLANENPVSP-------NLKMTVLLSLLIGLGG-GAALVYGIDLLDDR
A0A518DZF9      SDV--RVAVVGEPLANENPVSP-------NLKMTVLMSLLIGLGG-GAALVYGIDLLDDR
A0A2E7ENQ5      AEV--RMAVVSEATASDSPVHP-------RLLTVLATVIVSGLSL-GIGLAYVLDVLDDR
A0A7V2XSV8      ELT--NISIVEKAKAPARPFSP-------NKPLNLALGLAAGLAL-GLAAAFLVEQLDPT
A0A847GXG1      SDL--RVAVVSEPKASNRPVSP-------RLSLVGMMCLLGGLGV-GVALVYVLDVLDDR
A0A7C5BZF0      REV--RAFVISEPKMNPTPVSP-------NWQFVLLGALGAGVAL-GLAVVYVVDILDDR
A0A847YGH5      RDL--RVSLITEAVENRTPVSP-------SLTRTVAIVLLLGLGV-GLMIVYVQDVLDDH
A0A286RLF2      GDL--RASVITEPRENRSPVSP-------SLPRVLIMVILGGLTL-GMFVVYVMDVLDDR
A0A7V3TX18      GDL--RASVITEPRENRSPVSP-------SLPRVLIMVILGGLTL-GMFVVYVMDVLDDR
A0A1G3AQE9      QQI--CATLLDEPRVNRTPVSP-------NLARTVLAVLTLGLGL-GLGAVYILDILDDR
A0A3L7UQT9      EGI--KVDLNKLPKAGKLPSSP-------RLVLVVAVCFILGIGG-GLGLIYILDLLDDR
A0A4P5YBU2      EGI--KVDLNKLPKAGKLPSSP-------RLVLVVAVCFILGLGG-GLGLIYILDLLDDR
A0A7C7V5U8      ADM--RAVVVTEPERIDQPVSP-------SLRRVVLMVLIAGLGT-GLLAVYVLDILDDR
A0A3M1VCL4      GAL--KTEVVSHPKVVPQPVSP-------RLVLVALVALTLGTTT-GLGMIYVLDSIDDR
A0A518AKT8      GPI--QAVVVEDPLPELKPVSP-------RIKTVFLMSVLSGLIV-GVSLAYIQDALDDR
A0A5C5ZR72      APA--RVEVMDEVMSSNVPEEA-------IPWKQLFVACAMSMVV-PYGVVVLREMALRR
A0A7Y5SJZ4      ELV--RTSIVSHPTAVREPVSP-------RLRSVALISLFLGLVA-GVGTVYVRDLLDDR
A0A5C5V7Z9      API--RASIVEEPLPEETPVSP-------RFASLFGSAILGGLAL-GAVIVFVRDQLDDR
A0A5C5YT05      API--RASIVEEPLPEETPVSP-------RFARLFGSALVGGVLL-GAGIVFIRDQLDDR
A0A518D7F9      APV--RVTVIEEAMPNERPVSP-------QLRLVVLASLCGGLAV-AAGVVYAQDLLDDR
A0A5C5ZIP0      API--RATIVQEPLPSDRPSSP-------QLKLVLVASLLSGLAI-GLGLIYVQDLMDDR
A0A518KBK3      API--RATIVEEPLPSDLPASP-------QLRLVLVASLMAGLCL-GVGLVYVQDLLDDR
A0A5C6AKF9      API--RATIVQEPLPADRPASP-------QLRMVLMASLLGGLCL-GIGVVYVQDLLDDR
A0A7C2KUQ9      APG--RINVQSYADEPSEPYNA-------RRSLLLTAMAICGAAALALAAAYVRVSLDQA
A0A7C5R0U3      ADV--RLAVVNPPVVPREPVSP-------RAGTVFPMALAAGLLV-GLLSAYALELLDDR
A0A847YCQ7      APP--RVVEFEPAGVPRINNLQ-------DKQRLVLFIGLTTLAG-VVIVVVLGDYLLRP
A0A286RD13      APP--RVRVLEEASTPRISNIN-------DKYRLVSFLGLMAFLG-TGAAVVLLDFFLRP
A0A7V3TUJ6      APP--RVRVLEEASTPRISNIN-------DKYRLVSFLGLMAFLG-TGAAVVLLDFFLRP
A0A517TY85      APE--RVFLMQVAEPPSMALEP-------IPYKYLLVACLASMLA-PLGLAVAYEALLRR
A0A5B9QEI7      APT--RVTLMQSASPPHIAIEP-------IPYKYLLLASLVSLVT-PLGLAIAYEFLAKR
                                                                            

A0A5S9IPR9      IKTVEEVQQLTPARIMGFIPF--I------------------------------------
A0A533Q9U4      IRTQEDVEKYLKTSLLGIVGHIPL------------------------------------
A0A533Q6B7      IKTQEDVKKYFGTVLLGIVGH--I------------------------------------
A0A1U9NNE1      MRTPTDLNKSLSTRIIGTTVC---------------------------------------
A0A2G2JCA2      VSGREQLELQSNTPVLAEISQ--L------------------------------------
A0A1G2XVR0      VKSTEDVENYLGVTLLGLVERAKQ------------------------------------
A0A1G3B0P0      VKSTEDVENYLGVTLLGLVERAKQ------------------------------------
A0A1E3X4X0      LSTPEDVERYLQVPLLGAVGRIEM------------------------------------
A0A286U4B3      IKSADDVEKHLNATVLGVLEKVEV------------------------------------
A0A5C6DDS2      IKSADDVEKHLKSTVLGVLEKVAV------------------------------------
A0A5S9IJB5      VKGKDQLEKMMQRPVLGLIAE---------------------------------------
A0A2E3GW02      FRSPEEMMQMLGVPILGHIPEMPA------------------------------------
A0A5B9QNZ7      FRSTADIETATGAPMLGAIGAMKF------------------------------------
A0A1Z8N7H5      FRTPEELSKRVGQPLIGLVRA--L------------------------------------
A0A1U7CZ81      VADPDALSTRVQSEVFSLPPLP-M------------------------------------
A0A142YNY8      VGDPDQLSTRVQSEVYSLPPIP-M------------------------------------
A0A1U7GLS6      VGNPDALSTRVQSEVYSLPPIP-M------------------------------------
A0A1G2YPI3      LHSAEDISAVLSMPVLGVVPS--M------------------------------------
A0A532UIN2      LHSAEEISAVLNLPILGVVPS--M------------------------------------
A0A0S8KNX5      LRTPDDVAKRIGIRIIGTTTS--L------------------------------------
A0A3D3UVZ8      LRTPDDVAKRIGIRIIGTTTS--L------------------------------------
A0A517NFU9      FSDVADLERTVGAPAIAHVPR--F------------------------------------
A0A5C5YWH4      FSDVHDLERTLGAPAIAHVPR--F------------------------------------
A0A3D2TNK4      FNSPEELTLQLGVPVLAMVKK--L------------------------------------
A0A7C1Y4F0      LRSSEEVSAILGIPVLGVVPK--MGASKVLPMRGHKPSVPPVPIAAIDVPAGEATASSDL
A0A6I0ENW6      MSEVSDVTNTVQVPFLGQMPR--F------------------------------------
A0A6L3A0B7      MSEVSDVTNTVQVPFLGQMPR--F------------------------------------
A0A0J1B4A0      FHDPAEVERIVGASILAHVPR--L------------------------------------
A0A142WSB9      VRSVDEVRQLTGAHVLGIVPH--F------------------------------------
M5SZR3          FRTSDEISKHLMLPVIGRIALARV------------------------------------
M5TW92          FRTSDEISKHLMLPVIGRIALARL------------------------------------
A0A2S8FKY2      LSDLPTTRDELGLELLGTIPR--L------------------------------------
A0A517N8P6      FRSPDEISTLLGLPILAHLPV--I------------------------------------
A0A432MJP4      VRSLDEVRSMLGSRILGVIPR--L------------------------------------
M5UQ35          FKNPEEVERVVGAPILAHLPL--L------------------------------------
A0A0S8FY64      VKTPDDVERRLNMPWLGYVPQ--M------------------------------------
A0A1N6KFT7      IRTLDEVRKVLEFRLIGTIPK--L------------------------------------
L0DFG4          IRTLDEVRKVLNFALIGTIPK--L------------------------------------
A0A5C5XXG1      FRSAAEVEETVSLPSLGRVGK--L------------------------------------
A0A7C7YUM8      LHSEAEVEQATGLPVLGSIPD--F------------------------------------
A0A7C2AHI6      MYSAAELEEASSLPVFGAIPD--F------------------------------------
A0A518BJJ1      LQGPSELEAVTGLPVLTTVPD--F------------------------------------
A0A518D182      LESEGELERITGLPVLASVPD--F------------------------------------
A0A7V4HWU2      FRSPEEVRSYLGLPIFGHIPTIGL------------------------------------
A0A5C5WTY6      FASVEQFETALGLQAFGVIDD--L------------------------------------
A0A5C5Y033      FRTAQEVDEAIGLLNLGHVGQ--M------------------------------------
A0A5C6G1Y2      FRTAQEVDEAIGLLNLGHVGQ--M------------------------------------
A0A354PDV6      FHSAVEFEQFIGLRTLGRIGK--V------------------------------------
A0A5C6FZ02      FRSAAEVEETVSLPSLGRVGK--L------------------------------------
M5TIT3          FRSSAELDEAIGLPRLGSVGK--L------------------------------------
A0A5M6CY44      FRSAAELDEMIGLPNLGRVGK--M------------------------------------
F2AXG2          FRSAAELDEAIGLPSLGRVGK--L------------------------------------
M2BB46          FRSAAELDEAIGLPSLGRVGK--L------------------------------------
L7CLQ6          FRSAAELDEAIGLPSLGRVGK--L------------------------------------
A0A0J1B719      FRSAAELDDAIGLPSLGRVGK--L------------------------------------
Q7UF18          FRSAAELDEAIGLPSLGRVGK--L------------------------------------
A0A2G1W1E0      FRSAAELDDAIGLPSLGRVGK--L------------------------------------
K5E235          FRSAAELDDAIGLPSLGRVGK--L------------------------------------
A0A5C6FFI9      FRDVEDLETTLQASAIAHVPL--F------------------------------------
A0A5C5WDJ1      FSSVEELEGTTGAAVIAHVPR--M------------------------------------
A0A5C5X547      VDDLKTMRLAIGLEHMGGIPR--L------------------------------------
A0A353FIP5      IRSTAQMEAVTGLTQWASIPD--F------------------------------------
A0A7V7MJI7      ILSAAQLEEATGLPQFGVIPD--F------------------------------------
A0A5B1CIK7      FRSAAELDEAIGLPNLGMVGK--L------------------------------------
A0A5C5WHS2      FRSASELDEAIGLPNLGMVAK--L------------------------------------
A0A5C6B6G8      FRTAAELDEAIGLPSLGRVGK--L------------------------------------
A0A5C5ZZN3      FRSSAELDEAIGLLSLGRVGK--L------------------------------------
A0A5C5XS91      FRSAAELDEAIGLTSLGRVGK--L------------------------------------
A0A5C6C4E6      FRSAAELDEAIGLTSLGRVGK--L------------------------------------
A0A2E1VVJ1      IRSAAQLEATTQLPVLGTIPD--F------------------------------------
A0A3M2AEL0      ILSIAQLETATGLPQVGVIPD--F------------------------------------
A0A2A2W9R6      FRNPGEVESVVGAPILAHMPM--L------------------------------------
A0A518HKC1      FRNPEEVESVVGAPILAHMPM--L------------------------------------
A0A518L3P0      FRNPEEVESVVGAPILAHMPM--L------------------------------------
A0A255R1S0      FKNPGEVEKAAGASIIAHLPQ--M------------------------------------
A0A5B9MKP1      FKDPGEVESVVGAPILAHMPM--L------------------------------------
A0A351FYP6      VKTIDDVERALDAAVLGVIPQ--N------------------------------------
A0A0S8J591      IRMPRDIEDGLGLPVLGFVPA--M------------------------------------
A0A532UT69      LRSGDEISALLRMPVLGAVPA--M------------------------------------
A0A7V9G2R2      VRGPDDVREVLEREVLSTIPY--V------------------------------------
A0A2D5AWU0      MRIIGELPHVLNVNVVGVMPR--L------------------------------------
L0DC26          IDSAADVIQCLGMNLFGTLPI--L------------------------------------
M5RT57          ISDVDQLTSNTTQTTVSEVAK--L------------------------------------
D5SZ21          FRSPEETSLQLGAPVLSFIPS--L------------------------------------
A0A7X7U1J4      VRSTQEISALLGVPVLGAIPA--M------------------------------------
A0A7V8E5N8      ILSPDEVRAFVGMEVLAAIPR--L------------------------------------
A0A356KTN1      LRTLKDAVNALGIPVLGVVPH---------------------------------------
A0A7Y5LV28      ILSAEEVEAFLGMDVLTVVPR--L------------------------------------
A0A7Y5HFQ5      VTRPEEVTRVTGLPILGMLPR--I------------------------------------
A0A7W1FMQ9      LTGPEAAARLTGLPVLGTIPL--V------------------------------------
A0A7W1NA62      VRGAENASALTGLPILGAVPH--S------------------------------------
A0A7V9JTP9      VRGAGSVQALTGLPMIGQIPH--V------------------------------------
A0A7W1FJ38      VRGAAATQELTGLPLLGQLPF--V------------------------------------
A0A1G2YQB7      LKTPDDM-KRIGVRIIGT------------------------------------------
A0A353P687      LKTPDDITKRIGVRIIGT------------------------------------------
A0A356EME5      ISGAEDLEHETNLAVIGEIAR--L------------------------------------
A0A3L7P4E4      FRSPDDISQTLRLPIVGISPQ--I------------------------------------
A0A3L7PEB5      FRSPDDISQTLRLPIVGISPQ--I------------------------------------
A0A1U9NL64      IRGAEEITALLGLPVLGVIPL--M------------------------------------
A0A2N1UCJ3      LRSAEEISMVLATPVLGIVPS--M------------------------------------
A0A7V2H881      LRSADEIRNVLGLPILGVVPH--I------------------------------------
A0A7C4EK84      LRTPEDVRSVLDLRVVGSVPR--M------------------------------------
A0A7C3F0T2      IHSADDVTNTLGLPILGMIPQ--M------------------------------------
A0A7X7U4K9      LRSADEVSALLGLSVLGVIPG--M------------------------------------
A0A2E0X4J3      LKSADEIGEALQLPLVGAIPL--A------------------------------------
A0A838QZ11      LKSVDEISDLLQLSVVGVVPY--T------------------------------------
A0A5C5YU10      LKSVDEIQELLQLQVFGAVRR--Q------------------------------------
A0A517MPZ6      LKSIEEIAATLQLPVLGALPL--S------------------------------------
A0A5C6CNV7      LKSIDEIAQVLQLPVLGALPL--S------------------------------------
A0A518K5H4      LKSIEEIASVMQLPVIGAVPL--M------------------------------------
A0A5C6AA28      LKSIEEIASVMQLPIVGAVPL--V------------------------------------
A0A2E7ESJ6      FRTPDEVASLMRLPVIGHVPL--I------------------------------------
A0A2E9VK20      VKSLADLRAIVDTPILGTLPS--I------------------------------------
A0A3D4PJK1      VKSLADLRAIVDTPILGTLPS--I------------------------------------
A0A355AI52      ARSPEELQAELNLPTLATIGI--L------------------------------------
A0A354PCQ3      MRRITDSSMCGELSVIGEIAR--L------------------------------------
A0A0S8GZ23      IYDPEDIERCIGVPMIGTTSD--L------------------------------------
A0A1I3DDV4      FRTPSEIDSALGVPVIAQVGK--I------------------------------------
A0A7V2UF66      FHSADEITATLGTPLLGIVPQ--M------------------------------------
A0A2E0SMM6      FRSADEIKYHLNLPVLAMVRR--M------------------------------------
A0A3L7SI46      FRSPDELQTQLGLPMLAMIRE--M------------------------------------
A0A5B9PJZ8      FRSSEDIAAILGSRVIGHVGL--F------------------------------------
A0A2S8G191      INAPSDISKNLRINVLGAIPF--V------------------------------------
A0A2E7EGG1      VTSSEQLQVDNNLPVVGEIAC--L------------------------------------
A0A2E2N5A9      FTTTEDIENKLNIPVLGIVPL--V------------------------------------
A0A7C8AGA2      LHDPKDVVRRVGVRIIGTTTS--P------------------------------------
A0A7C2FXP7      LTCPDDIVKRVGVKIIGTTTC--T------------------------------------
A0A1P8WP26      FRAPEELKLQLDTQILTMVPA--L------------------------------------
A0A3L7V1F3      FRTPEELKLQLDTQVLSMIPR--M------------------------------------
A0A2E3GWC6      IKSLADVRSLFEAPILGTLPS--V------------------------------------
F0SLB0          IKSLADVRSLFEAPILGTLPS--V------------------------------------
A0A3L7NDH9      IRSPEDLQTFAGLSLLTMMGS--L------------------------------------
A0A7X8IIB9      VHTPEDIARRVGVRIIGTTTG--P------------------------------------
A0A532UD06      LRSCEEISSVLHIPVLGVIPE--I------------------SEGQRSTITRGREIWLKL
A0A660URN1      LRSADEISAVLGLPVLGVVPT--I------------------LPEQNIAIHSGKALL---
A0A517ZCB5      FRSPDQLRSELGLPILAMIRK--L------------------------------------
A0A225EH48      VDSVDQVVNELGLRVIGTIPA--F------------------------------------
A0A518INW8      FRDPSDLQHSLNASVIAHVPR--F------------------------------------
A0A518JPH9      FRDPSDLERSLNANVIAHVPR--F------------------------------------
A0A5C5VEK8      LKSVDEIQEVLQLQVFGAMKR--Q------------------------------------
A0A532UTJ0      LRTPDDVAKRIGIRIIGTTTS--L------------------------------------
A0A2E2CCW9      MKSVDEIRNQLHLPILGEVPC--F------------------------------------
A0A3C0AGX3      MKSVDEIRNQLHLPILGEVPC--F------------------------------------
A0A518AAQ5      IRTVDEIRNQLHLPMLGEVPQ--F------------------------------------
A0A517QBG9      IKTVDEIRNQLHLPMLGEVPQ--F------------------------------------
A0A518FTU3      IKTVDEIRNQLHLPMLGEVPQ--F------------------------------------
A0A517WHH5      MKSVDEIRNQLHLPMLGEVPQ--F------------------------------------
A0A5A8BGT3      MKSVDEIRNQLHLPMLGEVPQ--F------------------------------------
A0A2E7K7A9      MKSVDEIRNQLHLPMLGEVPQ--F------------------------------------
A0A517PTS5      MKSVDEIRNQLHLPMLGEVPQ--F------------------------------------
A0A6I6AH34      MKSVDEIRNQLHLPMLGEVPQ--F------------------------------------
A0A517VTK3      LKSVDEIRNQLHLPVLGEVPT--F------------------------------------
A0A517WQT4      LKSVDEIRNQLHLPVLGEVPT--F------------------------------------
A0A517VID8      MKSVNEIRNQLHLPVLGEVPS--F------------------------------------
A0A517RK10      VKSVDEIRNQFHLPILGEVPA--F------------------------------------
A0A518IH18      VKSVDEIRDQLHLPILGEVPT--F------------------------------------
A0A7W0M4Y4      FRSPEDIRDELGLSVVGHVPV--I------------------------------------
A0A2D5NDU9      VRTAEELQRRLPVPILASMPQ--T------------------------------------
A0A5C5XLF4      LKSLADLRAIVDTPILGTLPS--I------------------------------------
A0A518CHE5      FRSPDEIKYHLNLPVLAMVRK--M------------------------------------
A0A1V5N3W2      LYTPEDLARTVGVAVVGTTSQ--L------------------------------------
A0A517NSK8      FADPEDVEKTLGAPVLAHVNR--F------------------------------------
A0A5C5Z0D6      FVDPDDVQHTLGAPVLAHVPR--F------------------------------------
A0A7W5H7D9      FVDPDDVQRTLGAPVLAHVPR--F------------------------------------
M5UE94          FVDPDDVQATLGAPVLAHVPR--F------------------------------------
A0A3E0MY27      LSSAHDMTEGLGMTVMGDVPL--L------------------------------------
A0A7V4M591      FRSLDEMQNRMGVPVLAMVQQ--M------------------------------------
A0A7X7F3G7      FRDIDDMQQQLGVPVLSLIRR--L------------------------------------
A0A7Y4VQ32      VRESRDVRSALRIPLLGQLPR--L------------------------------------
A0A2E0X9P6      IATADDLERETALNLLGEVTR--F------------------------------------
A0A1N6DAJ8      VDSAADVIKSLGMNLFGTLPS--L------------------------------------
A0A2E8FLY0      FRSPDELQLQTNLSVLAMVGE--L------------------------------------
A0A3D2U1E1      FRSPEELQVQAGLPVLAIVGE--L------------------------------------
E8R3W3          VDNLNVLGASMGMNVIGAIPT--L------------------------------------
A0A5C5ZM48      VCDVRSLEAHANAPVLCEIAR--L------------------------------------
A0A5B9WF77      VVNPDSLSSRVQSEVYALPPI--P------------------------------------
A0A7C4Z5R7      ITSPEEVLQGVGMNVVGNVPL--V------------------------------------
A0A1P8WN28      LRSPEEVRDELGLNVLGIIRK--L------------------------------------
A0A3B9CTT0      LRTPEDVQDELGLPVLGIIRR--L------------------------------------
A0A518ALT3      VCNADELANETQLPLLGEVAC--L------------------------------------
A0A286RGB6      VNTAHELPHAVGVDVWGTIPL--V------------------------------------
A0A7V3TZQ6      VNTAHELPHAVGVDVWGTIPL--V------------------------------------
A0A3M1QRP3      EGLHDRTVSQAG-PLLGPLPL--V------------------------------------
A0A517TMV0      FGSPEEMAHQLGCRVLSVVRE--L------------------------------------
A0A3E0MY88      FRSPEDVTMRLGAPTLAMVAQ--L------------------------------------
A0A518BBX8      FRTSQEIQRRLGLPIVGLIPF--I------------------AAP---------------
A0A5B9QF68      FSSPEELTAQLGVPVLAMVRN--L------------------------------------
A0A5B9QGF0      FSSPEELTSQLGVPVLAMVRN--L------------------------------------
A0A5C6CK24      FSSPEELTAQLGVPVLAMVRN--L------------------------------------
A0A7C5FXU1      VNTSEELSQNLGVEVLARIPY--V------------------------------------
A0A847YFA1      VNTSAEVAKDAGVEILGTVPL--L------------------------------------
A0A1C3E6N1      FRSPEETSLQLGAPVLSFIPT--L------------------------------------
A0A518GJT2      FRSPEETSLQLGAPVLSFIPT--L------------------------------------
A0A2E8B0L9      FRSPDELRDQLGVPVLAMVRR--L------------------------------------
A0A5Q4GFE7      FRSPEELQQQLGAPVLAMIRE--L------------------------------------
A0A257WS34      FKSPDELQAQLGLPVLAMIRQ--M------------------------------------
A0A7C4LP10      FKSPDELKWLLGLPVLAMIRQ--I------------------------------------
A0A2E3RCU8      FRTPDEMSKRVGYPIISLVRA--L------------------------------------
A0A517MLW3      FASLEEAERQTRTEILAVVEK--L------------------------------------
A0A5B9QVD0      FASLDDIERQTQTEILAVVEK--L------------------------------------
A0A3A0DET7      LKSVDEISEVVQLPVFGVVPQ--S------------------------------------
A0A3B8PNV4      FRSPEELRLQLDVPVLALVGE--M------------------------------------
A0A3D1DR40      FRSPEELRLQLDVPVLALVGE--M------------------------------------
A0A2E7RYU8      FRSPEELRLQLDVPVLALVGE--M------------------------------------
A0A3B8LXG8      FRSPEELRLQLDVPVLALVGE--M------------------------------------
A0A6M5Z0K7      IHSPADVSKGLRLRVIGALPK--L------------------------------------
A0A350CI62      FRTPEELKLHLETQVLSMIPR--M------------------------------------
A0A4P5WQK6      FRTPEELKLHLETQVLSMIPR--M------------------------------------
A0A3C1X4W5      FRTPEELKLHLDTQVLSMIPR--M------------------------------------
A0A3D3W3A7      FRTPEELKLHLDTQVLSMIPR--M------------------------------------
A0A7Y5SKC2      FRSVEELQAILGVPALAMVQQ--L------------------------------------
A0A7X7U104      LRSAEEISALLALPVVGAVPT--I------------------------------------
F0SI78          FRSPEEMMQMLGVPILGHIPE--M------------------------------------
A0A517MDV3      FRSTKEIESAVGAPMLGAVGT--M------------------KFR---------------
A0A518IQ30      FQSPDELEEQVGVSVIAMIQS--L------------------------------------
A0A517LWP4      FQSPDELQEQVGVSVIAMIQS--L------------------------------------
A0A518JNW8      FQSPDELQEQVGVSVIAMIQS--L------------------------------------
A0A2E3GWX1      FHSPDELKSQLGAPVLAMVRE--L------------------------------------
F0SG60          FHSPDELKSQLGAPVLAMVRE--L------------------------------------
A0A2E9VST2      FHSPDELKRELGAPVMAMVRS--L------------------------------------
A0A356A6X2      FHSPDELKRELGAPVMAMVRS--L------------------------------------
A0A5C5XLM3      FHSPDELKRELGAPVMAMVRS--L------------------------------------
A0A7V2UW16      IDAPDEAERVIGAPLLGVVPH--I------------------GDD---------------
A0A518DRX3      FRSPEEMVEQLGAKLLAAIRP--L------------------------------------
A0A518DZF9      FRSPEEMVEQLGAKLLAAIRP--L------------------------------------
A0A2E7ENQ5      FRSVDELKDQLNVAVLAIVRQ--L------------------------------------
A0A7V2XSV8      IDSPEEAERVVGRALLGVIPH--V------------------------------------
A0A847GXG1      FRSPEELQEQLRVPVLSMIRR--L------------------------------------
A0A7C5BZF0      FRSIEELQLLTGTPVLATVRD--L------------------------------------
A0A847YGH5      FRSVEEIQWQLKTPVLAVVRE--M------------------------------------
A0A286RLF2      FRSVEEIQWQLRAPVLSIIRE--M------------------------------------
A0A7V3TX18      FRSVEEIQWQLRAPVLSIIRE--M------------------------------------
A0A1G3AQE9      FRSREEMQSVLGVPALAIVQE--L------------------------------------
A0A3L7UQT9      FRSPDELRMQLGVPVLAMVRA--M------------------------------------
A0A4P5YBU2      FRSPDELRMQLGVPVLAMVRA--M------------------------------------
A0A7C7V5U8      FRSAEEMQAQLRAPVLAMVRQ--L------------------------------------
A0A3M1VCL4      FRSPEELQLQLGAPVLAIVRK--L------------------------------------
A0A518AKT8      FNSPEELTAQLGVPVLTLVQR--L------------------------------------
A0A5C5ZR72      VTDSDQIYQDTNLRILGEISS--F------------------------------------
A0A7Y5SJZ4      FRSLEDMESQLRVPVMAVVGK--L------------------------------------
A0A5C5V7Z9      FTSPDEMSAQLELPVLSVVRT--L------------------------------------
A0A5C5YT05      FASPDEMSQQLELPVLSVVRT--L------------------------------------
A0A518D7F9      FGSPEEMSRELGLPILSIVRQ--L------------------------------------
A0A5C5ZIP0      YGSPDEMALQLGCQVLALVRQ--L------------------------------------
A0A518KBK3      FGSPEEMAMQLGCRVLAVIRE--L------------------------------------
A0A5C6AKF9      FGSPEEMALQLGCPVLAVVRD--L------------------------------------
A0A7C2KUQ9      VQGVSDLKGPFETPFLGCVPL--L------------------------------------
A0A7C5R0U3      FRTPDQIEEQLQLPLLSVIGQ--L------------------------------------
A0A847YCQ7      VSSTAQLAYGLGLPVIGDLPL--L------------------------------------
A0A286RD13      VSSAYQISYGLGLPVLGDLPL--I------------------------------------
A0A7V3TUJ6      VSSAYQISYGLGLPVLGDLPL--I------------------------------------
A0A517TY85      ISSTDQLTKESLLPVIGEVAR--F------------------------------------
A0A5B9QEI7      ISTPEQLTNESSLPLLGEVAQ--F------------------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ---------------------------------------------------SK-------
A0A1G3B0P0      ---------------------------------------------------SK-------
A0A1E3X4X0      ---------------------------------------------------DKQKRRSEQ
A0A286U4B3      ---------------------------------------------------ER-------
A0A5C6DDS2      ---------------------------------------------------DK-------
A0A5S9IJB5      ------------------------------------------------------------
A0A2E3GW02      --------------------------------------------------------SQKR
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1U7CZ81      --------------------------------------------------------VRAS
A0A142YNY8      --------------------------------------------------------SRSP
A0A1U7GLS6      --------------------------------------------------------ARSP
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A517NFU9      --------------------------------------------------------NLRK
A0A5C5YWH4      --------------------------------------------------------NTRD
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      APVAAQDAEQAATETRDAVEGDRRTPSELESVRWVQRMSKKAGRSARGTTVGGASWDKSK
A0A6I0ENW6      --------------------------------------------------------APGT
A0A6L3A0B7      --------------------------------------------------------APGT
A0A0J1B4A0      --------------------------------------------------------KESA
A0A142WSB9      --------------------------------------------------------QKRN
M5SZR3          --------------------------------------------------------SAKP
M5TW92          --------------------------------------------------------SAKP
A0A2S8FKY2      --------------------------------------------------------PRGI
A0A517N8P6      --------------------------------------------------------LTPS
A0A432MJP4      --------------------------------------------------------SKA-
M5UQ35          --------------------------------------------------------KTSK
A0A0S8FY64      --------------------------------------------------------HSDG
A0A1N6KFT7      --------------------------------------------------------LVDQ
L0DFG4          --------------------------------------------------------RSDQ
A0A5C5XXG1      --------------------------------------------------------NSMR
A0A7C7YUM8      --------------------------------------------------------ERGR
A0A7C2AHI6      --------------------------------------------------------RRGR
A0A518BJJ1      --------------------------------------------------------KHGK
A0A518D182      --------------------------------------------------------KDGG
A0A7V4HWU2      --------------------------------------------------------RKGK
A0A5C5WTY6      --------------------------------------------------------S---
A0A5C5Y033      --------------------------------------------------------S---
A0A5C6G1Y2      --------------------------------------------------------S---
A0A354PDV6      --------------------------------------------------------N---
A0A5C6FZ02      --------------------------------------------------------N---
M5TIT3          --------------------------------------------------------N---
A0A5M6CY44      --------------------------------------------------------M---
F2AXG2          --------------------------------------------------------N---
M2BB46          --------------------------------------------------------N---
L7CLQ6          --------------------------------------------------------N---
A0A0J1B719      --------------------------------------------------------N---
Q7UF18          --------------------------------------------------------N---
A0A2G1W1E0      --------------------------------------------------------N---
K5E235          --------------------------------------------------------N---
A0A5C6FFI9      --------------------------------------------------------NLRK
A0A5C5WDJ1      --------------------------------------------------------ALRD
A0A5C5X547      --------------------------------------------------------PMKQ
A0A353FIP5      --------------------------------------------------------RHGA
A0A7V7MJI7      --------------------------------------------------------RKGA
A0A5B1CIK7      ------------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      ------------------------------------------------------------
A0A5C5ZZN3      ------------------------------------------------------------
A0A5C5XS91      ------------------------------------------------------------
A0A5C6C4E6      ------------------------------------------------------------
A0A2E1VVJ1      --------------------------------------------------------RRGL
A0A3M2AEL0      --------------------------------------------------------RRGG
A0A2A2W9R6      --------------------------------------------------------RESR
A0A518HKC1      --------------------------------------------------------RESK
A0A518L3P0      --------------------------------------------------------PESK
A0A255R1S0      --------------------------------------------------------VESK
A0A5B9MKP1      --------------------------------------------------------RESK
A0A351FYP6      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A7V9G2R2      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A7X7U1J4      ------------------------------------------------------------
A0A7V8E5N8      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A7Y5LV28      ------------------------------------------------------------
A0A7Y5HFQ5      ------------------------------------------------------------
A0A7W1FMQ9      ------------------------------------------------------------
A0A7W1NA62      ------------------------------------------------------------
A0A7V9JTP9      ------------------------------------------------------------
A0A7W1FJ38      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7V2H881      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A7X7U4K9      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A838QZ11      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A7V2UF66      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A7X8IIB9      ------------------------------------------------------------
A0A532UD06      KSIFADISRTAYSRTVPGEPKGKAKPGAQPIMAQVRAYRALRATGTKAQPFAVGASSPNK
A0A660URN1      ----------------------KFKSGASRIWRTIQAGISSDAAGVETKTVSAVPRSED-
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A7W0M4Y4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
A0A7W5H7D9      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A3E0MY27      -----------------------------SERPW--------------------------
A0A7V4M591      ------------------------------------------------------------
A0A7X7F3G7      ------------------------------------------------------------
A0A7Y4VQ32      -----------------------------RDA----------------------------
A0A2E0X9P6      -----------------------------PMR----------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A2E8FLY0      -----------------------------PA-----------------------------
A0A3D2U1E1      -----------------------------PPG----------------------------
E8R3W3          -----------------------------PRQ----------------------------
A0A5C5ZM48      -----------------------------PSR----------------------------
A0A5B9WF77      -----------------------------RQR----------------------------
A0A7C4Z5R7      -----------------------------PEV----------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      -----------------------------PVR----------------------------
A0A286RGB6      ------------------------------------------------------------
A0A7V3TZQ6      ------------------------------------------------------------
A0A3M1QRP3      -----------------------------RDP----------------------------
A0A517TMV0      -----------------------------QPL----------------------------
A0A3E0MY88      -----------------------------DMT----------------------------
A0A518BBX8      ----------------------KTKGSGEDAQ----------------------------
A0A5B9QF68      -----------------------------TPL----------------------------
A0A5B9QGF0      -----------------------------TPL----------------------------
A0A5C6CK24      -----------------------------SPL----------------------------
A0A7C5FXU1      -----------------------------PAR----------------------------
A0A847YFA1      -----------------------------PRR----------------------------
A0A1C3E6N1      -----------------------------PTY----------------------------
A0A518GJT2      -----------------------------PTY----------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      -----------------------------PQP----------------------------
A0A7C4LP10      -----------------------------RET----------------------------
A0A2E3RCU8      -----------------------------PEL----------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A3B8PNV4      -----------------------------PVT----------------------------
A0A3D1DR40      -----------------------------PVT----------------------------
A0A2E7RYU8      -----------------------------PVT----------------------------
A0A3B8LXG8      -----------------------------PVT----------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      -----------------------------TEL----------------------------
A0A4P5WQK6      -----------------------------TEL----------------------------
A0A3C1X4W5      -----------------------------SEL----------------------------
A0A3D3W3A7      -----------------------------SEL----------------------------
A0A7Y5SKC2      -----------------------------PAS----------------------------
A0A7X7U104      -----------------------------NVP----------------------------
F0SI78          -----------------------------PAS----------------------------
A0A517MDV3      ----------------------RHRGMDKTLS----------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E3GWX1      -----------------------------PML----------------------------
F0SG60          -----------------------------PML----------------------------
A0A2E9VST2      -----------------------------PAL----------------------------
A0A356A6X2      -----------------------------PTL----------------------------
A0A5C5XLM3      -----------------------------PSL----------------------------
A0A7V2UW16      ----------------------AKRYGRETGTGERDAPEGGRPGPASAGLAGTGSRIMKA
A0A518DRX3      -----------------------------SLT----------------------------
A0A518DZF9      -----------------------------SLT----------------------------
A0A2E7ENQ5      -----------------------------SPT----------------------------
A0A7V2XSV8      -----------------------------SANGRKEAGRAGRREAAAGAVADAGPGAATG
A0A847GXG1      -----------------------------SLA----------------------------
A0A7C5BZF0      -----------------------------SIP----------------------------
A0A847YGH5      -----------------------------TPR----------------------------
A0A286RLF2      -----------------------------PPR----------------------------
A0A7V3TX18      -----------------------------PPR----------------------------
A0A1G3AQE9      -----------------------------KMN----------------------------
A0A3L7UQT9      -----------------------------EPT----------------------------
A0A4P5YBU2      -----------------------------EPT----------------------------
A0A7C7V5U8      -----------------------------APA----------------------------
A0A3M1VCL4      -----------------------------QQL----------------------------
A0A518AKT8      -----------------------------EPL----------------------------
A0A5C5ZR72      -----------------------------PKR----------------------------
A0A7Y5SJZ4      -----------------------------EKL----------------------------
A0A5C5V7Z9      -----------------------------NPL----------------------------
A0A5C5YT05      -----------------------------NPL----------------------------
A0A518D7F9      -----------------------------NPT----------------------------
A0A5C5ZIP0      -----------------------------QPI----------------------------
A0A518KBK3      -----------------------------PLR----------------------------
A0A5C6AKF9      -----------------------------PAR----------------------------
A0A7C2KUQ9      -----------------------------RD-----------------------------
A0A7C5R0U3      -----------------------------AAT----------------------------
A0A847YCQ7      -----------------------------RRR----------------------------
A0A286RD13      -----------------------------ERP----------------------------
A0A7V3TUJ6      -----------------------------ERP----------------------------
A0A517TY85      -----------------------------PRR----------------------------
A0A5B9QEI7      -----------------------------PRQ----------------------------
                                                                            

A0A5S9IPR9      ---------SPKIFMGKTTHVVEEKENTNVAEAFRAI-----STS----I--FF-AEEQT
A0A533Q9U4      ----------DKKDTDFTELIAHSSPKHSITEALKGI-----RTS----I--IF-SHPDK
A0A533Q6B7      --------PQKKKDARTMQLITYNLPKYPITESIKRI-----RTS----I--MF-SHPDN
A0A1U9NNE1      -----------------PTEVKRSELSERLADDYRTI-----RAN-------IS-MLEEE
A0A2G2JCA2      ----------PKRRTMSPGNSTVSTSLRMYEESIDSL-----RTN----I--ML-PNNSD
A0A1G2XVR0      -----------ENKDANLELLTSEAPKSVFSETIRNI-----RTG----I--ML-STTDT
A0A1G3B0P0      -----------ENKDANLELLTSEAPKSVFSETIRNI-----RTG----I--ML-STTDT
A0A1E3X4X0      PTPASGLGGIADDNVFVPELFVHRKSKSNIAEAIRNI-----RTN----I--IF-TATDT
A0A286U4B3      ------------DEVENFDTILHELPKSTFAEAVRNV-----RTG----I--ML-SSADN
A0A5C6DDS2      ------------DEVQNFDLISHELPMSTFAEAVRNV-----RTG----I--ML-SSTDN
A0A5S9IJB5      ---------GKKNKKSQYPEVLALSTRSPVAESFRSL-----RTT----L--SF-SIEKN
A0A2E3GW02      RKRNKSGDTVPIDP----TLVNYHRPNSRIAEAYRLI-----RGT----L--LL-TMGGE
A0A5B9QNZ7      ------RRNKQLSRLISPELVVYHRPESPQAEAYRHL-----RTA----L--MF-SPGGK
A0A1Z8N7H5      ---------PELSGEGLKKVSAFSDPVSVFVESFRTL-----RTS----L-----TLSGV
A0A1U7CZ81      NKLNGPAEDDQIDR---------------FIQRLDHL-----RFA----V--CGDHPEVG
A0A142YNY8      RRLGAPGDDDQIER---------------FIQRLDHL-----RFA----V--CGDHPEVG
A0A1U7GLS6      RRLGAPGEDDQIDR---------------FIQRLDHL-----RFA----V--CGDHPDVG
A0A1G2YPI3      ------SRRESVTDRGRKTYLD---SKSNWAEAYRTI-----RTA----V--FF-GAPKD
A0A532UIN2      ------PRRLSIADRGQKVHKD---SDSPVAEAYRTI-----RTA----V--FF-GAPKN
A0A0S8KNX5      ------------------HTVKPALLPERIIGDYQTI-----RAN----L--GL-LGGEG
A0A3D3UVZ8      ------------------NTVKPALLPEQIVGDYQTI-----RAN----L--KL-LGGRG
A0A517NFU9      LRKLL-NKDSGVQP----SLVCSYAPRSTESEVYRVA-----RTA----L--MV-TNRKD
A0A5C5YWH4      LKSKT-RSGSLIQP----SLVTFHAPRSAESEVYRVA-----RTS----L--MV-ANRKT
A0A3D2TNK4      ---------DALNGENLETIHTHACPNAPETEAFRTL-----RTV----L-----SLSEQ
A0A7C1Y4F0      TPVASAAEKPDIVRRGQKVHLE---SKSVVAEAYRTI-----RTA----V--FF-GAPKE
A0A6I0ENW6      DALSD--------------------TSPMLQESIRMI-----RTA----L--LE-RCSVR
A0A6L3A0B7      DALSD--------------------TSPMLQESIRMI-----RTA----L--LE-RCSVR
A0A0J1B4A0      LKKKV-KEGSGISA----MIPTFHLPRGTEAETFRVL-----RTS----L--LF-LTKSQ
A0A142WSB9      QNSA--MAHTGISP----QVVYLHHPGSRESEAYRSL-----RTT----L--FF-STRET
M5SZR3          QLDPE-EMDDSLDR----SLCTYFRPISVESESYRAL-----RTT----L--FF-HNRSR
M5TW92          QLDPE-EMDDSLDR----SLCTYFRPISVESESYRAL-----RTT----L--FF-HNRSR
A0A2S8FKY2      VRKPK-ALSHNLGPYEDQVRDS---SDSVAATVLR--------------------RSLSE
A0A517N8P6      KRQLKKSSGNDLFPHTDQIVTVLHHPHAPCSEAVRSV-----RTS----L--FPVAGAPP
A0A432MJP4      ------ELAETTEP----GLVVHQRPGSLTAEAYRAL-----RTG----L--EF-VRRER
M5UQ35          LKRHV-RPGSVVSP----MIVAFHAPRSSEAETFRVL-----RTG----I--IF-RCKSE
A0A0S8FY64      SREGLVSLAQHAIQ----HATD---SS---TEAFRSI-----RTN----I--YF-SGQRG
A0A1N6KFT7      LTLMG----EVGLV----SHAM---PRSVWAEAYRSV-----RTS----L--EF-LRRSR
L0DFG4          ISLMG----EIGLV----SHAM---PRSVWAEAYRSV-----RTS----L--EF-LRRSR
A0A5C5XXG1      RGVRG-------------LIAG---ELSPNAEALRLG-----RTM----L--LPKIKSRD
A0A7C7YUM8      TRIKGLNRGQRSLP----MRDA---PGGPQAEAYRSI-----RAS----L--RQALDGDG
A0A7C2AHI6      LRVRG--AGDGYLA----MLSN---PGSPVGEAYRSI-----RSN----L--KFALEPDS
A0A518BJJ1      HRVAK--ATTDFIA----LRDD---PHGVVAEAYRSL-----RAN----L--RFAVGDVN
A0A518D182      -RVAT--RTKDFVA----MRDD---PSGPVAEAYRSL-----RAS----L--RFAVGDLG
A0A7V4HWU2      RIVPEAAANSPLAP----TLCVAHQPKGRQAEAYRAV-----RTA----L--YF-STHSE
A0A5C5WTY6      ------GIELSTSP----KATG---NAKGSRETFRLT-----RTI----L--AQ-SIQSR
A0A5C5Y033      ------AIDQGIAG----LVAT---DGSSESEAFRLG-----RTI----L--LP-DIKSK
A0A5C6G1Y2      ------AIDQGIAG----LVAT---DGSSESEAFRLG-----RTI----L--LP-DIKSK
A0A354PDV6      ------SMRQGVKG----LIAT---ELTPDAEAIRMM-----RTL----L--LM-DVKSK
A0A5C6FZ02      ------SMRRGVRG----LIAG---ELSPNAEALRLG-----RTM----L--LP-KIKSR
M5TIT3          ------SINQGVAG----LIAT---ELSPNAEAFRLG-----RTV----L--LP-EIRSG
A0A5M6CY44      ------SINQGVNG----LISA---ELSPDAEAFRLG-----RTM----M--LM-DIKAG
F2AXG2          ------SINQGIKG----LIAT---ELSPDAEAFRLG-----RTV----L--LP-DIRSG
M2BB46          ------SINQGIKG----LIAT---ELSPDAEAFRLG-----RTV----L--LP-DVRNG
L7CLQ6          ------SINQGIKG----LIAT---ELSPDAEAFRLG-----RTV----L--LP-DIRKE
A0A0J1B719      ------SINQGIKG----LIAT---ELSPDAEAFRLG-----RTV----L--LP-DIRSG
Q7UF18          ------SINQGIKG----LIAT---ELSPDAEAFRLG-----RTV----L--LP-DVRNG
A0A2G1W1E0      ------SINQGIKG----LIAT---ELSPDAEAFRLG-----RTM----L--LP-DIRNG
K5E235          ------SINQGIKG----LIAT---ELSPDAEAFRLG-----RTM----L--LP-DIRNG
A0A5C6FFI9      LPIPS-PDQTPLAP----SLVTAHCPRSAEAEVYRVA-----RTS----L--MI-RADGS
A0A5C5WDJ1      LRKAA-NVKSMLDP----SLMTFHSPRSPEAEIFRVG-----RTS----M--MI-ANRKG
A0A5C5X547      LSGKNGKDDKKDSK----LQRA-------LSESVRGI-----VAQ----L--IR-RKASE
A0A353FIP5      NKIEAAKGKEHFLA----LLDA---PDSRVAEAYRGL-----RAN----L--TF-AAKRN
A0A7V7MJI7      TRIRGLNKRRHFLA----LRDA---PDSAAAESYRVL-----RAN----L--RF-AAQGQ
A0A5B1CIK7      ----N-SIRDGISG----LIAV---ENSPNAEAFRLG-----RTV----L--LP-EVRSG
A0A5C5WHS2      ----N-SIREGISG----LIAA---ENSPNAEAFRLG-----RTV----L--LP-EIRSG
A0A5C6B6G8      ----N-SIDMGIRG----LVSA---ELSPDAEAFRLG-----RTV----L--LP-EIRSG
A0A5C5ZZN3      ----N-SVKQGVTG----LIAT---ELSPDAEAFRLG-----RTV----L--LP-DIRSG
A0A5C5XS91      ----E-SIKKGVSG----LIAT---GESPDAEAFRLG-----RTM----L--LP-EIRSG
A0A5C6C4E6      ----N-SMKKGVAG----LIAT---GESPDAEAFRLG-----RTM----L--LP-EIRSG
A0A2E1VVJ1      ARSQR-ARGKVFLA----LLHD---PESAAAEAYRSL-----RAS----L--RF-ATGGR
A0A3M2AEL0      TRSKH-SRARDYLP----LRDE---PDSPTAEAYRAL-----RAN----L--RF-LAKGQ
A0A2A2W9R6      LQKQA-IKDSEISP----MVAAFHVPRATDAETFRFV-----RTS----L--LF-LAKKQ
A0A518HKC1      LQKQA-IKDSAISP----MIAAFHVPRATDSETFRVV-----RTS----V--LF-LAKKQ
A0A518L3P0      LQKQA-IKDSDISP----MVAAFHIPRATDAETFRVI-----RTS----I--LF-LAKKQ
A0A255R1S0      LAKQA-KVGSKISP----MITTFHQPRGIDAETFRVL-----RTT----L--LF-MAKRQ
A0A5B9MKP1      LQKRV-IKGSAISP----MVASFHLPRAVDSETFRVV-----RTS----V--LF-LAKKQ
A0A351FYP6      -----------------VGSLMDEGDESPHAEAYRVL-----RTN----I--LF-AGRKS
A0A0S8J591      --------SPKFKDFATRSLISHLDSRSGPAEAFRGI-----RTE----V--ML-RSDLR
A0A532UT69      -----LGERS----GRARGQKVHLDPDSPAAEAYKTI-----RTA----I--FL-GVPNG
A0A7V9G2R2      -----PYMPALSL-ANDA------ESEPELAESYRTL-----RAA----LR-LM-LRDRI
A0A2D5AWU0      -----KGPRSRAR-TGRIVEE---QPGSSAAEAIRNL-----RTA------TTF-ALPKD
L0DC26          -----PRRSRILG-SGDAEHR---RWGSMLIESVDAA-----RTA----L--LH-VSRTE
M5RT57          -----PVRTISIG-SRQT------KAMSIFEESIDSL-----RVG----L--LL-GEKHN
D5SZ21          -----PTYDGNGL-DSVHAFV---APHESSTEAFRTL-----RTA----IQ-----FAGD
A0A7X7U1J4      -----GWPRQTPA-IRGQKVRI--NPDSREAEAFRTI-----RTA----I--YF-GAPKE
A0A7V8E5N8      -----R-----GA-GGEEVFVLGDKSSIPELESFRAV-----RAQIVTRLERLG-SPAVG
A0A356KTN1      -----------QR-EDEVELLALRESRSVYAEAFRRA-----RVQ----LNAVG-AFPSE
A0A7Y5LV28      -----EGMPEGGP-AALGE-----NSTIAEFEAFRGL-----RAE----VQ-MR-LEKLG
A0A7Y5HFQ5      -----T-----GK-GGEADVAVLQDSKSELAEAVRII-----RTG----IL-FT-PSGRA
A0A7W1FMQ9      -----RRLPALTD-ESTL------T-SGMLAEAVRHL-----RTA----LR-LA-LGSRR
A0A7W1NA62      -----AGLTALGR-GGDP------EKPHAVAEALRAV-----RAA----LM-LT-KRR-D
A0A7V9JTP9      -----ANLQPLGK-QGNP------EEPHNLAEAYRAI-----RAA----LR-LA-RRPGE
A0A7W1FJ38      -----PGLLPLGK-GGDP------DHPPVLAEAYRAL-----RAA----LR-LT-RSDPH
A0A1G2YQB7      --------------TTSKEKIKESMWPRQLADDYHAI-----CIN----L--GL-MNNCT
A0A353P687      --------------TTSRDKIKKAMWPRQLADDYHSI-----CIN----L--GL-MNNCT
A0A356EME5      -----PERSTK---AGKTTSRRMAQKLRLYEESIDSM-----RTF----L--VL-AEEIK
A0A3L7P4E4      -----QLGRRDRTNPIDPAIVTIHRPRSQSAEAFRGV-----RTY----L--MA-ATRGE
A0A3L7PEB5      -----QLGRRDRTNPIDPAIVTIHRPRSQSAEAFRGV-----RTY----L--LA-ATRGA
A0A1U9NL64      -----SKRKS----MAERGRRVALNPSSPVSEAYRTV-----RTA----V--FF-GVPKE
A0A2N1UCJ3      -----SDKGKKD--NGNKGQKVHLEPKSSIAEAYRSI-----RTS----V--FF-GVPKG
A0A7V2H881      -----QSART----PSARGTVVHTEPMSDVAEAYRTV-----RTA----I--YF-GVQPG
A0A7C4EK84      -----SAKLA----FSQRGRQVHLDPMSQVAEAYRTV-----RTA----V--LF-GLPAG
A0A7C3F0T2      -----SAKQE----LSDRGQVVELEPTSHAAETYRTI-----RTA----I--YF-GVPNG
A0A7X7U4K9      -----SRREL----PQTRGQKVHLQRNSREAEAFRTV-----RTA----I--FF-GAAKE
A0A2E0X4J3      -----PGVKN----RAEAGMMLVNAPRAAFSEAVRTL-----RTS----F--HF-GLGGP
A0A838QZ11      -----EAAGA----RSHAGQLVSQAPRSAIAEAIRTL-----RTA----L--HF-GLAGH
A0A5C5YU10      -----LGKIG----REELGKLVHLQPRSTSAEAFRTL-----RTA----V--HF-GLAGD
A0A517MPZ6      -----AGKDD----RHETGRVVLTHPRSMAAESFRTL-----RTA----I--HF-GLTRD
A0A5C6CNV7      -----SERANDRKGRSAIGTVLLTHPRSTAAEAFRTL-----RTA----I--HF-GLARD
A0A518K5H4      -----AGSRGREGDRSVGGRLVALQPRSTAAEAIRTL-----RTA----L--YF-GIG-G
A0A5C6AA28      -----TGARSREGERNIGGRIVALQPRSVAAEAIRAL-----RTS----L--HF-GLA-G
A0A2E7ESJ6      ---DPEKIPKLPGCNIEPIMCTVHKPKSPQAESYRAV-----RTA----L--YF-NSRGE
A0A2E9VK20      -ANPAKNLQAARETGLAPMLYYYHDPGSPEAEACRSV-----RAT----F--FV-RAADV
A0A3D4PJK1      -ANPAKNLQAARETGLAPMLYYYHDPGSPEAEACRSV-----RAT----F--FV-RAADV
A0A355AI52      ------EEEDFEDGIGLETVHMWNISDDAAAESFRTI-----RTV----L--VM-GTEDS
A0A354PCQ3      -----------------PSGTRSYKGRRIFEESIDSL-----RAN----L--FL-STRWK
A0A0S8GZ23      ------------------THVEKKLLLEQVAEDYQTI-----RAN----L--GL-LSNGK
A0A1I3DDV4      ----------TRSRDKRKKGRMIVDAQAPEAESFRLL-----RTY----L--LR-EVKAG
A0A7V2UF66      ---------PGSDGLVEHGRAVEKEPTSHAAESYRTV-----RTA----I--YF-GVPNG
A0A2E0SMM6      ---------EETGGYAIDAVQTHVNPNSVESEAFRTL-----RTA----I--SF-NTHES
A0A3L7SI46      ---------EALDGSGLDAIVTYAKPDSLEAESFRTL-----RSS----I--TF-STSNT
A0A5B9PJZ8      --QRVRPRKDSPFSNVAPELIALHQPSNQNCEAYRSI-----RTS----I--FF-RAQET
A0A2S8G191      ----------------PRSVLVNSSRNSKKQEYWKNLIAESVGGI----V--AR-LFRPS
A0A2E7EGG1      -----------PEKSITHELDDDIDQLGLFEESIDSL-----RTG----L--VL-SQKNE
A0A2E2N5A9      ----------QQAQGAQLARMYSEGNNPLFTETIRTI-----RTK----L--EM-ANTDH
A0A7C8AGA2      ------------------RNVDKLLLARQLADDYQAI-----RAN----L--GL-LDGDS
A0A7C2FXP7      ------------------KHVSRPLLAQQLSDDYQTI-----RAN----L--EL-LNGDD
A0A1P8WP26      ---------EQFSGEGFNSVLCHVKPNSTEAESFRGL-----RTN----L--EF-AGGDT
A0A3L7V1F3      ---------EELQGEGFAAVMCHSKPHSKEVEAFRAL-----RTS----I--EF-SPQET
A0A2E3GWC6      -TNPQKNLEMARQTGTSPMLYYYHDPASPEAESCRSV-----RAT----F--FV-RASDA
F0SLB0          -TNPQKNLEMARQTGTSPMLYYYHDPASPEAESCRSV-----RAT----F--FV-RASDA
A0A3L7NDH9      ----EDEADRDEEGSGLESTHMHKSNDDAASEGFRTL-----RTV----L--AM-NGSQS
A0A7X8IIB9      ------------------EHVSRKLLARQLVDDYQTI-----RAN----L--GL-LNGNG
A0A532UD06      DETTTEEQALEEQALVEFGQVVHFKPRSIAAEAYRTL-----RTS----I--FF-GVPKG
A0A660URN1      ----TAQGALDTKAIAERGQRVHLAPKSHVAEAYRTI-----RTA----V--FF-GVPKG
A0A517ZCB5      ---------PPLADSGLSSLYPFSKPNAVESEAFRSL-----RTT----L--EF-SNEDT
A0A225EH48      -----------------PSKSSLRSGDAGQAQNWRFVLNESVNSA----R--TM-LLHTA
A0A518INW8      -VVTRKEKKAAKQSAISPLCRTVFAPHSVESEVLTMA-----RTS----L--FV-HAGQT
A0A518JPH9      -QVTRKEKKAAKQSSLSPLCRTVFAPHSVESEVLTMA-----RTS----L--FV-HTGQT
A0A5C5VEK8      ---------MGRLGREELGKLVHLQPRSTSAEAFRTL-----RTA----V--HF-GLAGD
A0A532UTJ0      -----------------HTVKPALLPEQIVGD-YQTI-----RAN----L--GL-VGDKG
A0A2E2CCW9      ---ADSDAAVD-ESEFAPALWYYYRPASREAEAFRSL-----RTS----L--LL-KTDRS
A0A3C0AGX3      ---ADSDAAVD-ESEFAPALWYYYRPASREAEAFRSL-----RTS----L--LL-KTDRS
A0A518AAQ5      ---TETPAHVD-DSQFDSALWYYYRPASREAEAYRSL-----RTS----L--LL-KTDRS
A0A517QBG9      ---TETPAHVD-ESQFDSALWYYYRPASREAEAYRSL-----RTS----L--LL-KTDRS
A0A518FTU3      ---TEKPAHVD-ESQFDSALWYYYRPASREAEAYRSL-----RTS----L--LL-KTDRS
A0A517WHH5      ---TEEPAHMD-DSQFDSALWYYYRPASREAEAYRSL-----RTS----L--LL-KTDRT
A0A5A8BGT3      ---TEEPAHMD-DSQFDSALWYYYRPASREAEAYRSL-----RTS----L--LL-KTDRT
A0A2E7K7A9      ---TEEPAHMD-DSQFDSALWYYYRPASREAEAYRSL-----RTS----L--LL-KTERN
A0A517PTS5      ---TEEPAHMD-DSQFDSALWYYYRPASREAEAYRSL-----RTS----L--LL-KTERN
A0A6I6AH34      ---TEEPAHMD-DSQFDSALWYYYRPASREAEAYRSL-----RTS----L--LL-KTDRT
A0A517VTK3      ---DESVSIDDSECEFDRALWYYYRPSSKEAESFRSL-----RTS----L--LL-KTDQS
A0A517WQT4      ---DESVSIDDSECEFDRALWYYYRPSSKEAESFRSL-----RTS----L--LL-KTDQS
A0A517VID8      ---AESEAVVD-DSEFAPALWYYYRPASREAEAFRSL-----RTS----L--LL-KTDRS
A0A517RK10      ---AESEAAMD-DSDFDPALWYYYRPASREAEAFRSL-----RTS----L--LL-KTDRS
A0A518IH18      ---AESEAAMD-DSEFDPALWYYYRPASREAEAFRSL-----RTS----L--LL-KTDRS
A0A7W0M4Y4      -----ANKTIATGSTAAAGLCTVHLPKGQSSEAFRLV-----RTA----L--FF-GARSG
A0A2D5NDU9      ---------QAAPKETDA-PTTTWDNEHEFAEAARTL-----RTA----I--YF-GLAQI
A0A5C5XLF4      -ANPAKNLQAARETGLAPMLYYYHDPGSPEAEACRSV-----RAT----F--FV-RAADV
A0A518CHE5      ---------EETTGYAIDAVQTHVNPNSVESEAFRTL-----RTA----I--SF-SSHES
A0A1V5N3W2      -----------------N-YRDKIGLRQQLVSDYQTI-----RSN----L--RL-LSDGE
A0A517NSK8      --APIRRKRNEPAFEIDSSVYAFHRPRSPEAEIYRVI-----RTS----M--LM-SAKAK
A0A5C5Z0D6      --EPFKRKRKDPPLKIDSSIRVYHQPRSPSAEVFRVM-----RTG----L--LV-EAKAK
A0A7W5H7D9      --EPIKRKRKDAPFAIDSSVRVHHQPRTPAAEVFRVL-----RTG----L--LV-EARKN
M5UE94          --DPIKRKRKDPPFEIDSSIRVHHQPRTPAAEVFRVL-----RTG----L--LV-AARKN
A0A3E0MY27      ---------RLPGMS----GIDPISLQGMMDESVDSI-----RSL----L--LH-SASCE
A0A7V4M591      ---------AAPETVGLAAITMYADPASAESEAFRTL-----RTA----L--DL-AHPDA
A0A7X7F3G7      ---------DVPEASGLEAIQLHVAPASTESEAFRTL-----RTA----L--AL-ADREL
A0A7Y4VQ32      -------------------AALNEKPSGHMNECMRMI-----RTA----L--LD-RVPNG
A0A2E0X9P6      ----------PVASRLRSLPAWHHREMIVFAESIDSL-----RTQ----L--ML-TQGLG
A0A1N6DAJ8      ---------PQRSRGFRSGEAENVRWKSMLVESVDAA-----RTT----L--LH-VSRTE
A0A2E8FLY0      ----------ADGPGLAS-VPTFSEPNGVETEAFRTL-----RTA----L--AF-SSNPT
A0A3D2U1E1      ---------NAETKGLDA-VQTFAEPNGSENEAFRTL-----RTT----L--AF-SSEPT
E8R3W3          ---------TNSSRSISKPNDRQVVWEGMLRESINEI-----RSH----V--LH-ANMPT
A0A5C5ZM48      ---------PNSSGR--RSEYRLEQALRVFEESTNVL-----ATT----I--RW-ADGFK
A0A5B9WF77      -------------------AIGASGPDDQIDRFIQRL----DHLR----F--AV-CGEPH
A0A7C4Z5R7      -----------------A-RRNLVPPQGERNRTWHTILTESVDAT----R--TL-LLHAA
A0A1P8WN28      ---------PQHEVDQAR-IYVNDFPQTTHAECFRTL-----KTS----I--TL-SPMDT
A0A3B9CTT0      ---------PEEQLSQCK-IYLEKFAQTVQAEAFRTL-----KTA----V--TL-TAQQS
A0A518ALT3      ---------KVGTRH--QLMAPNQHDLLVYTESIDSL-----RTT----L--AL-TEGVG
A0A286RGB6      ---------PTRALQ----MLPEENGRSRRYQRWRALFSESVRKV----A--AR-IIRES
A0A7V3TZQ6      ---------PTRALQ----MLPEENGRSRRYQRWRALFSESVRKV----A--AR-IIRES
A0A3M1QRP3      -------------------RSATAEEFTVQSECVRMV-----RTA----L--LQ-RLPHD
A0A517TMV0      ---------ASHGLQ--A-VQMFAKPQATESEAFRTL-----RTA----I--TL-GAEVS
A0A3E0MY88      ---------HQTGVE--A-VHTHVDPNSPECEAFRTL-----RTA----L--SF-NPEET
A0A518BBX8      ---------IDAAID--MTLCAHLRPRSVHAEAYRGL-----RTA----L--YF-SMNAH
A0A5B9QF68      ---------PGEGME--T-VHTHTLPHAVETEAFRTL-----RTA----I--SL-SGVAC
A0A5B9QGF0      ---------PGEGMD--T-VHTYKLPHAVETEAFRTL-----RTA----I--SL-SGTSC
A0A5C6CK24      ---------PGEGME--T-VHTHKLPHSVETEAFRTL-----RTA----I--SL-SGSSC
A0A7C5FXU1      ---------ALLGPK--ASSPRARVWRGMLTESAKSL-----VAR----L--LR-ENESN
A0A847YFA1      ---------AARALA--SESGRHRHWRAVFSEAVRHV-----AAR----L--IR-SPCGE
A0A1C3E6N1      ---------DGNGLD--S-VHAFVAPHESSTEAFRTL-----RTA----I--QF-AGDDI
A0A518GJT2      ---------DGNGLD--S-VHAFVAPHESSTEAFRTL-----RTA----I--QF-AGDDI
A0A2E8B0L9      ---------TVAGNEGAESLQVHVAAGAVESEAFRTL-----RTT----L--AF-SGQDL
A0A5Q4GFE7      ---------ATPATAGLQAIQVHVSPESVESEAFRTL-----RTT----L--AF-SGSDL
A0A257WS34      ---------EGEGIQ--Q-VLTFVKPSAAEAECFRTL-----RSA----I--SF-CAGDT
A0A7C4LP10      ---------GGTGIQ--Q-VLTYARPDSAESECFRTL-----RSA----I--TF-CAGDT
A0A2E3RCU8      ---------GGKGIE--K-VSAYNDPASVFVESFRTL-----RTS----L--AL-SAAES
A0A517MLW3      ---------ETYGEYGAEAIQMHVAPSTRSSEAFRTL-----RAG----L--ML-NPAKP
A0A5B9QVD0      ---------EPHGETGPQAIQMHVDPSARVSEAFRTL-----RAG----L--ML-NPDQP
A0A3A0DET7      ---------SASADRALAGQLVLQAPRSSVAEAIRTL-----RTA----L--HF-GMAGE
A0A3B8PNV4      ---------DELGLS--S-VRMLSEPNSTDTEAFRTL-----RTA----L--SF-AGRPT
A0A3D1DR40      ---------DELGLS--S-VRMLSEPNSTDTEAFRTL-----RTA----L--SF-AGRPT
A0A2E7RYU8      ---------DEPGLS--S-VRMLSEPNSTDTEAFRTL-----RTA----L--SF-AGRPT
A0A3B8LXG8      ---------DEPGLS--S-VRMLSEPNSTDTEAFRTL-----RTA----L--SF-AGRPT
A0A6M5Z0K7      -----------------S-GAQSASLARSLAESVDAL-----RTT----L--LH-LHSAP
A0A350CI62      ---------PGEGFE--A-VMCHVRPHSREVEPFRAL-----RTS----I--EF-SPQDT
A0A4P5WQK6      ---------PGEGFE--A-VMCHVRPHSREVEPFRAL-----RTS----I--EF-SPQDT
A0A3C1X4W5      ---------PGEGFD--A-VMCHVRPHSREVEAFRAL-----RTS----I--EF-STQDT
A0A3D3W3A7      ---------PGEGFD--A-VMCHVRPHSREVEAFRAL-----RTS----I--EF-STQDT
A0A7Y5SKC2      ---------ESVGVE--T-LQIIADPEASQSEAFRTL-----RTA----L--LL-SNQDT
A0A7X7U104      ---------RGEAGA--RGQRILTHPDSREAEAFRTL-----RTA----V--FF-GVPKD
F0SI78          -QKRRKRNKSGDTVPIDPTLVNYHRPNSRIAEAYRLI-----RGT----L--LL-TMGGE
A0A517MDV3      -----------------PELVVYHRPDSSDAEAYRHL-----RTS----L--LF-RPGGK
A0A518IQ30      ---------NGSGEAGGQNLHMFTNPKSAESEAFRTL-----RTS----L--SL-QGSDF
A0A517LWP4      ---------NGSGEAGGQNLHMFTNPKSAESEAFRTL-----RTS----L--SL-QGSDF
A0A518JNW8      ---------NGSGEAGGQNLHMFTNPKSAESEAFRTL-----RTS----L--SL-QGSDF
A0A2E3GWX1      --------DVETGLE--S-IYTHTKPNSVETEAFRTL-----RTA----I--EF-ASETH
F0SG60          --------DVETGLE--S-IYTHTKPNSVETEAFRTL-----RTA----I--EF-ASETH
A0A2E9VST2      --------PHTHGLE--S-IFTYTKPNSVETEAFRTL-----RTS----I--EF-ACENH
A0A356A6X2      --------PHTHGLE--S-IFTYTKPNSVETEAFRTL-----RTS----I--EF-ACENH
A0A5C5XLM3      --------PHTHGLE--S-IFTYTKPNSVETEAFRTL-----RTS----I--EF-ACENH
A0A7V2UW16      IGLGGNGNGNGGGEP--PELVCHLDMKSRASEAFRSI-----RTA----I--QF-AGRER
A0A518DRX3      ---------ETHGAQ--A-VQVHVNPTAVESEAFRTL-----RTV----L--SF-GDLE-
A0A518DZF9      ---------ETHGAQ--A-VQVHVNPTAVESEAFRTL-----RTV----L--SF-GDLE-
A0A2E7ENQ5      ---------SATGVD--S-LQVHVAPNDVASESFRTL-----RST----L--AF-SEQG-
A0A7V2XSV8      ARGGAGGNGGGPGFS--ADLICHTDLKSHASEAFRAV-----RTA----I--HF-AGAR-
A0A847GXG1      ---------ETVGVR--A-IQVHVAPESVESEAFRTL-----RTT----L--AF-SGQD-
A0A7C5BZF0      ---------EDPGLE--V-LPAYANPNSAESEAFRTL-----RTA----L--AL-AETE-
A0A847YGH5      ---------DGGGAE--A-IEVAQDPAGPGSESFRTL-----RTA----I--AL-HDER-
A0A286RLF2      ---------EGEGVE--V-LEVVADPNSPASESFRTL-----RTA----L--AL-SDRP-
A0A7V3TX18      ---------EGEGVE--V-LEVVADPNSPASESFRTL-----RTA----L--AL-SDRP-
A0A1G3AQE9      ---------QNSGID--Q-LPTYASPNAAEVEAFRTL-----RTA----L--SL-ANQE-
A0A3L7UQT9      ---------GGTGAD--A-VLCHAKPNGVETEAFRTL-----RTA----I--SF-SDRQ-
A0A4P5YBU2      ---------GGTGAD--A-VLCHAKPNGVETEAFRTL-----RTA----I--SF-SDRQ-
A0A7C7V5U8      ---------TGSGLE--C-LQVYAHPDAAESEAFRTL-----RTA----L--SL-TDPP-
A0A3M1VCL4      ---------EGTGVA--S-VLTFAKPNGVETEAFRTL-----RLK----L--MF-SETPA
A0A518AKT8      ---------VGDGLQ--S-LHTHMCPNASDSEAFRTL-----RTS----L--SL-MTDAS
A0A5C5ZR72      ---------KVAANPQML-PRRLRREMYVFAESINAL-----RTS----L--VF-AAEPD
A0A7Y5SJZ4      ---------VGYGVE--A-LHTCVFSNSAQTEAFRTL-----RTA----V--TL-SEGGV
A0A5C5V7Z9      ---------PGVGLD--A-VHMHVDGNSVEAEAFRTL-----RTS----L--TL-RGDET
A0A5C5YT05      ---------PGTGLD--A-VHMHVDANSVEAEAFRTL-----RTS----L--TL-RGEET
A0A518D7F9      ---------GGERLE--A-VHMFRDGNSPDAEAFRTL-----RTA----L--TL-TGDVA
A0A5C5ZIP0      ---------AGSGIQ--S-VQMFAKPQAVDSEAFRTL-----RTA----I--AL-GADAP
A0A518KBK3      ---------TGVGLE--K-VQMFSQPQATESESFRTL-----RTA----I--TL-GAEVS
A0A5C6AKF9      ---------SGVGLE--K-VQMFAQPQGAESEAFRTL-----RTA----I--TL-GAAVS
A0A7C2KUQ9      -----------------P-QRPSEQEQAAQTEHVRMI-----RTA----L--L----ERI
A0A7C5R0U3      ---------PESGLDEFI-A--QQRQDSADAEAFRTL-----RTT----L--YF-TAR--
A0A847YCQ7      ---------WLPNVSR-N-GTVPVDVRAALTESVDQI-----RTT----L--L----HRA
A0A286RD13      ---------IMRWMSR-N-GHMPETMRSVLIESVDQL-----RTI----L--L----HRA
A0A7V3TUJ6      ---------ITRWISR-N-GHMAETMRSVLIESVDQL-----RTI----L--L----HRA
A0A517TY85      ---------RVGAAPV-I-AGPPSKEMFVFAESIDSL-----RTQ----L--LL-TEHLG
A0A5B9QEI7      ---------RVATTQAQI-AAPQQRQMFVYTESIDSL-----RTQ----L--ML-TEQVG
                                                                            

A0A5S9IPR9      KN---KTFVITSALAQDGKTTIFCNLALMMA-KA-GHK-VLLIDGDLRRPRLRRLFEL--
A0A533Q9U4      PK---KVILVTSSAPSEGKSLISANLAIVMA-QT-GKK-VLLIDADLRKPTMHKLFKI--
A0A533Q6B7      PK---KTLLISSAIPSEGKTLLTSNLGVVMA-QT-GKK-VLLVDADLRNPSLHKTFEL--
A0A1U9NNE1      NQ---HILAVTSSQPKDGKTTFSINFAASLA-QN-DRK-VLLIDGDLRKPDIARILNL--
A0A2G2JCA2      DI---KVIVVSSACSREGKTSVACQLAISLA-RSSGRK-TLLIDGDMRSPDIHNVFEV--
A0A1G2XVR0      PH---KSLLITSTKQGEGKSFIAANLAIAFA-QT-GKK-TLLVDTDFRKPRQHKIFGI--
A0A1G3B0P0      PH---KSLLITSTKQGEGKSFIAANLAIAFA-QT-GKK-TLLVDTDFRKPRQHKIFGI--
A0A1E3X4X0      PR---KLIMIASANPDEGKTFFVSNLATVIA-HT-GKK-VLMVDTDMRKPRLNKIFSV--
A0A286U4B3      PK---RIMLVTSTTPSEGKTFVASNLAIVIA-KT-GKK-TLIVDCDFRKPRVHKAFNI--
A0A5C6DDS2      PK---KIILVTSTTPGEGKTFVAGNLAIVIA-KT-GKK-TLIVDCDFRKPRVHKAFNI--
A0A5S9IJB5      ST-----FFVTSPVPGDGKSFCAANLSVAFT-QN-DAK-VLLIDADMRKSRQHQIWNT--
A0A2E3GW02      RA---RVIQFTSPDPGDGKSTTCSNIALATA-NS-GKR-TLVIDLDLRRPTVHKLFGL--
A0A5B9QNZ7      DL---RLLQMTSPNPGDGKTLTTVNLAASLG-QT-GKR-VLLIDCDLRRPRVGKLFSL--
A0A1Z8N7H5      DS---TRIAFTSSEPGDGKTTVIANLAVVCA-QS-GKK-TLLIDGDLRRPGLTRLLDL--
A0A1U7CZ81      LG---RCVLITSAIGGEGKTTLAAQLAARCG-HA-GHS-TLLIDADLRRGSLCSLLDI--
A0A142YNY8      LG---RCVLISSAVGGEGKTTLAAQLAARCG-HS-GHS-TLLIDADLRRGALSPLLDV--
A0A1U7GLS6      LG---RCVLISSAVGGEGKTTLAAQLAARCG-HS-GHA-TLLIDADVRRGALSPLLDV--
A0A1G2YPI3      EA---KTILVTSPMPADGKTTLASNMAIAMA-QA-GQR-VLILDADFRKPMQHRIFKL--
A0A532UIN2      QA---KTILVTSPAPADGKTTLVSNLAIAMA-QA-GQK-TLIIDGDFRKPMQQKIFNV--
A0A0S8KNX5      IP---KKLVITSPGMKEGKTTFAINLATSIA-ES-GKR-VLLVDGDLRKPDVARLLNL--
A0A3D3UVZ8      IP---KKLVVTSPGMKEGKTTFSVNLATSLS-ES-GKK-VLLIDGDLRKPDVARLLNL--
A0A517NFU9      DV---RTIMMTSPQPGDGKSTTISNLAISFA-RA-GKS-VLLIDADMRRPVIAGLFNV--
A0A5C5YWH4      NV---RTMMMTSPQPGDGKSTTISNLAVSFA-RA-GKK-VLLIDADMRRPVIAGLFGV--
A0A3D2TNK4      NC---ERILISSSEPGDGKTTISANLSVALA-QA-GHR-TLVIDADLRRPGFTTLMQL--
A0A7C1Y4F0      GA---KTILITSPAPGDGKSTLASNIAISMA-QA-GQK-TLLIDADFRKPVQHKIFEV--
A0A6I0ENW6      QG---YTVLITSPNVGTGKTTFAMLLARSLA-HV-GKR-VLLVDTDIRRSSLSQRVNA--
A0A6L3A0B7      QG---YTVLITSPNVGTGKTTFAMLLARSLA-HV-GKR-VLLVDTDIRRSSLSQRVNA--
A0A0J1B4A0      SK---KVFLLTSPSPSDGKSTTIANLAVSVA-QT-GKR-VLLIDADMRRPTVAANFGV--
A0A142WSB9      GE---KVIQVCSAEPGDGKSTTTANLAVALA-QS-GKS-VVLIDADLRRPTVHDLFAL--
M5SZR3          EQ---SVIQVTSACPGDGKSTVAGNLGVSIA-QS-GKR-VLLIDADLRKPRQHLFFGS--
M5TW92          EQ---SVIQVTSACPGDGKSTVAGNLGVSIA-QS-GKR-VLLIDADLRKPRQHLFFGS--
A0A2S8FKY2      QC---QVLLISSAMPREGKSSLTCHLAISLA-QA-GRK-VVVVDFDLRRPSMHSIFGL--
A0A517N8P6      EY---QVLQITSALPGDGKSTVAANLAASVA-RA-GKR-VLLIDADLRRPTQAKIFGV--
A0A432MJP4      DV---RVIVVCSPSPGDGKSTVTSNLAIGLA-QA-GRR-VLLIDCDLRKPSQDRIHGI--
M5UQ35          GK---RAFMITSPSPADGKSTMIVNLAASMA-QT-GKR-VLLVDADMRRPTVAASLGV--
A0A0S8FY64      EM---KTLMVTSAAPQDGKTVFAANLATTMA-QD-GKR-VLLVDADLRRPALHRAFEL--
A0A1N6KFT7      QV---QLILVTSAHSGDGKTTTASNLAISFA-MA-GRK-VLLVDGDLRKPAQHKIFRL--
L0DFG4          QV---QVILVTSSHSGDGKTTTASNLAISFA-MA-GRR-VLLVDADLRKPSQHKIFGL--
A0A5C5XXG1      -M---RSIGVTSSMQGDGKSTITANLAASFS-QV-GLS-VLVVDGDLRRPTVHRYFSV--
A0A7C7YUM8      AL---KTLACTSCFQGEGKTVTNADLAIVFA-KA-GRR-VLLVDCDLRKPQLHNIFTT--
A0A7C2AHI6      VL---RTVAVTSSAPGEGKTTTNANLAATFA-LG-GAK-VLLVDADVRRPAVHKTFGL--
A0A518BJJ1      AL---RTMAATSCAPGEGKSTTNIDIAWAFA-SG-GRR-VLLVDADMRRPSVHRYLKL--
A0A518D182      QM---RTLAVTSSAPGEGKSTTNIDLAWCLA-SP-SRR-VLLVDADLRRPSVHRYLGL--
A0A7V4HWU2      GH---KVIQITSPNPGDGKSTTAANLALAIA-DS-GKR-VVLLDADFRRPRVHKFLGL--
A0A5C5WTY6      GI---HSMGITSPTPGDGKSTMVSHLSTSFI-RS-GMR-VLLIDADLRRPTIHKLFGL--
A0A5C5Y033      KV---RSIGFTSSMQGDGKSTIVANFAQAFA-QV-GLN-VVVVDCDLRRPSQHRYLSL--
A0A5C6G1Y2      KV---RSIGFTSSMQGDGKSTIVANFAQAFA-QV-GLN-VVVVDCDLRRPSQHRYLSL--
A0A354PDV6      KL---QTIAMTSPMQGDGKSTVISNLAVSFS-QL-GMS-VLVMDCDLRRPSIHNFFSV--
A0A5C6FZ02      DM---KSIGVTSSMQGDGKSTITANLAASFS-QV-GLS-VLVVDGDLRRPTVHRYFSV--
M5TIT3          KL---RTIGFTSSMQGDGKSTVAANFAVSFS-QI-GLR-VLVIDADMRRPGVHRFFSV--
A0A5M6CY44      KL---KTIGFTSPLQGDGKSTIMSNFAVSFA-QV-NLK-VLVIDADLRRPTVHRYFSV--
F2AXG2          KV---RAIGFTSPMQGDGKSTVVSNFAVSFS-QV-GLK-VLVIDADLRRPSAHRYFSI--
M2BB46          NV---RAIGFTSPMQGDGKSTVVSNFAVSFS-QV-GLK-VLVIDADLRRPSAHRYFSI--
L7CLQ6          NV---RAIGFTSPMQGDGKSTVVSNFAVSFS-QI-GLK-VLVIDADLRRPSAHRYFSL--
A0A0J1B719      SV---RTIGFTSPMQGDGKSTVVSNFAVSFS-QV-GLK-VLVIDADLRRPSAHRYFSL--
Q7UF18          NV---RAIGFTSPMQGDGKSTVVSNFAVSFS-QV-GLK-VLVIDADLRRPSAHRYFSL--
A0A2G1W1E0      NV---RAIGFTSPMQGDGKSTVVSNFAVSFS-QV-GLK-VLVIDADLRRPSAHRYFSL--
K5E235          NV---RAIGFTSPMQGDGKSTVVSNFAVSFS-QV-GLK-VLVIDADLRRPSAHRYFSL--
A0A5C6FFI9      DT---KVLMMSSPHPGDGKSTTISNLAISFA-QA-GKR-VLLIDSDLRRPVIAGLFGV--
A0A5C5WDJ1      SV---QTIMVTSPQPGDGKSTTISNMAISFA-QT-GKK-VLLIDADMRRPVIAKLFGI--
A0A5C5X547      NQ---NCIMVSSATAGEGKTTASVEISRMLA-RS-GQK-TVLIDFDLRRPRIHEIFEV--
A0A353FIP5      EI---KSLAITSASQGEGKSTTIADLAISLA-NS-GAT-VLLVDADLRRPSIHKLFSI--
A0A7V7MJI7      EV---KTIAITSAAQSEGKSTTSADLAIALA-HG-GAK-VLLVDADLRKPVVHKMFPG--
A0A5B1CIK7      KL---RTIGFTSPMQGDGKSTVCSNFAVSFS-QI-GLR-VLVIDADLRRPSAHRYFSV--
A0A5C5WHS2      EL---RVLGFTSPMQGDGKSTVTSNFAVSFS-QI-GLK-VLVIDADLRRPSVHRYFSV--
A0A5C6B6G8      KL---QTIGFTSPMQGDGKSTVTSNFAVSFA-QL-GLK-TVVVDADLRRPSIHRYFSV--
A0A5C5ZZN3      KI---RTIGFTSPMQGDGKSTVASNFAVSFS-QI-GLR-VLLIDADLRRPSAHRFFSV--
A0A5C5XS91      AL---RTIGFTSPMQGDGKSTVVSNFAVSFS-QI-GLK-ILIIDADLRRPSAHRFFNL--
A0A5C6C4E6      AL---RTIGFTSPMQGDGKSTVVSNFALSFS-QI-GLK-VLVIDADLRRPSAHRFFNL--
A0A2E1VVJ1      EI---RTMAITSAGQGEGKSTTLADLAIALA-QG-GKK-VLLVDADLRRPVVHKYFDA--
A0A3M2AEL0      AI---KTLAITSSVQGEGKSVTTCDLAVALA-QT-GAR-VLLVDADLRRPVVHRLFGF--
A0A2A2W9R6      SK---QVFLVTSPSPSDGKSTTIANLAVSMA-QA-GKR-VLLVDADLRRPMVAKTFGI--
A0A518HKC1      SK---QVFLLTSPSPSDGKSTTIANLAVSMA-QA-GKR-VLLVDADLRRPTVAKNFGI--
A0A518L3P0      SK---QVFLITSPSPSDGKSTTIANLAVSMA-QA-GKR-VLLVDADLRRPMVSKTFGI--
A0A255R1S0      SK---KIFMITSPSPADGKSTTIANLAVSMA-QT-GKR-VLLVDADMRRPTIASRFGV--
A0A5B9MKP1      SK---QVFLLTSPSPADGKSTMVSNLAVSMA-QA-GKR-VLLVDADMRRPTIDKVFGV--
A0A351FYP6      ED--QTTFTVVSGGAGEGKTTTMFNLAVVFA-QM-GDR-ILVVDSDLRRPSMHRYFKV--
A0A0S8J591      QV---KTGMVTSTSPQEGKTTVAVNWAITLA-QA-GNK-VLLIDGDLRKPMIHRAFNM--
A0A532UT69      KA---KTILVTSPESAEGKTTMVSNLAISMA-QA-GEK-TLILDADFRNPVQHLVFDVDV
A0A7V9G2R2      GC---QRIMVTSYNEGDGKSTVASRLAVSLA-MS-GVR-VLVIDADLRSPSLREEFG---
A0A2D5AWU0      SH---GVVLVTSSVSGEGKSVTASNLAFALA-TG-GRR-TLLIDGDLRMPSLHEIYG---
L0DC26          SV---RVVMVASALGGEGKTSLSSHLATSLA-RA-GRR-TLLVDGDLRRPSAHELFD---
M5RT57          DI---QTLVVTSAVHGEGKSSISSQLAVSIGRAT-GEP-VLLIDGDLRAPDIHNIFQ---
D5SZ21          DI---RRLVITSTEPGDGKTTVSTNLAVAYA-QS-GRR-TIIIDCDMRRPGLSKTMK---
A0A7X7U1J4      KA---RTIVVTSPTAGEGKSTVIANLGIAMA-QA-GQH-VLILDADLRSPTQHRIFTL--
A0A7V8E5N8      RA---YVLSVLSPLPGEGKTTIAANLARVLA-LE-GRR-VLLFDADLRKPRLHALLK---
A0A356KTN1      GC---GVLLCVSGIPREGKTLSALNLAIASA-QA-GRR-TLLIDADMRSPRVHRILG---
A0A7Y5LV28      AG---RVLAVLSPLQGEGKTTVTVNLARVLA-MD-GKR-VLIIDADMRKPKLKGFLR---
A0A7Y5HFQ5      ER---RRILVTSAETGEGKTLLSANLAAALA-QT-GEG-TVLVDCDLRKPRVHKVFG---
A0A7W1FMQ9      EC---HIVAVCSSSPGEGKSTITTLLAASLA-AA-GSR-VLVVDGDLRQPSLHELVA---
A0A7W1NA62      GA---RCLVMTSTAGGEGKSTLSTRLAVSLA-ST-GAR-VLLIDADMRKPTLHHQLG---
A0A7V9JTP9      RT---QVLAITSCSPGEGKSTVSTRLAITLA-ST-GAK-VLLIDADMRKPTLHHHVG---
A0A7W1FJ38      GS---RVLVITSSGPGEGKSTVSTRLAIALA-AA-GAK-VLLVDADLRKPTLQKQLG---
A0A1G2YQB7      IP---NKLAITSAGPQEGKSTLAVNLAMNLA-KI-GKK-VLLIDGDLRKPDIAKYLNL--
A0A353P687      IP---NKLVISSASPREGKSTLAVNLATNLA-KI-GKK-VLLIDGDLRKPDIAKYLKL--
A0A356EME5      GA---RVLAVTSAASNEGKTSVAAQLALSLA-RASGKP-TLLIDGDMRAPDIQEVFEV--
A0A3L7P4E4      GH---RIVLLTSPEPGDGKSTMSSNLAVTLA-QT-GKS-VLLIDADMRRPTVKRLFSL--
A0A3L7PEB5      GH---SIVLLTSPEPGDGKSTMSSNLAVALA-QT-GKS-VLLIDADMRRPTVKRLFGL--
A0A1U9NL64      SC---KTILVTSPQPAEGKSTLISNLGITMA-QA-GQK-TLIVDADFRRPKQHEVFEF--
A0A2N1UCJ3      QA---RTILITSPAPSDGKTTMVSNLAIAMA-QA-GQK-TLIVDADFRKPMQHNIFGF--
A0A7V2H881      SV---RTLLITSPAPGDGKTTLASNIASAMA-QA-GNR-VILLDCDFRKPTQHRIFEL--
A0A7C4EK84      AA---RKMLVTSPTPGDGKTVCVSNLAIAMA-QA-GQR-VLLLDADFRRPSQQRVFGL--
A0A7C3F0T2      QA---RKIVVTSPEPGDGKTTLVSNLGIAMA-QA-GQR-TLIIDGDFRKPMQHRIFKV--
A0A7X7U4K9      NA---KTLLVTSPDPGDGKSTLVSNLGIAIA-QT-GQK-TLILDADLRKPMQHILFNA--
A0A2E0X4J3      DV---RAVCVTSPTAGDGKSTVASNLAIAMA-RA-GQR-TLLIDADMRKPRQHVTFGL--
A0A838QZ11      EV---KVIAVTSPLPGDGKSTIASNLAIAMA-QA-DQR-VLLIDADLRKPTQHIIFDA--
A0A5C5YU10      DC---KVLVVTSPSPGDGKSVVTSNLAIATD-QA-DRR-TLLIDADMRKPTQHTIFGV--
A0A517MPZ6      DA---KVIAITSPSPGDGKSVVASNLALTMA-QA-DQR-VLLIDADMRKPKQHEVFEI--
A0A5C6CNV7      DA---KIICVTSPSPGDGKSTVASNMAIAMA-QA-DQR-VLLIDADMRKPTQHTIFEV--
A0A518K5H4      ES---KTFVVTSPAPGDGKSTVASNLAIAMA-QA-NQR-VLLIDADMRKPTQHETFGM--
A0A5C6AA28      DA---RTYVVTSPAPGDGKSTVASNLAIAMA-QA-NQR-VLLIDADMRKPTQHEIFGV--
A0A2E7ESJ6      RH---QVIQVTSPMPGDGKSTLASNLAVTIA-QS-GKS-VLLLDADFRRPTQHEVFAM--
A0A2E9VK20      DA---HIIQFTSSEPGDGKTTTISNLAISIA-QA-GKR-VLLIDADLRKPMVHQLFGM--
A0A3D4PJK1      DA---HIIQFTSSEPGDGKTTTISNLAISIA-QA-GKR-VLLIDADLRKPMVHQLFGM--
A0A355AI52      ER-----IAVTSAEPGDGKTTISSNLAIAYQ-QA-GKR-VLIIDADMRKPGLTKLIDR--
A0A354PCQ3      DT---RSIAVVSSISGEGKSSVASQLSLSIA-KA-TGQTVLLVDADLRCPDQHRLFGL--
A0A0S8GZ23      IP---HKMVVTSSGVREGKSTFAVNLATSLA-QA-GKR-VLLIDGDLRKPDIERLLNL--
A0A1I3DDV4      NL---RTAMITSSQAKDGKSTILANLGASFA-EL-GLK-VLIIDGDMRAPTIHRFLNM--
A0A7V2UF66      HA---KSLLITSPAPGDGKTTLTSNLGIAMA-QA-GQR-TLIVDGDFRKPMQHAIFEI--
A0A2E0SMM6      RR-----LLVTSTEKSDGKTTVMANLAVAFA-QA-NKK-TLIVDTDMRRPGMTNLLEM--
A0A3L7SI46      QR-----LVMTSTEPGDGKTTTLANLSVAFA-QA-KKK-TLLIDADLRRPGMTQLLEL--
A0A5B9PJZ8      GA---KIIQMTSPTPGDGKSTTIANLAASMA-QS-GRK-VLLIDADLRKPRQHKYFGV--
A0A2S8G191      ATRQYRVVMISSALAGEGKTTLAGQIAYALA-ES-GAR-TILVDFDLRRPALDTAFDV--
A0A2E7EGG1      SI---QVVVVSSSVAGEGKSSVASQLAVSLA-RS-SGMPTLLIDGDMRSPDIHRIFKV--
A0A2E2N5A9      YS---QVIVTTSALPGEGKSTLSANLAHALA-QL-GK--VILIDADLRKPTLAKNFGR--
A0A7C8AGA2      AS---KIIVVTSPGIGDGKTTFSVNLATSFA-QS-GEK-VLLIDGDLRKPDIAEVLNL--
A0A7C2FXP7      LT---RIIAVTSPGMGEGKTTFALNLATSFA-QK-GEK-VLLIDGDLRKPGIAQTLNI--
A0A1P8WP26      GR-----IVCTSTEPGDGKTTISSNMAVAFA-QS-GRR-TLIIDADMRRPGLSTLLDL--
A0A3L7V1F3      NR-----LVCTSTEPGDGKTTVSSNLAVAFA-QS-GKR-TLIIDADMRRPGLSTLLGL--
A0A2E3GWC6      GA---RIIQFSSPEPGDGKTTTISNLAISMA-QA-GKK-VLLIDADLRRPMVHRLFGL--
F0SLB0          GA---RVIQFSSPEPGDGKTTTISNLAISMA-QA-GKK-VLLIDADLRRPMVHRLFGL--
A0A3L7NDH9      QR-----IAISSSEPGDGKTTASTNLAVAYS-QA-GKR-VLLIDADMRKPGLTKLVGF--
A0A7X8IIB9      SI---KMLVITSPGMGDGKSTLAVNLATSFA-NS-GRK-TLLIDGDLRKPDVAAMLQI--
A0A532UD06      GA---KTILVTSPAPGDGKTTLVSNLAIATA-QA-GQG-TLVIDADLRKPRQHRIFEI--
A0A660URN1      QA---KTIVITSPAPGDGKSTLASNLALTMA-QA-GQR-TLVLDADFRKPVQHKIFEI--
A0A517ZCB5      KC-----MTISSTEPGDGKTTVMASLGVAFA-QS-GRR-TILIDGDMRRPGLTRLFNL--
A0A225EH48      KTQNMQVLMVTSAMQGEGKTSLASQLATSMA-TA-GLR-TLVLDCDLRNPSLHKLFDS--
A0A518INW8      ND---NVIQVTSPMPGDGKSTMTVNLAAAIA-KA-GKR-VLLIDADLRRPTLYKLLGT--
A0A518JPH9      DE---NVIQVTSPMPGDGKSTMTVNVAAAIA-KA-GKR-VLLIDADLRRPTLYKLLGI--
A0A5C5VEK8      DC---KVLVVTSPSPGDGKSVIASNLAIATD-QA-DRR-VLLIDADMRKPTQHSIFGV--
A0A532UTJ0      IP---RKLVITSPGMKEGKTTFAVNLATSMA-ES-GKK-VLLIDGDLRKPDVARLLNL--
A0A2E2CCW9      GA---KVLQMTSAEPGDGKTTSISNLALAIA-QT-GRK-VLIVDADLRRPTIHKLFGL--
A0A3C0AGX3      GA---KVLQMTSAEPGDGKTTSISNLALAIA-QT-GRK-VLIVDADLRRPTIHKLFGL--
A0A518AAQ5      GA---KVLQVTSAEPGDGKTTSVSNLAMAIA-QT-GRK-VLIIDADLRRPTVHKLFGI--
A0A517QBG9      GA---KVLQVTSAEPGDGKTTSVSNLAMAIA-QT-GRK-VLIIDADLRRPTVHKLFGI--
A0A518FTU3      GA---KVLQVTSAEPGDGKTTSVSNLAMAIA-QT-GRK-VLIIDADLRRPTVHKLFGI--
A0A517WHH5      GA---RVLQVTSAEPGDGKTTSVSNLALAIA-QT-GRK-VLIIDADLRRPTVHKLFGI--
A0A5A8BGT3      GA---RVLQITSAEPGDGKTTSVSNLALAIA-QT-GRK-VLIIDADLRRPTVHKLFGI--
A0A2E7K7A9      GA---KVLQVTSAEPGDGKTTSVSNLALAIA-QT-GRK-VLIIDADLRRPTVHKLFGI--
A0A517PTS5      GA---KVLQVTSAEPGDGKTTSVSNLALAIA-QT-GRK-VLIIDADLRRPTVHKLFGI--
A0A6I6AH34      GA---RVLQITSAEPGDGKTTTVSNLALAIA-QT-GRK-ALIIDADLRRPTVHKLFGI--
A0A517VTK3      GA---KVLQMTSAQPGDGKTTSISNLALAIA-QT-GRK-VLIVDADLRRPTIHSLFGI--
A0A517WQT4      GA---KVLQMTSAQPGDGKTTSISNLALAIA-QT-GRK-VLIVDADLRRPTIHSLFGI--
A0A517VID8      GA---KVLQMTSAEPGDGKTTSISNLALAIA-QT-GRK-VLIVDADLRRPTIHKLFGL--
A0A517RK10      GA---KVLQMTSAEPGDGKTTSISNLALAIA-QT-GRK-VLIVDADLRRPTVHKLFGL--
A0A518IH18      GA---KVLQMTSAEPGDGKTTSISNLALAIS-QT-GRK-VLIVDADLRRPTVHKLFGL--
A0A7W0M4Y4      NL---KVVQVTSPDQGDGKSTVSANLAVAVA-QS-GRR-TLLIDADMRRPTVHRLFGL--
A0A2D5NDU9      EG---TSIQITSAEPGPGKSTIASILAIAMA-KA-GHR-TLLIDGDLRKPVQSKRWQV--
A0A5C5XLF4      DA---HIIQFTSSEPGDGKTTTISNLAISIA-QA-GKR-VLLIDADLRKPMVHQLFGM--
A0A518CHE5      RR-----LLVTSTEKSDGKTTVMANLAVAFA-QS-NKK-TLIVDTDMRRPGMTNLLEL--
A0A1V5N3W2      IP---KILVVTSPASGDGKTTLAINLSLSLA-QT-GQK-VLLIDGDLRKPDIAHFLKL--
A0A517NSK8      DQ---RIIQVTGPLPGDGKSTTSANLAVAFA-QA-GKR-VLLIDADLRKPRVAKLFRL--
A0A5C5Z0D6      GL---HVFQVTSPLPGDGKSTTSVNLATAFA-QT-GKR-TLIIDADLRKPRVGRLLHL--
A0A7W5H7D9      GH---QVIQVTSPLPGDGKSTTSVNLAMAFA-QT-GKR-TLIVDADLRKPRVARLLHL--
M5UE94          GH---QVIQVTSPLPGDGKSTTSVNLAMAFA-QT-GKR-TLIVDADLRKPRVARLLHL--
A0A3E0MY27      SV---QVVMVTSANSGEGKTTISSSLAASLG-RS-GRR-TLLIDGDMRRPAVHRMLDL--
A0A7V4M591      RQ-----IVFSSAEPGDGKTTVSANLAVGYA-QS-DKK-TLLIDADLRRPGLTRMMNL--
A0A7X7F3G7      NR-----IVVTSAEPGDGKTTIIANLATCYA-QS-NKK-TLLIDADLRRPGLTNLMQM--
A0A7Y4VQ32      KG---CSIVVTSAGPEAGKTSVSLLLAKSLS-DL-GRK-VLLVDADIRHPGLSRRLGV--
A0A2E0X9P6      VG-GVRVLAVASAGSGEGKTSVATSLAVSFA-KA-TQHATLIIDADLRAPSAARMLGL--
A0A1N6DAJ8      SV---RVVMVASALSGEGKTSLSSHLATSLA-RA-GRR-TLLIDGDMRRPSAHELFDQ--
A0A2E8FLY0      TR-----LAVTSTEPGDGKTTILANLAVAFA-QS-GKK-TLLIDADMRRPGMTALMDL--
A0A3D2U1E1      AR-----LVVTSTEPGDGKTTVLANLAVAFA-QS-GKR-TLLIDADMRRPGLTAMMDL--
E8R3W3          PP---RVLLVTSSMPREGKTTLSSYLAVSMA-SC-GHR-TLLVDCDFRRPMSHQLFGT--
A0A5C5ZM48      GI---RVVSVMSAMKNEGKTSLSSQLSICLA-EA-GGK-TLLIDGDLRSPDIHSAFDI--
A0A5B9WF77      DAEMGRCVLVTSAIGGEGKTTLAAQLAARCG-NA-GIS-TLLIDADLRRASLCPLLEV--
A0A7C4Z5R7      QADGTRVVMISSAVAGEGKTSLTCQLGASLA-RA-GQR-TLIVDFDLRKPSLHELFGL--
A0A1P8WN28      KC-----IAITSTEASEGKTTTTVNLAASYA-QT-GQR-TLLIDADMRRPGLSRLLEI--
A0A3B9CTT0      KC-----LAVTSTDAGEGKTVTTVNLAASFA-QT-GQK-TLLIDADMRRPGLSRLLEV--
A0A518ALT3      VRDCHKTVAVCSGVSGEGKTNISTALAMSIA-HA-SKMPTLIIDADLRSPDVSEYLDV--
A0A286RGB6      EHERLQVIMVTSAVPGEGKTTLASQLAASLA-QM-GQK-TVILDFDLRRPSLHEVFNL--
A0A7V3TZQ6      EHERLQVIMVTSAVPGEGKTTLASQLAASLA-QM-GQK-TVILDFDLRRPSLHEVFNL--
A0A3M1QRP3      RC---NVIQITSASPGAGKTTFAIMLAKSLA-HI-GKR-VLLVDADLRNPSIAGRLGV--
A0A517TMV0      DR-----LVISSSEPSDGKTTISSNLAVSYA-QT-GKR-TLLIDCDLRKPGLTALMDL--
A0A3E0MY88      QR-----LVVSSAEPGDGKTTVLSNLGTSIA-QS-GKK-VLMIDADLRRPGLTALFAL--
A0A518BBX8      NQ---NVVQVTSPNAGDGKSTTASNLAITFA-QL-GRK-TLLIDADLRKPRVHRLFNL--
A0A5B9QF68      GR-----LLISSSEPGDGKTTISVNLSVAMA-QA-GKR-TLVIDADLRKPGFTSLLQL--
A0A5B9QGF0      ER-----LLISSSEPGDGKTTISVNLSVAMA-QA-GKR-TLVIDADLRKPGFTSLLKL--
A0A5C6CK24      DR-----LLISSSEPGDGKTTISVNLSVAMA-QA-GKR-TLVIDADLRKPGFTTLLKL--
A0A7C5FXU1      PP---RVIVVTSAESSEGKTTVAGQLAIGLA-QL-GHS-TLLVDFDLRRPHVDRFLGL--
A0A847YFA1      AS---KVILVTSAVGGEGKTTLSSQLAATLA-EM-GQS-VVLVDFDLRRPSLDTVFGV--
A0A1C3E6N1      RR-----LVITSTEPGDGKTTVSTNLAVAYA-QS-GRR-TIIIDCDMRRPGLSKTMKL--
A0A518GJT2      RR-----LVITSTEPGDGKTTVSTNLAVAYA-QS-GRR-TIIIDCDMRRPGLSKTMKL--
A0A2E8B0L9      QR-----IAITSSEPSDGKTTVLTNLAVSYA-QA-GKR-TLLIDCDLRRPGLTKLFQL--
A0A5Q4GFE7      ER-----IAITSTEPSDGKTTVLANLAVSYA-HS-GKR-TLVIDADLRRPGMTKLFEM--
A0A257WS34      HR-----LCVTSTEPGDGKTTTLANLAVAFA-QA-GKK-TLLIDADLRRPGMTQLLGL--
A0A7C4LP10      QR-----LVITSTEPGDGKTTTLANLAVAFA-QA-KKK-TLLIDADLRRPGLTQLLEL--
A0A2E3RCU8      TR-----LALTSSEPGDGKTTVIANLAVVYA-QS-GKR-TLLIDGDLRRPGLTRLLDL--
A0A517MLW3      RL-----IAVSSSEPGDGKTTISSNLAVGLA-QA-GKR-TLVIDADLRKPGMTNLFNV--
A0A5B9QVD0      RL-----IAVSSSEPSDGKTTVSSNLATSLA-QA-GKR-TLLIDADLRKPGMTNLFDL--
A0A3A0DET7      DV---KVLAITSPMPGDGKTTIASNLALAMA-QA-DQR-VLLIDADLRKPSQHTIFDL--
A0A3B8PNV4      QQ-----LVITSTEPGDGKTTVLANLGVAFA-QS-GKR-TLVIDADMRRPGLTRKLNL--
A0A3D1DR40      QQ-----LVITSTEPGDGKTTVLANLGVAFA-QS-GKR-TLVIDADMRRPGLTRKLNL--
A0A2E7RYU8      QQ-----LVVTSTEPGDGKTTVLTNLGVAFA-QS-GKR-TLVIDADMRRPGLTRKLNL--
A0A3B8LXG8      QQ-----LVVTSTEPGDGKTTVLTNLGVAFA-QS-GKR-TLVIDADMRRPGLTRKLNL--
A0A6M5Z0K7      QG---TVLMVASSGAGEGKTTLATALAASLA-RA-RCR-TLIVDCDLRAPSLHRLFGV--
A0A350CI62      NR-----LVVTSTEPGDGKTTVSMNLSVAYA-QS-GRR-TLVIDADMRRPGLSTLLGL--
A0A4P5WQK6      NR-----LVITSTEPGDGKTTVSMNLSVAYA-QS-GRR-TLVIDADMRRPGLSTLLGL--
A0A3C1X4W5      NR-----LVITSTEPGDGKTTVSMNLSVAYA-QS-GKR-TLVIDADMRRPGLSTLLGL--
A0A3D3W3A7      NR-----LVITSTEPGDGKTTVSMNLSVAYA-QS-GKR-TLVIDADMRRPGLSTLLGL--
A0A7Y5SKC2      RK-----IVVSSSEPGDGKTTVLANLAAALA-QS-QKK-TLLIDADLRRPGLTAMLGL--
A0A7X7U104      EA---RTIVVTSPAPGEGKSTVVSNLAIAMA-QA-GQR-VLLIDADFRRPTQHKIFNL--
F0SI78          RA---RVIQFTSPDPGDGKSTTCSNIALATA-NS-GKR-TLVIDLDLRRPTVHKLFGL--
A0A517MDV3      E---LRVIQMTSPNPGDGKTLTTTNLAVSIA-QT-GKQ-VLLIDCDLRRPRLGTLFGL--
A0A518IQ30      SK-----LAITSSEPGDGKTTVIANLAVTYA-TA-GKR-TLLIDCDLRKPGLTRLFDL--
A0A517LWP4      SK-----LAVTSSEPGDGKTTVIANLAVTYA-TA-GKR-TLLIDCDLRKPGLTRLFDM--
A0A518JNW8      SK-----LAVTSSEPGDGKTTVIANLAVTYA-TA-GKR-TLLIDCDLRKPGLTRLFDM--
A0A2E3GWX1      QR-----ISISSTEPSDGKTTVISNTAVAFA-QA-GRR-TLLIDGDMRRPGLTRLFDL--
F0SG60          QR-----ISISSTEPSDGKTTVISNTAVAFA-QA-GRR-TLLIDGDMRRPGLTRLFDL--
A0A2E9VST2      QR-----ISITSTQPSDGKTTVISNTAVAFA-QA-GKK-TLVIDGDMRRPGLTAVFAL--
A0A356A6X2      QR-----ISITSTQPSDGKTTVISNTAVAFA-QA-GKK-TLIIDGDMRRPGLTAVFAL--
A0A5C5XLM3      QR-----ISITSTQPSDGKTTVISNTAVAFA-QA-GKK-TLIIDGDMRRPGLTAVFAL--
A0A7V2UW16      GGREIKSFAVVSVAPREGKTVAAINLAVAMS-QV-GHR-VLVVDADMRRPRVHEALGL--
A0A518DRX3      ----GNRLIVTSTEPSDGKTTVISNLGASFA-QS-GKR-TLLIDCDLRKPGLSTLFQV--
A0A518DZF9      ----GNRLIVTSTEPSDGKTTVISNLGASFA-QS-GKR-TLLIDCDLRKPGLSTLFQV--
A0A2E7ENQ5      ----SECVAISSSEPGDGKTTVLSNLGASSA-QA-GKR-TLLVDADMRRPGLTRLFGF--
A0A7V2XSV8      GAGTIRSLLVVSVAPLEGKTTAVLNIGIATA-QA-GHR-VLLVDGDMRRPRLHRSLEL--
A0A847GXG1      ----LERIAITSTEPGDGKTTVIANLAVSYA-HA-GKR-TLLIDCDLRRPGLTKLFEM--
A0A7C5BZF0      ----TNLLAVTSAQPSEGKTTVLANLAVATA-RA-GKR-TLLIDADLRRPGLTALLNM--
A0A847YGH5      ----TERIIVTSAEPGDGKSTIAANLAAAFA-QS-GKR-TLLIDGDLRRPGLSTLLGL--
A0A286RLF2      ----TGAVVVTSTQPGDGKSTVSANLALTYA-HV-GKR-TLLVDGDLRRPGLTQLLGL--
A0A7V3TX18      ----TGAVVVTSTQPGDGKSTVSANLALTYA-HV-GKR-TLLVDGDLRRPGLTQLLGL--
A0A1G3AQE9      ----THQLVVSSAEPGDGKTTVLANLAVAIA-QS-GKK-TLLIDADLRRPGLTALMAM--
A0A3L7UQT9      ----AQRIVVTSTEPGDGKTTVMSNLAVAFA-QS-GKR-TLLIDADMRRPGMTALLGL--
A0A4P5YBU2      ----AQRIVVTSTEPGDGKTTVMSNLAVAFA-QS-GKR-TLLIDADMRRPGMTALLGL--
A0A7C7V5U8      ----AQRVVVSSAEPGDGKTTVLANLAVSYA-QS-DKR-TLLIDADLRRPGLTALLGL--
A0A3M1VCL4      QR-----LVVSSTEPGDGKTTVLSNLAVAFA-QA-GKR-TLLIDADLRRPGMTTLFGL--
A0A518AKT8      ER-----ILVSSAEPSDGKTTVSANLAVAFA-QA-GKR-TLVIDADLRRPGMTTLLGL--
A0A5C5ZR72      QP---LVIALTSAVSGEGKTSISVALAMSFA-NA-SGKPTLLIDGDTRKPGVPDLIDL--
A0A7Y5SJZ4      RS-----LVVSSVEPADGKTTVVANLAVAFA-QS-GKR-TLLIDSDLRRPGLTPLVGL--
A0A5C5V7Z9      ER-----LVISSAEPSDGKTTVTSNLGVAFA-QI-GKR-TLIIDADLRKPGMTSLMDL--
A0A5C5YT05      ER-----LVISSAEPSDGKTTVSSNLGVAFA-QV-GKR-TLIIDADLRKPGMTSLMGL--
A0A518D7F9      DR-----IVVSSAEPSDGKTTVSSNLAVAFA-QI-GKR-TLVIDADLRKPGLTALLGL--
A0A5C5ZIP0      DR-----LVISSAEPSDGKTTISSNLAVSYA-QV-GKR-TLLIDADLRKPGMTALMDL--
A0A518KBK3      ER-----LVITSSEPGDGKTTVSANLAVSYA-QT-GRR-TLVIDCDMRKPGLTSLLEL--
A0A5C6AKF9      DR-----LVISSSEPGDGKTTISANLAVSYA-QT-GKR-TLVIDCDLRKPGLTALLEL--
A0A7C2KUQ9      DRQRGSAVLISSAGPQAGKSTLALLLAESLA-QC-GKH-VLLVDTDLRNSAVSKRCGV--
A0A7C5R0U3      ---DLVSLAVTSAEPGDGKTTVLVSLASSLA-RS-GKR-VLVIDADLRKPAMTRVCQL--
A0A847YCQ7      KQDRLKVVLVTSALAQEGKTTAAAQLALSLA-RA-GRR-TVLVDGDIRRPRVHRIFDR--
A0A286RD13      ERQGLKVVLVTSALAREGKTTLVAQLATSLA-RA-GRR-VVVVDGDLRRPRLHRLFRC--
A0A7V3TUJ6      ERQGLKVVLVTSALAREGKTTLVAQLATSLA-RA-GRR-VVVVDGDLRRPRLHRLFRC--
A0A517TY85      VPGERKVVAICSAASGEGKSSLATALAMSIA-ES-SKQPTLLIDADLRSPDIARLLGT--
A0A5B9QEI7      QPGVDKIIAICSAASGEGKSSLAAALTLSIA-KA-SKKPTLLIDADLRSPDVSSFLEV--
                           .     **:                    ::.* * *            

A0A5S9IPR9      --PQGE--GFTELLR-----RDVSSEE------VVH------KINENLSCITSGKIP--A
A0A533Q9U4      --DKSL--GLSNVLV-----KSGDLRT----V-AKE------TTIPNVRAIACGPIP--P
A0A533Q6B7      --DESS--GLSNSLI-----NPVNLHR----V-ARV------TKVPNLYVITSGPPS--P
A0A1U9NNE1      --PEGTT-GLSDVLE-----GKPFANA------LWY------APSAGFDVLGNYDRC--L
A0A2G2JCA2      --PKSP--GLAEVLN-----RDIPLKD----A-INR------EWSDSVHLLTAGTLM--T
A0A1G2XVR0      --DLKP--GLSNHFI-----GEIDYES----I-IKH------VNIPHLNIITCGLIP--P
A0A1G3B0P0      --DLKP--GLSNHFI-----GEIDYES----I-IKH------VNIPHLNIITCGLIP--P
A0A1E3X4X0      --ERNP--GVSNVLA-----GEASIES----C-IKD------TEISNLNLITSGSVP--P
A0A286U4B3      --QMMP--GLTNHIL-----GDNDLDS----I-IKH------TAIPNISVITCGLIP--P
A0A5C6DDS2      --ETMP--GLSNHFV-----GEGDLDL----I-IKP------TAIPNLSVITCGLIP--P
A0A5S9IJB5      --PRYP--GLSNLIA-----DSEVNLDDVVQN----------VDVENLSFLPAGVSP--P
A0A2E3GW02      --DRDV--GVSTFLT-----SDVEWAD----C-IQQ------TSVPNLDVITAG-KK--N
A0A5B9QNZ7      --DPDNTAGLADVLT-----GKTELLD----A-IYE------TEVPEVSVMPSG-FR--P
A0A1Z8N7H5      --KSKP--GLSDLLN-----ADDEVSG----M-ISDYLAP--TDAPNLDVLPAG-PR--R
A0A1U7CZ81      --PEGL--GLSDVL-----KEEANVED----V-AIP------VQGGTFHLLCAG-TP--V
A0A142YNY8      --ADSK--GLSDLLM----NEDLNPED----L-AIP------VQGGTFHLLSAG-TP--T
A0A1U7GLS6      --PEGA--GLSDALM----NDGLNVEE----L-AIP------VQGGTFHLLSAG-TP--T
A0A1G2YPI3      --NHENR-GLSSVLA-----GAARLED----A-IHQ------TEVKGLDLLACG-PE--V
A0A532UIN2      --NHGDV-GLSSTLA-----GITTSGE----A-IRP------TEIEGLELLPCG-AS--V
A0A0S8KNX5      --PKGAR-GLQDVLS------GVEFED----V-VYS------IASSGLDVLAADYHN--A
A0A3D3UVZ8      --PKGSR-GLQDVLC------GVKFEQ----A-VFS------VASTGLDVLAADFQD--S
A0A517NFU9      --AESP--GLSDVLR-----GEISADT----A-IKP------SEIPNLNLMANG-SP--T
A0A5C5YWH4      --QREP--GLSDVLS-----GTISARE----S-IQN------TEVSNLDLIPNG-RP--T
A0A3D2TNK4      --KGQP--GVADLLT--SPETPAQSAP----PLIHS------TIVKDLDVLPAG-LR--R
A0A7C1Y4F0      --DDNK--GVSSVLA-----GRDTIEQ----A-IQP------GVIDSLDVMACG-PE--V
A0A6I0ENW6      --GPRK--GLVDFLR----TGKLTTKD----V-LFH------ADVLGVDVIPAGDRA--S
A0A6L3A0B7      --GPRK--GLVDFLR----TGKLTTKD----V-LFH------ADVLGVDVIPAGDRA--S
A0A0J1B4A0      --ERSP--GLSDLLSHDGPINPATLAE----C-VQA------SEQDSLTLCTSG-SR--T
A0A142WSB9      --PRQL--GLAEVLT-----GAIPLES----G-LKA------TPVANLSVLTAG-IP--P
M5SZR3          --EIGI--GLSNMIV-----DGAEPTD----A-IRA------TPVHNLWLLSAG-QK--T
M5TW92          --EIGI--GLSNMIV-----DGAEPTD----A-IRA------TPVHNLWLLSAG-QK--T
A0A2S8FKY2      --PVGP--GVGDILV-----GEAKLAD----S-IRP------TDIPNVDLLPAG-IK--E
A0A517N8P6      --QSEL--GLTSLIN-----GEGQLAD----I-VVP------TDTEDLFVLASG-PR--P
A0A432MJP4      --DRAP--GLSEVLR-----GISTWRE----V-LQP------SAAEDLRIMTTG-GP--V
M5UQ35          --SAEY--GLVDYLK-----GKAGFED----V-LHP------CEQAGLFVCTDG-SR--T
A0A0S8FY64      --ERSP--GLTNLLV-----EGRALQE----I-VQQPSDGQLEGLQNLYVLSAG-AK--T
A0A1N6KFT7      --KGDQ--GLSHILR-----RLLPLSR----V-VQQ------TQIENLDFIASG-SD--V
L0DFG4          --KADQ--GLSHVLR-----RLLPLSR----V-VQQ------TQTENLDFIASG-PE--V
A0A5C5XXG1      --APEG--GLTDLLT-----GSMDLDD----A-IKP------TEADGVSVITAG-AS--T
A0A7C7YUM8      --QRAP--GFAEILE-----EGAVWRD----C-IQD------VGEENLSLLPAG-QT--S
A0A7C2AHI6      --EKGP--GFAEALM-----EEADWRE----C-VHR------TELEGLAVLCCG-SW--R
A0A518BJJ1      --DRGP--GLAEVLA-----GTSEWRD----V-ARS------TDNPLLSVIPAG-VL--R
A0A518D182      --GDQV--GLAECLT-----DEADWRE----R-RQP------SGRDHLDVLVAG-RS--R
A0A7V4HWU2      --ENQV--GLSSLIN-----GEAELPD----A-VQA------TAVANLWTITTG-PR--P
A0A5C5WTY6      --PNEL--GLSQFIS-----GSATLDE----V-IQS------TKSDDFKVITSG-EI--S
A0A5C5Y033      --QDQQ--GMSEVLQ-----AKLPLAE----V-IQP------TEIENLSAISAG-KT--P
A0A5C6G1Y2      --QDQQ--GMSEVLQ-----AKLPLAD----V-IQP------TEIENLSAISAG-KT--P
A0A354PDV6      --KREN--GLVDVLA-----DELEPME----A-IRD------TDVENVHVLPAG-AP--T
A0A5C6FZ02      --APEG--GLTDLLT-----GSMELDD----A-IKP------TEADGVSVITAG-AS--T
M5TIT3          --DKAN--GLSEVLE-----GQLAFED----A-VKE------TRADNVFVVTGG-AT--S
A0A5M6CY44      --ENEL--GLSDLLE-----NETSIEE----T-IRS------TAIDNVSVMTAG-SS--T
F2AXG2          --GKED--GLCDVLE-----GRLEIPE----S-IKV------TEAENVSVMTAG-SS--S
M2BB46          --GKED--GLCDVLE-----GRLEIPE----A-IKV------TEADNVSVMTAG-SS--S
L7CLQ6          --GKED--GLCDVLE-----GRLEIPE----A-IKV------TEAENVSVMTAG-SS--S
A0A0J1B719      --GKED--GLCDVLE-----DRLEISE----A-IKA------TEADNVFVMTSG-SS--S
Q7UF18          --GKED--GLCDVLE-----GRLEIPE----A-IKV------TEAENVSVMTAG-SS--S
A0A2G1W1E0      --GKED--GLCDVLE-----GRLEIPE----A-IKA------TEADNVFVMTSG-SS--S
K5E235          --GKED--GLCDVLE-----GRLEIPE----A-IKA------TEADNVFVMTSG-SS--S
A0A5C6FFI9      --DGGR--GLGDILM-----GEATLED----S-TVA------SSVENLDILPHG-KA--T
A0A5C5WDJ1      --DQEP--GLSDYLE-----RRIPFEG----A-VTR------TEVANLDIVPNG-GP--T
A0A5C5X547      --DGAT--GIYDILT-----GNETLDG----A-LKY------IEEDKLTVIPAG-----N
A0A353FIP5      --QSNP--GLVDAIS-----GESPCED----LAQQV------SSIPNLHILPSGKVDVGG
A0A7V7MJI7      --NLSP--GVAEVLQ-----GTVEWKD----CKVLC------QDVANLEILPAGLPK--G
A0A5B1CIK7      --AKGA--GLCDVLE-----GRAEFAD----V-IKE------TDAENVSVITAG-SS--P
A0A5C5WHS2      --AKGA--GLCDVLE-----GREQFKD----M-IRE------TEAEGVHVVTAG-SS--P
A0A5C6B6G8      --SKTG--GLCDVLE-----GRLQLAD----V-IKD------TDAEKVSVITAG-SS--S
A0A5C5ZZN3      --GREE--GLCDILN-----DRTPFAD----A-IKE------TRADNVWVIPAG-SS--S
A0A5C5XS91      --SKEN--GLCDLLE-----GRIDFNE----A-VKE------TKVDNVHVMPAG-SS--S
A0A5C6C4E6      --NKER--GLCDLLD-----GRISFEE----A-VKE------TKADNVYVMPAG-SS--S
A0A2E1VVJ1      --EVSP--GLSEVLL-----EKNPWQD----C-VHK------APVANLDVLPAG-AM--V
A0A3M2AEL0      --PISP--GLSDVLK-----EDASPEK----L-MHP------TNIDGLSVLTAG-SR--T
A0A2A2W9R6      --ERSP--GLSDYLN-----HVVCFSE----S-LHE------CEQINLTLCPAG-SR--T
A0A518HKC1      --ERSP--GLSDYLN-----HVVCFSE----S-LHE------CEQINLTLCPAG-SR--T
A0A518L3P0      --ERSP--GLSDYLN-----RVVCFSE----C-LHE------CEQINLTLCPAG-SR--T
A0A255R1S0      --ERGP--GLSDYLH-----GDATLME----C-LHH------TEQENLVICPSG-SR--T
A0A5B9MKP1      --ERSP--GLSDYLN-----GVVSFSE----C-QQD------CEQLNLAVCPAG-SR--T
A0A351FYP6      --SNTI--GLTNLLL-----GQNTLDE----V-IQT------SESPNLHFIPSGKLP--S
A0A0S8J591      --KPDR--GLSTLLS-----EKDSATV----Y-IKK------TDIENLHVLPGGPIP--S
A0A532UT69      FEVNGSK-GLASLLS-----RRAT-LEDIAEK-TDI------KD---LDLLPCGEQL--I
A0A7V9G2R2      --QECPR-GLSSLLA-----GESDMV-PMPTR-FPN-----------LDLMDAGDLT--S
A0A2D5AWU0      --VENLA-GLGQVMT-----RSITTDKVIVQN-VAA------G----LDLMPAGDPF--G
L0DC26          --QPCVP-GFCEVLR-----GEIDIV-GAVQP-TVI------SG---LSLLTAGFSD--S
M5RT57          --VSNNL-GMTSVLE-----GRATLDEAVIRD-WSD------Q----IHLLPAGRLR--V
D5SZ21          --LRGSY-GLSTILR-----NDDSIENSLRNN-VVV------SDLAGLDIIPAGPRP--A
A0A7X7U1J4      --DRRAK-GLGWVLA-----GEMSVE-NAIEH-TGL------AN---LDVLTCGPEV--P
A0A7V8E5N8      --TSDGP-GLSEVLA-----GKADLK-SAARP-SVI------PG---VDIVGVRTGV--S
A0A356KTN1      --QPLEP-GLADAIE-----GK--VE-DLGER-LRR------TQVENLWVMGAGRCE--A
A0A7Y5LV28      --EKAGP-GLDEVLS-----GTVRVE-AAARA-STI------DG---VDIVGVSEGM--H
A0A7Y5HFQ5      --LGNED-GLTRIFA-----DGQ-VR-PRTHR-IAR------EEGAPLDVVTSGPIP--P
A0A7W1FMQ9      --TPGTP-GFSELLG-----GAEDVA-PVPTG-LTN-----------LDFLGAGTVP--T
A0A7W1NA62      --EGDER-GLSFLLA-----GYDGIA-PQSTS-YAN-----------LDFIGVGVRP--P
A0A7V9JTP9      --ETAER-GLSFILA-----GETGIE-PVATA-FAN-----------VEFLGVGVRP--P
A0A7W1FJ38      --DERER-GLSYLLA-----GEEGIE-PAASE-HQR-----------LDVLPVGVRP--P
A0A1G2YQB7      --DNKGK-GMHQLLA-----DFK--LRDLLMH-ADT------PG---LAVLTAEPCD--I
A0A353P687      --DNKGK-GMHQLLA-----DFK--LRDLLLY-SDV------PG---LSVLTAEPCD--I
A0A356EME5      --R-KSP-GLAEVLG-----GECD-LHEAIVP-TWT------PS---VDVLPGGEAK--Q
A0A3L7P4E4      --K-NKM-GLSNLLG-----DVSLDVNECIES-VTF------EGST-LDILSSGECP--I
A0A3L7PEB5      --K-NNT-GLSELLD-----EVPPDINECIQT-VSF------EGSN-LDILASGECP--I
A0A1U9NL64      --D-REP-GISNILA-----GESQ-IDSVIKN-TSI------DG---LDVLACGPSI--P
A0A2N1UCJ3      -ANEVEK-GLSSILS-----GQIS-LDDAIRS-CPT------DG---LFLLTSGPEI--L
A0A7V2H881      --E-KRI-GLSNVLA-----GEVS-IEQATQA-VKV------PG---LHVVPCGPIP--S
A0A7C4EK84      --D-QRM-GLSRVLL-----ENVP-LDKAIAP-TGI------EN---LDVLPCGPPP--A
A0A7C3F0T2      --E-RER-GISSVLV-----GREP-LDAAIHH-TEV------KC---LDILPTGPTP--P
A0A7X7U4K9      --NHSDA-GIREVLA-----GRVR-LRDAIRP-TSI------KG---LSLLACGQAI--P
A0A2E0X4J3      --S-TEI-GLSTLLA-----DRRP-AADAMQA-TDV------DN---LTVITSGPVP--S
A0A838QZ11      --S-AEK-GLASVLG-----ARLP-VSEAIVP-SGV------AS---LDLLPCGPLP--A
A0A5C5YU10      --D-NTQ-GLSTALS-----ERRP-IEELIVS-SEI------GT---LDFLPAGPTP--S
A0A517MPZ6      --Q-VEH-GLSSVLA-----ERRP-ADEVIQR-TEV------DT---LDLLPCGSRP--T
A0A5C6CNV7      --T-CEQ-GLSTVLT-----ERRP-VRELIVS-TEV------VN---LDLLPCGVCP--A
A0A518K5H4      --T-PTT-GFSDVLT-----GAVL-AIEAVVS-GVA------PN---LDLLPCGPIP--P
A0A5C6AA28      --E-VES-GFAAVLS-----GVTP-AIEAVVA-TSV------PS---LDLLACGRIP--A
A0A2E7ESJ6      --EAPEI-GLASVVA-----GDAEPADAWQEI-PF---------VPNLRIMACGPRP--E
A0A2E9VK20      --REDI--GLSECLS-----GEIEMAN----A-VQD------SGIENLHILSAGAIP--A
A0A3D4PJK1      --REDI--GLSECLS-----GEIEMAN----A-VQD------SGIENLHILSAGAIP--A
A0A355AI52      --RGQV--GLSDILR-----GTEEVAEQASGL-AIQ------TGSVPVDIIPAGRRP--P
A0A354PCQ3      --EMGP--GFSAVLA-----GKASLLD----A-VNS------RLGNLIHLLPAGQLT--A
A0A0S8GZ23      --PHDSW-GLMDVLY-----GLKKFEE----T-VRS------VPLSGLDVLTADGRN--P
A0A1I3DDV4      --PIDR--GLSETLQ-----GKTKLDE----V-IRP------TGIEGLSVMTAGSAV--R
A0A7V2UF66      --EREH--GLSGVLA-----GRETLDA----A-IHH------TKVECLDILPTGPTP--P
A0A2E0SMM6      --RKEE--GLSKLLR-----SDEPIHQCAVEL-IQP------SGAPNLDILPSGGRP--V
A0A3L7SI46      --KGPR--GLSQILR-----ETTPVAECCLEN-IFN------LGIENLDVMPSGSRP--A
A0A5B9PJZ8      --DNDY--GLTSVVY-----GQMEPEE----A-VRV------IQPEYLSVVTCGPIP--P
A0A2S8G191      --NLVP--GVTEWLS-----GEVEIQD----A-IQE------TGMRNLDIIAAGDWG--H
A0A2E7EGG1      --ENKP--GLVGVLS-----GECDFED----A-VNR------EWSEHVHVLPAGYLD--R
A0A2E2N5A9      --PKGSM-GLTDIIE-----NRASLES-------CI------TQVSGVDMICAGTAV--R
A0A7C8AGA2      --PKGSR-GLQDLLF-----GKEFTK-----L-VYN------TGTVGLDVLAADHRN--V
A0A7C2FXP7      --PKELR-GLQDLLF-----GKPLAES------VYR------IGSTGLDILAADSRN--V
A0A1P8WP26      --RDDK--GLSVILR-----STDEFDEAVQGN-LRA------TAVDGLDVISCGPRP--V
A0A3L7V1F3      --RDDT--GLSKILR-----DSDELEVSIERN-LRK------SDVKGLDVISCGPRP--V
A0A2E3GWC6      --REEI--GFSEVLQ-----GELELLN----A-IQP------TKIENLSVLSAGAIP--A
F0SLB0          --REEI--GLSEVLQ-----GELELLN----A-IQP------TKIENLSVLTAGAIP--G
A0A3L7NDH9      --RSMP--GLSDILR-----GNQPVSDHASAC-IRR------SGSVPIDIIPAGQRP--S
A0A7X8IIB9      --PNGHR-GIQDYLF-----GADLQRT------LYH------VEGLPLFVLACDDRN--S
A0A532UD06      --DHEL--GLTNVLA-----GTVRLDE----A-IQP------GPVTGLDLLSCGSQV--P
A0A660URN1      --DHGK--GLSNVFA-----GAITLDE----A-IEA------GPVEGLDILPCGPEV--P
A0A517ZCB5      --TGHP--GLSTVLM-----SDRSVEEAIDTL-PHH------TELPNLDVLPAGPRP--A
A0A225EH48      --PLTP--GCAEVLL-----QEVDVSD----A-VQP------TTVPNLWLIPAGQCS--N
A0A518INW8      --QNAN--GLAEYLM-----GDAGLDE----V-AVP------SEIERLDFISHGHHA--S
A0A518JPH9      --QHPK--GLAEYLM-----GDASLEE----V-TVS------SEIPGLDFICHGHHA--S
A0A5C5VEK8      --DSKQ--GLSTMLR-----ERRPVED----F-IIP------NALGSLDFLPAGPSP--S
A0A532UTJ0      --PKGSR-GLQDVLC-----G-----VKFEQA-VYS------MASTGLDVLAADFDN--A
A0A2E2CCW9      --ANSV--GLGDVLT-----GEIDAQT----A-IRE------TRVSHLSILTAGMLP--E
A0A3C0AGX3      --ANSV--GLGDVLT-----GEIDAQT----A-IRE------TRVSHLSILTAGMLP--E
A0A518AAQ5      --NNAV--GLGDVLA-----QEIDAQT----S-IRE------TRISNLSILTAGMLP--E
A0A517QBG9      --NNAV--GLGDVLA-----QEIDAQT----S-IRE------TRISNLSILTAGMLP--E
A0A518FTU3      --NNAV--GLGDVLA-----QEIDAQT----S-IRE------TRISNLSILTAGMLP--E
A0A517WHH5      --NNAV--GLGDVLA-----QEIDAQT----S-IRE------TRISNLSIMTAGMLP--E
A0A5A8BGT3      --NNAV--GLGDVLA-----QEIDAQT----S-IRE------TRISNLSIMTAGMLP--E
A0A2E7K7A9      --NNAV--GLGDVLA-----QEIDAQT----S-IRE------TRISNLSILTAGMLP--E
A0A517PTS5      --NNAV--GLGDVLA-----QEIDAQT----S-IRE------TRISNLSILTAGMLP--E
A0A6I6AH34      --NNAV--GLGDVLA-----QEIDAQT----S-IRE------TRISNLSILTAGMLP--E
A0A517VTK3      --VNGI--GLGDVLS-----EEIDAQT----A-IRE------TRIKDLSLMTAGTLP--E
A0A517WQT4      --VNGI--GLGDVLS-----EEIDAQT----A-IRE------TRIKDLSLMTAGTLP--E
A0A517VID8      --ANSV--GLGDVLS-----GDIDAQT----A-IRE------TRVSHLSILTAGMLP--E
A0A517RK10      --ANAI--GLGDVMA-----EEIDAQT----A-IRE------TRISNLSIMTAGTLP--E
A0A518IH18      --SNAI--GLGDVMA-----NEIDAQT----A-IRE------TRISNLSIMTAGTLP--E
A0A7W0M4Y4      --SNDL--GVANVIG-----EHLEPAD----A-IHE------SEIPNLSVMVCGPRP--H
A0A2D5NDU9      --SGPG--GITSAVA-----EDLRLIA----A-VHE------TEVDGLDLLAAGTPP--S
A0A5C5XLF4      --REEI--GLSECLS-----GEIEMAN----A-VQD------SRIENLDILSAGSIP--A
A0A518CHE5      --RKEE--GLSKLLR-----SEEPVDQCAVEL-IQP------SGSPNLDILPSGSRP--V
A0A1V5N3W2      --PENYW-GLQDVLL-----GLRRWEE----A-VYT------LPEAGVQVLTADHRN--N
A0A517NSK8      --ENTL--GLSEAIG-----GLADAAD----V-ISD------TVVDNLWAVGSGAVP--A
A0A5C5Z0D6      --EGSL--GLSDALR-----QSLDPSK----V-VQT------TVQDNLFAVSAGSIP--E
A0A7W5H7D9      --DGEL--GFAEALM-----DQCDPVD----V-VQT------TVNENLFAVGAGSIP--P
M5UE94          --SGES--GFSEALQ-----DLCDPTD----V-VQS------TVSDNLFAVSAGAIP--A
A0A3E0MY27      --PLDT--GLSEVLR-----GEAAVEE----A-IRP------SRAPGLWVMPAGRCD--H
A0A7V4M591      --RGVY--GLSELLR-----SEGNIAEQAAIH-IQP------SGLANLDILPSGPRP--P
A0A7X7F3G7      --RQQE--GLSTVLR-----SDAHVADLCVAL-IQP------TGIERLDVLPCGPRP--A
A0A7Y4VQ32      --ETRE--GLTDLLA-----GGNGDVQ----S-MMT------TTDDGVDLLPAGHDA--S
A0A2E0X9P6      --PNQP--GLADVLR-----GDLPAVE----T-IAQ------VGSSTAFLLPAGRSQ--D
A0A1N6DAJ8      --PCVP--GLSEVLR-----DEVDVAD----A-IQP------TAAGGLWLLPAGLCD--S
A0A2E8FLY0      --RGPR--GLSTVLR-----GDEPIANTATAN-LFA------TELGTLDVMPAGPRP--L
A0A3D2U1E1      --RGQQ--GLSSILR-----SNLPPDTATQGN-VFS------THLEHLDVIPSGARP--A
E8R3W3          --QKSP--GLAEIFR-----NEIDLWS----A-IQT------TSFNLLSTLAAGEGD--P
A0A5C5ZM48      --DPSP--GLGDVLD-----GHASLQQ----T-VVA------AEQPGLWVLPAGKAV--S
A0A5B9WF77      --PEGP--GLSDALQ-----GDVKVDE----L-IIP------VQGGTFHLLAAGTPV--P
A0A7C4Z5R7      --PLTP--GIREIMR-----GEAHASE----C-WRA------SRIEGLSVLPAGHGD--H
A0A1P8WN28      --RGNG--GLSEVLR-----ADSDIPQMCKER-VVQ------TEVPLLEVLPCGPRI--L
A0A3B9CTT0      --RGNG--GLSEILQ-----ADGGIAELASER-VTP------TDVDGLYVLPCGPRI--L
A0A518ALT3      --PSGP--GLSEVIS-----GSVPLNE----A-IYR------VGDSLTFVLPAGSER--I
A0A286RGB6      --PISP--GVSEVLR-----AEISLKD----V-VRP------TELENLFVVTAGYWS--P
A0A7V3TZQ6      --PISP--GVSEVLR-----AEISLKD----V-VRP------TELENLFVVTAGYWS--P
A0A3M1QRP3      --SGA---GQEFLAS-----LLDAQAGQTPRR-DRA------TNVPGLRVLVSSRPA--R
A0A517TMV0      --KRMP--GVTDILT-----AGGDIAAIAERC-VRR------TDLETLDVIPAGPRR--P
A0A3E0MY88      --KREH--GLSDVLN-----APEPVEEVATRY-VRG------TGIPDLDVLPSGPRR--P
A0A518BBX8      --SGKK--GLVSVIR-----DGADLDD----V-IHD------TGIDGLSVIPCGPLP--E
A0A5B9QF68      --RGRP--GLADVLT-----SGLSPAESAPSM-VVA------TEVPGLDVLPVGLRR--P
A0A5B9QGF0      --KGRP--GVADVLT-----SGLSPSESAPSM-VVE------TEVPGLDVLPVGLRR--P
A0A5C6CK24      --KGRP--GVSDVLT-----SERSPAESAPDL-VVH------TEVPGLDVLPVGLRR--P
A0A7C5FXU1      --RRGP--GLAHVLR-----GEISLED----A-VQD------TEQPLLRVLPAGAWT--D
A0A847YFA1      --DRSP--GVSEVLR-----AEVALEE----T-IQE------THLENLSLIAAGTWS--R
A0A1C3E6N1      --RGSY--GLSTILR-----NDDSIENSLRNN-VVV------SDLAGLDIIPAGPRP--A
A0A518GJT2      --RGSY--GLSTILR-----NDDSIENSLRNN-VVV------SDLAGLDIIPAGPRP--A
A0A2E8B0L9      --RGVA--GLSDILR-----GNDEVPAMCEER-IQA------AGVDGLDVLVCGPKP--P
A0A5Q4GFE7      --RSNG--GLSEILR-----GDSPIDAMCRPR-VLP------SGIAHLDVMPCGPKP--S
A0A257WS34      --KGQQ--GLSHVLR-----DSRPVQESCLDN-IFH------LGQENLDVMPSGARP--I
A0A7C4LP10      --KGPR--GLSQVLR-----ETAPIADSALEN-IFH------LGVENLDVMPSGPRP--A
A0A2E3RCU8      --KSHR--GLSDVLA-----ADDPIQEIIPGH-VVP------TAAANLDVLPAGPRR--Q
A0A517MLW3      --RHAK--GLSQLLV-----EMSPVDVVDK-Y-VMS------TGIDNLELIPCGARP--L
A0A5B9QVD0      --RQCR--GFSQLLV-----EANVAATVKS-Y-IQP------SGIEDLDLLPSGARP--L
A0A3A0DET7      --STEK--GLATVLS-----ARMPVGD----A-IVR------LRESSLEVLPCGPLP--A
A0A3B8PNV4      --KGSR--GLSTILQ-----SEDPIAVSAAGN-LFA------TELGSLDVIPAGPRP--T
A0A3D1DR40      --KGSR--GLSTILQ-----SEDPIAVSAAGN-LFT------TELGSLDVIPAGPRP--T
A0A2E7RYU8      --KGPR--GLSTILQ-----SEEPIGISAASN-LLA------TELNSLDVIPAGPRP--G
A0A3B8LXG8      --KGPR--GLSTILQ-----SEEPIGISAASN-LLA------TELNSLDVIPAGPRP--G
A0A6M5Z0K7      --AQTP--GVCEVLS-----RTARVEAV-----IRP------TAAECLDVLAAGEMS--E
A0A350CI62      --RDDV--GLSRLLR-----SPDDLDTAIAAN-LRT------TVVQGLDVISCGPRP--V
A0A4P5WQK6      --RDDV--GLSRLLR-----SPDDLDTAIAAN-LRT------TVVQGLDVISCGPRP--V
A0A3C1X4W5      --RDDV--GLSRLLR-----SADDLETAIAAN-LRT------TVVQGLDVISCGPRP--V
A0A3D3W3A7      --RDDV--GLSRLLR-----SADDLETAIAAN-LRT------TVVQGLDVISCGPRP--V
A0A7Y5SKC2      --RGVE--GLSGIIH-----GQLPVASMAAQH-IQT------TALAGLDVLPSGPRP--T
A0A7X7U104      --DRLAR-GLSAVLA-----GQMPLEE----A-IER------SGIANLDVLTCGPDV--P
F0SI78          --DRDV--GVSTFLT-----SDVEWAD----C-IQQ------TSVPNLDVITAGKKN--E
A0A517MDV3      --EDEA--GLSNVLT-----GDTELVD----S-IHE------TPIENLSVMPSGFRP--S
A0A518IQ30      --RGLG--GVSQLLT-----QADTVEPVWGNE-VKA------TGIGNLSIIPAGPRP--Q
A0A517LWP4      --RGLG--GVSQLLT-----QADVVAPIWNHE-VKG------TGIPNLSIIPAGPRP--Q
A0A518JNW8      --RGLG--GVSQLLT-----QADVVAPIWANE-VKG------TGIPNLSIIPAGPRP--Q
A0A2E3GWX1      --RGQQ--GLSSILR-----DDQTIEESAKAN-MVH------TGLMNLDIIAAGPRP--S
F0SG60          --RGQQ--GLSSILR-----DDQTIEESAKAN-MVH------TGLMNLDIIAAGPRP--S
A0A2E9VST2      --KGQA--GLSTILR-----DTASIEESALKH-ITK------TRLENLDVISAGPRP--S
A0A356A6X2      --KGQA--GLSTILR-----DTATIEESASKY-ITK------TRLENLDVISAGPRP--S
A0A5C5XLM3      --KGQA--GLSTILR-----DTATIEESASKY-ITK------TRLENLDVISAGPRP--S
A0A7V2UW16      --PATGP-GLSDVLK-----GGAALDDV-----VQE------TKVKGLWVITAGPIP--P
A0A518DRX3      --RGLP--GLSDLLR-----SSEPVGAMCEQR-ILS------TGIPDLDLLPCGPKA--F
A0A518DZF9      --RGLP--GLSDLLR-----SSEPVGAMCEQR-ILS------TGIPDLDLLPCGPKA--F
A0A2E7ENQ5      --RGKG--GLSDVLT-----KPNDLNELCEER-IQK------TALAGLDVLPAGPLP--T
A0A7V2XSV8      --PGTDR-GLSDILA-----GRAALADV-----VQR------TPVEGLDVVTAGPIP--P
A0A847GXG1      --RGRG--GVSEILR-----SDEDLAAMCDER-VQA------TGIAGLDVLPCGPKP--S
A0A7C5BZF0      --RGRE--GLSAVIQ-----SAEDLETIARAN-IRR------TTLECLDVLPCGPRP--A
A0A847YGH5      --RGRE--GLSEVLR-----MESAVAEAAPGR-IRR------DVIPGLDVLPCGARP--V
A0A286RLF2      --RGEP--GISEVLR-----DTAPIAEAIQAR-LKK------NIVPDLDVLPCGRRP--A
A0A7V3TX18      --RGEP--GISEVLR-----DTAPIAEAIQAR-LKK------NIVPDLDVLPCGRRP--A
A0A1G3AQE9      --RGIE--GLSSVIR-----SEEDIVRAAVAH-IRP------SGLAGLDVLASGPRP--S
A0A3L7UQT9      --KGQQ--GLSQVLR-----DERPIAASVAEN-LFT------QITPGLDVIPSGSRP--S
A0A4P5YBU2      --KGQQ--GLSQVLR-----DERPIAASVAEN-LFT------QITPGLDVIPSGSRP--S
A0A7C7V5U8      --KGFQ--GLSTVLR-----SDRDVGELAAAH-IRP------SGLEGLDVLPSGPRP--S
A0A3M1VCL4      --RAAP--GLSTVLR-----SEEPLQVALQGC-LFQ------SGCAGLDFIPSGPRP--S
A0A518AKT8      --KGQA--GVADILT-----SEEPTASIAPRH-VVH------TDEPRLDVIPAGLRR--P
A0A5C5ZR72      --RHGQ--GLTEVLA-----GQ---CTLDEAL-QPA------RGVANLQVLPAGKSR--S
A0A7Y5SJZ4      --RGHD--GLTTALL-----NSAPMAEVVEAH-LCR------DLVDNLDVLPSGPRP--A
A0A5C5V7Z9      --KGQA--GVTDILL-----CEGGVAELAERC-LVK------TPLEKLDVIPAGPRR--P
A0A5C5YT05      --KGHA--GVTDILI-----CEGAIGALAERC-LVK------TGLDKLDVIPAGPRR--P
A0A518D7F9      --KGQP--GVTDLLT-----ARGEMSKLAPGV-VRK------TDQPGLDVIPAGPRR--P
A0A5C5ZIP0      --KGKS--GVTDILT-----TSGDVAAEARRC-LLK------TEQPNLDVIPAGPRR--P
A0A518KBK3      --KGYE--GVTDILS-----AEGNVGLIAQRC-VVR------TALESLDVIPAGPRR--P
A0A5C6AKF9      --KGQA--GVTDILT-----TRDDVAAVAERC-VLR------TALDTLDVIPAGPRR--P
A0A7C2KUQ9      --RAEP--GLVGVLT-----SK---ATDAE-A-VSH------YNGTDLDVLPAGRLG--A
A0A7C5R0U3      --RGRK--GLVELLS-----QEGVTCEEDP-P-VVS------VAPLGIDVLPAGRKT--A
A0A847YCQ7      --RLGP--GLSEWVR-----GE---AQLSE-I-VQQ------TEFEMLQVVTAGHGD--A
A0A286RD13      --PLSP--GLSELAK-----NL---ARPEE-I-VRN------AEIENLYVVTAGHCD--G
A0A7V3TUJ6      --PLSP--GLSELAK-----NL---ARPEE-I-VRN------AEIENLYVVTAGHCD--G
A0A517TY85      --PAGP--GLAELLS-----GR---ATLRE-V-IHR------VGETEAFVLPAGKLR--G
A0A5B9QEI7      --PSQP--GIVELLG-----GE---VALEK-A-IHR------VGKTQAYVLPAGVLK--G
                        *                                                   

A0A5S9IPR9      D-PYE-TI-HNSH--IKELIRELEHEYDYILIDAPPIGITTDALLLG--KKLGGLLFAIT
A0A533Q9U4      N-PSE-LL-SSSA--MVEMLQLAKEEFEWIIIDSPPILTVTDARILA--RVADGAVFVIK
A0A533Q6B7      N-PSE-LL-SSSA--MVEFLKVAREEYDWIIIDSPPLLTVTDGSILA--RMVDGIVFVLR
A0A1U9NNE1      K-ACD-RL-SRPE--VQSNIRNLCRYYDHVVIDTPPVLAFPDALLWA--RIADATILASF
A0A2G2JCA2      S-PHK-LL-GTNV--FDKLMKGVRGRYRYVVLDTPPVLAASEALVMA--KQADVSLVCAM
A0A1G2XVR0      N-PSE-LL-GSHS--MEKFCDNVRNRFDIIIFDTPPTMTVTDAVVLS--RNVDGVVFVIK
A0A1G3B0P0      N-PSE-LL-GSHS--MEKFCDNVRNRFDIIIFDTPPTMTVTDAVVLS--RNVDGVVFVIK
A0A1E3X4X0      N-PSE-ML-GSAS--MEKFCDDIRKMFDYVLLDSPPIMSVTDATILA--RLTDASLLLVK
A0A286U4B3      N-PSE-ML-GSHS--MEKFCKEIMDRFDTVILDTPPAMAVTDTIVLS--NMVDGIIYVIK
A0A5C6DDS2      N-PSE-ML-GSHS--MEQFCMEVRERFDTVIFDTPPSLAVTDTVILS--NIVDGIIYVIK
A0A5S9IJB5      N-PIE-LV-EKER--FKEIIAECEQKYDYVIIDCPPIAIVADGVSVS--KVCQTGLLVVK
A0A2E3GW02      EQYGE-LL-HNPK--LASVLDALRDKYDVIFIDSPPVLAVADATAIA--PLADSLLLVIK
A0A5B9QNZ7      HNPSE-LL-QTNE--FFNLLAAVREKFDYVLLDSTPLLAVSESASIG--QRVDGVVLALR
A0A1Z8N7H5      QNPSE-LL-ASDR--LAQIFAWAETKYDQILVDCPPTLVASDAVLVG--RIVDGMVLIVR
A0A1U7CZ81      ADTSR-LF-QGRN--FGMMIARLRQMYDLIIIDSPPVLPVPDGLIMG--RWTDGAVLASR
A0A142YNY8      SDTSR-VF-QGRA--FGMLIARLRQLYDLIIIDSPPILPVPDALIMG--RWTDGVVLTSR
A0A1U7GLS6      SDTSR-LF-QGRA--FGMLIARLRQLYDLIIIDSPPILPVPDALIMG--RWTDGVVLASR
A0A1G2YPI3      PNPAE-IL-NSDT--FAKLLERLSNKYDRIVIDSPPVMPVTDAQILA--AICDITLLVLR
A0A532UIN2      PNPSE-LL-NSDG--FAQLLEILSDRYDRVIIDSPPVMPVTDAQILA--AICDVTLLVLR
A0A0S8KNX5      ADAYE-LL-ALPS--TAHRIDTISKKYDHVIIDTPPALGFPDALLWA--KVGDAVILTSF
A0A3D3UVZ8      ADAYE-ML-ALPS--TAKRINAISRKYDHVIIDTPPALVFPDALMWA--KIGNAVILVSY
A0A517NFU9      SDPAE-LL-ESAR--FSMMLSEMSLHFDLVLIDAPPLLAVADPAIIA--PIVDSVVMTIR
A0A5C5YWH4      ADPSE-LL-ESDR--FGAMVAELTQRYDLVLIDAPPLLAVADPAIIA--PLVDAVVLTVR
A0A3D2TNK4      PNPAE-LL-SSKA--FIELLAWAESKYDRVIVDCPPVLAVSDAQIVG--RLVDGAILVVR
A0A7C1Y4F0      PNPSE-LL-NSDV--FTETLVKLTEQYDRVVVDSPPVGPVADAQILS--TVCDITVLVLR
A0A6I0ENW6      VDDAE-RM-ANGR--FGQALKEWRGSYDFVILDSAPVLPVADARILA--GQADGTIMAVR
A0A6L3A0B7      VDDAE-RM-ANGR--FGQALKEWRGSYDFVILDSAPVLPVADARILA--GQADGTIMAVR
A0A0J1B4A0      SEPSE-LL-ESDQ--WVAFLDLARKTYDVILIDTPPLLAVADPSIVA--DEVDGVFLAVR
A0A142WSB9      ENPAE-LL-STSN--LEGLVQELRGRYDFVLFDSPPVLAVSDPCIIA--PQADAMLLVVR
M5SZR3          PDPAE-LL-TSTR--FAELMAQFREDYDYVIVDSGPLLAVSDPRIVM--AHTDGLLLSVR
M5TW92          PDPAE-LL-TSTR--FAELMAQFREDYDYVIVDSGPLLAVSDPRIVM--AHTDGLLLSVR
A0A2S8FKY2      QSVPR-SA-STGR--LDQLFADLRKSYDFIIVDAGPVLGSPSTRFLAQPQHVDGVILSIF
A0A517N8P6      NNPAE-AL-MMPE--FGQILDEARLQFDLIIIDTPPLLAVTDASNVA--TYADGVMVVMR
A0A432MJP4      ENPAE-LL-MSER--FRSLVAELRGEFDRVLIDTSPLLYVADPSIVA--PSADGVLLVLR
M5UQ35          SQPAE-LL-ETDR--FAEFMAEARSAFDVILIDTPPLLAVADPVIVS--EHVDGCLLAVR
A0A0S8FY64      PNPAE-LL-GSSA--MARLVRQSREQYDVVIFDSCPAMFVADAAPIA--SGCDGVVIVLK
A0A1N6KFT7      DNPAE-LL-ASSA--LTDFVAEIRNLYDMVVFDSSPLLAVTDPSILS--AVVDGVVLVVR
L0DFG4          DNPAE-LL-ASAT--FTDFVSEIRNIYDMVVFDSSPLLAVTDPSILS--AMVDGVVLVVR
A0A5C5XXG1      RTPAE-LL-QSEK--LEELTQQLEERFDLVIFDLPPVLAVSDPLVVA--PRIDGMVLVIR
A0A7C7YUM8      TSPGE-LL-ASRA--ALNLVEEMKEAYDLVVFDLPPAVVVADVAGFA--ANLDALLMVYR
A0A7C2AHI6      GTPGE-AL-SGER--PAQLIDEFLAEYDVVLFDLPPAVVVADVEAFA--HKLDAIVLLYR
A0A518BJJ1      ASAGD-AL-GTTK--AQELIDEFTKSYDLVVFDLPPALAVADVETFA--HRLDAVLLLYR
A0A518D182      QVSAD-LL-GSDA--MSELVDEWLAEYDLVVFDLPPALVVADVEVFA--HRLDAIVLLYR
A0A7V4HWU2      SNPAE-LL-TSVR--FEELIAVLRDQYDYVVIDSPPVLAVTDPSVIA--PRVDAVLLVLR
A0A5C5WTY6      LDSPE-WL-QTAA--LEELLRQT-EDFDLVLFDLPPVLAVSDAAVVL--PRLDASLLVSR
A0A5C5Y033      ENPAE-LL-QGVN--LDKAIESLSNHFDLVLVDLPPVLAVSDPAVVL--PRLDGAVLVVR
A0A5C6G1Y2      ENPAE-LL-QGVN--LDKAIESLSNHFDLVLVDLPPVLAVSDPAVVL--PRLDGAVLVVR
A0A354PDV6      STPAE-LL-QSPR--FDQLLEILKEKYDVVLLDLPPVLAVSDPLVVA--PKVSGVVVVFR
A0A5C6FZ02      RTPAE-LL-QSEK--LEELTHQLEERFDLVIFDLPPVLAVSDPLVVA--PRIDGMVLVIR
M5TIT3          PRPAE-LL-QSDK--LGEVLEAAKTQFDLVLVDLPPVLAVSDPIVVM--PRLDGGILVVK
A0A5M6CY44      KTPAE-LL-QTSR--LDEILDELKQEFDVILLDLPPVLAVSDPVVVL--PRIDGSVLVIR
F2AXG2          QTPAE-LL-QSQR--LDEVLAVVREDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVK
M2BB46          QTPAE-LL-QSQR--LDEVLAVVKEDFDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVK
L7CLQ6          QTPAE-LL-QSQR--LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVL--PRLDGGILVVK
A0A0J1B719      HTPAE-LL-QSQR--LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVK
Q7UF18          QTPAE-LL-QSQR--LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVK
A0A2G1W1E0      QTPAE-LL-QSQR--LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVK
K5E235          QTPAE-LL-QSQR--LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVVK
A0A5C6FFI9      SVPAE-LL-QSNR--MSVLVQEARRTYDLVLIDAPPVLAVADPSIVA--PLADGVILTVR
A0A5C5WDJ1      AEPAE-LL-ESVQ--LTRLLQEACAKYDLVLIDAPPVLAVADPAIIA--PMVDSVLLTVR
A0A5C5X547      VESEV-YL-ESYSGMLAELFATLQEQYDFVIVDCCPVLPVVDARIVS--EYVDGVILALT
A0A353FIP5      INPGD-LL-AQEK--MSEIADSLRGAYDYVFFDVPPVLAVADASSFL--NRLDAILLLVR
A0A7V7MJI7      ANPGD-LL-ATIA--MAELVKELRKFYEFVLFDVPPVLAVADAATFL--NQLDAIFLLSR
A0A5B1CIK7      KMAAE-LL-QSEK--LDEILSQAKEQYDLVIVDLPPVLAVSDPIVVM--SRLDGGVLVVR
A0A5C5WHS2      KMAAE-LL-QSDK--LDEVIAEAREMYDLVLVDLPPVLAVSDPIVVM--PRLDGGVLVVR
A0A5C6B6G8      KMPAE-LL-QMEK--LDELLEELKQQFDVVLVDLPPVLAVSDPVVVM--PRLDGGVLVIR
A0A5C5ZZN3      STPAE-LL-QSSK--FDEILRMASTQFDLVLVDLPPVLAVSDPVVVM--PRLDSGILVVR
A0A5C5XS91      TSPAE-FL-QSEE--LDEVLATARSQFDFVLVDLPPVLAVSDPVVVL--PRLDGAILVVR
A0A5C6C4E6      TSPAE-FL-QSEE--LDEVLATARSHFDFVLVDLPPVLAVSDPVVVL--PRLDGAILVIR
A0A2E1VVJ1      KNPGD-LL-ASEG--LVQLTESFLSEYDRVLFDVPPVLAVADASAFL--HNLEAIFLLCR
A0A3M2AEL0      ARPGD-LI-ASPA--MQGFLQDVRGSFDYILFDIPPVLAVADASGFV--SQLDALFMLCR
A0A2A2W9R6      SAPSE-LL-ESES--IAEFIANARQSFDMVFIDSPPLLAVTDPAIIA--LHVDGCLLTVR
A0A518HKC1      SAPSE-LL-ESES--FGEFIAEARQSFDMIFIDSPPLLAVTDPAIIT--LHVDSCLLAVR
A0A518L3P0      SAPSE-LL-ESDS--FAEFIAEARQSFDMVFIDSPPLLAVTDPAIIT--LHVDSCLLTVR
A0A255R1S0      SSPSE-LL-ESDR--FLEFIENVREGCDLVFFDAPPVLAVADPAIIA--LHVDCVLMGVR
A0A5B9MKP1      SSPSE-LL-ESEQ--FAEFIAQARQSFDMVFIDSPPLLAVTDPAIIT--LHVDSCLLAVR
A0A351FYP6      S-SMG-VL-NSAK--MKEFVAEMKSRYDYVFFDAPPIMGVSDASVLA--SAVDLCVLVVQ
A0A0S8J591      N-PAE-LL-GSRK--MRTLVAEAAERYDSVIIDASPVLGVADANILS--TMVDCVVLVVQ
A0A532UT69      N-ASE-VL-NSKS--FTTLLKDLAKKYDRIVIDSPPVVHVADAQILA--ATSDVTLLVLR
A0A7V9G2R2      N-PGE-LL-NSHC--LPEWLDHCSHSYDFILIDTPPLKAVADGLIVG--SYVDSILVVAR
A0A2D5AWU0      K-PAE-LF-ESGL--FPKLLDFLRKKYDCIVVDSPPILESSESRVMA--SEVDLCIFVTR
L0DC26          D-SIQ-AL-ASLD--LRAMFDQLKEHYDFLVIDSSPVLPVADALLIG--QHVDAVIFSVM
M5RT57          N-PHQ-LM-TRES--LNKIFNELRAQYRYIVIDTPPILSASEAILLA--RCADGSLLCTR
D5SZ21          N-PLE-LL-SSTR--FSELLAYVESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVR
A0A7X7U1J4      N-PAE-AL-NSER--FFHLLATVTGKYDRILIDSPPATLVTDALILA--ALCDAAVLVLH
A0A7V8E5N8      S-AAE-LA-SSPR--FAEALKSARETYDFVILDSAPVIQASESALIA--RRADAAILVLR
A0A356KTN1      N-PGE-LLARDDT--FHQLVWRLRRRFDRIVIDSPPVVAVSDATLMA--QAADAVIQVVS
A0A7Y5LV28      A-AAE-LA-NSAH--LDTAIREARERWDVILIDNAPVLQASESALIA--RRADGAILVLR
A0A7Y5HFQ5      N-PAE-LL-GGER--MRAYLVQASEEYRRVVLDSPPAGPVSDPALLA--REVDGVILVVR
A0A7W1FMQ9      N-PTE-LL-HSHC--LPEWIAVCRSHYDFVIIDTPPIASAPDALLLG--YYADSLLLVVR
A0A7W1NA62      N-PAE-LL-HSPA--LGQLIQRSRAQYQFIVIDTPPLGAVSDALIAA--EHADGVVMVVR
A0A7V9JTP9      N-PAE-LL-HSPA--LGTTIERARSRYDYVIIDTPPLGLVSDAFAVA--EHADRVILVVR
A0A7W1FJ38      N-PSE-LL-HSPA--LARAIAHWRTSYDYILLDSPPLGLVSDALSIG--ELADGVLLVVR
A0A1G2YQB7      A-IINKLI-HHKN--LVEFINEVSRIFDHVIIDTPPILAAVDALLWS--SMVDGVIMTSL
A0A353P687      S-IINRLI-HHKN--MVEFINEISRIFDHVIIDTPPVLAAVDALLWA--SMVDGVILTSL
A0A356EME5      N-VHK-LV-GNGE--LSAILRQVSQKYAYVVLDTPPILAASESLVLA--KAADASLVCAM
A0A3L7P4E4      D-PGE-RL-MSDR--MESLLNMLRDRYEWIIIDSPPVLAVTDSATLS--RLVDGVILVVR
A0A3L7PEB5      D-PGE-RL-MSNR--MENLLSMLRDRYEWIIIDSPPVLAVTDSATLS--RLVDGVILVVR
A0A1U9NL64      N-ASE-LL-NSDE--FGELLSSLKAKYDRILLDAPPVMPVADARILA--AMCDVTLLVLR
A0A2N1UCJ3      N-PSE-LL-NSEA--FSNLLKELTHRYDRVIIDSPPVTSVADSQILA--AICDITILVIR
A0A7V2H881      N-PSE-IL-NSQG--FADLLAGLAEKYDQVVIDSPPVLPVTDARILA--ACCDGVILALR
A0A7C4EK84      N-PSE-LI-NSQA--FGAMLQTLAGKYDHVVIDSPPVVPVTDARILG--ALCDVTLLVIR
A0A7C3F0T2      N-PSE-ML-NSPA--FADVLDQLSTQYDHILIDSPPVMPVTDARILG--AICDQTILTVR
A0A7X7U4K9      N-PAE-IL-NSAR--FAKLLQYLGQVYNWILIDSPPVTVVTDAQIIA--AVCDWAILVVR
A0A2E0X4J3      H-PVE-LL-NNGY--FADLVTSLSEQFDRVIIDSPPVMPVADARVIA--AMSDATLLVLR
A0A838QZ11      N-PVE-LL-NNGF--FSELLETLKGRYDKILIDSPPVMPVADARVIA--AISDATLLVLR
A0A5C5YU10      N-PLE-LL-NNDY--FAEMLERLKLQYDRIIIDSPPVMPVADSRVIA--SMSDAVLLVLR
A0A517MPZ6      N-PVE-LL-NNGY--FSELLHELQQKYDKIVIDSPPVMPVADARVIS--AQTDATILVLR
A0A5C6CNV7      N-PVE-LL-NNGF--FSELLDKLRLDYDKIVIDSPPVMPVADARVIA--AQTDATILVLR
A0A518K5H4      N-PVE-LL-NNGM--FSEVLEQLLRQYDQIVIDSPPVMPVADSRMIS--AMVDCSLLVLR
A0A5C6AA28      S-PVE-LL-NNGN--FSEALEQLSRHYDQIIIDSPPVMPVADARLIS--AMVDCSLLVLR
A0A2E7ESJ6      N-PSE-LL-SSES--FANVLQLLRDQFDFVIVDTPPVLAVSDPMAVA--ARVDGVILTFR
A0A2E9VK20      K-PAE-LL-SSSK--LHYLLGQAKRDYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVR
A0A3D4PJK1      K-PAE-LL-SSSK--LHYLLGQAKRDYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVR
A0A355AI52      N-PGE-LL-LGDR--FAELLAWADGEYDQVIVDAPPVLAGTDAAAVG--RLCDGLMLVVR
A0A354PCQ3      S-PHR-LM-SPER--LQEFMREALSHYSYVVIDTAPVLSAGETLAVA--STMEATLLCVM
A0A0S8GZ23      AEAVE-LL-EKPQ--TAECINNISQRYDHVIIDTPPVLAVPDARLWA--RMADAVVLSSL
A0A1I3DDV4      N-PAE-LL-QSEV--FDQVLEDCKSRFDMVLVDSGPVLLVSDPAIVS--QKCDIAMLVVR
A0A7V2UF66      N-PSE-ML-NSQA--FADLLKELRERYDHILIDSPPVMPVTDARILG--ALCDVTILVLR
A0A2E0SMM6      N-PSE-LL-SSNR--LSDFLAWAETVYDQIIIDAPPILAVSDAGIVG--RLADTLILIMR
A0A3L7SI46      N-PSE-LL-ASDR--FNDILAWAESAYDQILIDAPPVLAVTDPAIIG--RLVDGAVVVIR
A0A5B9PJZ8      N-PSE-LL-TSAR--FEAIIGVYREQYDYILIDTPPLLAVTDPAIVC--RFVDLVYMVMR
A0A2S8G191      N-SFR-EL-TSNR--MDAFFKKLRQEYDYVIVDGSPILPVVDARLIG--QYVDGVVMAVL
A0A2E7EGG1      S-PHK-LM-ANEG--FKQLIAKARDSYRYIVVDTPPVLAASESLVMA--RDADATLVCAM
A0A2E2N5A9      D-PLS-LL-SSSR--FSALIEALKTRYDRIVVDSPPTQGVSDAMVLA--AHAEALLFIVR
A0A7C8AGA2      SDALD-LL-GKPR--TGQSIERISADYDHVIIDTPPVLAFSDALLWA--RMADGVILTSF
A0A7C2FXP7      SDALN-LL-SQKN--TAQCIRQASLAYDRVVIDTPPILAFPDALVWS--KIAGSAILTSF
A0A1P8WP26      N-PAE-LL-SSER--FANLLAWAETRYDQIIVDAPPVLAVSDPLIIA--RLVDGVVLVVR
A0A3L7V1F3      N-PAE-LL-SSER--FSNMLAWAETKYDQIIVDAPPVLAVSDPAIVG--RLVDAVILVVR
A0A2E3GWC6      K-PAE-LL-SSAK--LHYLFGEATREYDFVLVDSPPILAVSDPSITA--RSVDAMMLVVR
F0SLB0          K-PAE-LL-SSAK--LHYVFGEATREYDFVLVDSPPILAVSDPSITA--RSVDAMMLVVR
A0A3L7NDH9      N-PAE-LL-LSER--FSELLSWAETTYDQIIVDASPVLAGTDAAAIG--RVCDGLVMVIR
A0A7X8IIB9      EDAFE-ML-SMPD--TAERIRHLRDEFDYIIIDTPPVLAFADAMVWA--KMADGVIMTSF
A0A532UD06      N-PSE-ML-NSDV--FAQMLKDLPKCYDRVIIDSPPVLPVADSQIIA--ASCDVTLLVLR
A0A660URN1      N-PSE-IL-NSDT--FANMLNELVQKYDRVIIDSPPVTPVADSQILA--AICDVTIMVLR
A0A517ZCB5      N-PVE-LL-SGDR--LSMLVAWAETHYDQVLIDAPPSLAAADGQIIG--RMVDGAIMTVR
A0A225EH48      RVIAA-LA-QGHP--LETLFNRLRGQFDFIVVDSCPVLPVADALLVG--QHVDGVVISIL
A0A518INW8      E-PAE-LL-ESFA--LERLIAEARQEYDFVFIDSPPLLAVADPLIIA--SLVDSVLLVVR
A0A518JPH9      E-PAE-LL-ESFA--LETLIAEARQDYDFVFIDSPPLLAVADPLIIA--AQADTVLMVVR
A0A5C5VEK8      N-PLE-LL-NNDY--LIEVLERLKARYDRIIIDSPPVMPVADSRVIA--AMSDAVLLVLR
A0A532UTJ0      ADAYE-ML-AMPA--TKKRINTISRKYDHVIIDTPPTLGFPDALMWA--KIGGAAILVSF
A0A2E2CCW9      N-PSE-ML-MSRA--FSELVNQLRKEYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVR
A0A3C0AGX3      N-PSE-ML-MSRA--FSELVNQLRKEYDYVLIDTPPLVVVSDPSVIA--SMVDGVLLVVR
A0A518AAQ5      N-PSE-ML-MSRR--FAETVNQLRNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVR
A0A517QBG9      N-PSE-ML-VSRR--FAETVNQLRNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVR
A0A518FTU3      N-PSE-ML-VSRR--FTETVNQLRNDYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVVR
A0A517WHH5      N-PSE-ML-MSRR--FAEMISQLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVR
A0A5A8BGT3      N-PSE-ML-MSRR--FAEMISQLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVR
A0A2E7K7A9      N-PSE-ML-MSRR--FAEMVNQLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVR
A0A517PTS5      N-PSE-ML-MSRR--FAEMVNQLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVVR
A0A6I6AH34      N-PSE-ML-MSRR--FAEMINQLRNEYDYILIDTPPLVVVSDPSVIA--STVDGVLLVVR
A0A517VTK3      N-PSE-ML-MSKR--FTHLLKQVRNDFDYVLVDTPPLAVVSDPSIVA--SSVDGVLLVVR
A0A517WQT4      N-PSE-ML-MSKR--FTHLLKQVRNDFDYVLVDTPPLAVVSDPSIVA--SSVDGVLLVVR
A0A517VID8      N-PSE-ML-MSRG--FSELVNQLRNDYDYILIDTPPLVVVSDPSVIA--SIVDGVLLVVR
A0A517RK10      N-PSE-ML-MSRR--FIDLIKQLRNEYDYVLIDTPPLVVVSDPSVIA--STVDGVLLVVR
A0A518IH18      N-PSE-ML-MSRR--FTDLIKQLRDAYDYVLIDTPPLVVVSDPSVIA--STVDGVLLVVR
A0A7W0M4Y4      N-PAE-LL-ASQQ--FEDFLGWARDNYDFVIVDTPPLLAVSDPGNVA--SRVDGVLLTLR
A0A2D5NDU9      N-PTE-IL-NSEK--FGDLIAQACATYDRVIVDSSPMLPVADARILA--TKCDATVLAVS
A0A5C5XLF4      K-PAE-LL-SSSK--LHYLLGQAKREYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIVR
A0A518CHE5      N-PSE-LL-SSNR--LSDFLSWAETVYDQIIIDAPPILAVSDAGIVG--RLVDTLVLVMR
A0A1V5N3W2      GQAID-QL-ARPE--TAEIIRTISQNYDHVIIDTPPVLAIPDALLWS--KMADAVVLSSL
A0A517NSK8      N-PAE-LL-QSED--FASLLKHWAEEFDYVIVDSPPVLAVSDAAIIS--QKCDVTLLALR
A0A5C5Z0D6      N-PSE-LL-QSDK--FAQLLNAWRSEFDFIIVDTPPVLAVSDATIVS--EETDAVLLTVR
A0A7W5H7D9      N-PSE-LL-QSDR--FSQLLNVWRDKFDFIIVDTPPVLAVSDAAVVS--EEMDNVLLAVR
M5UE94          N-PSE-LL-QSDR--FSQLINVWRDKFDFIVVDTPPVLAVSDAAVVS--EEMDNVLLAVR
A0A3E0MY27      E-SIQ-SL-TKEI--LGATLEQLRAEFDIIVIDTGPVLSVVDPLLIG--QHCDGAIVSVV
A0A7V4M591      N-PHE-LL-LSAR--FSQLLAWASGVYDHILIDSPPTLLTSDTAIIG--RLVDGVVLVVQ
A0A7X7F3G7      N-PAE-LL-AGPR--FLELIDWASTVYDQILIDSPPTLATSDSAVIG--RLVDGTILVVQ
A0A7Y4VQ32      DRDPE-LM-ADGA--FNRCLSAWKSRYDFIVFDAPPVLPVADARILS--GKVDGTILTVR
A0A2E0X9P6      N-PHH-LL-LGGR--IKELFDRLQRDYALIVVDTPPVLAASESLVLA--RAADAVVLCLL
A0A1N6DAJ8      D-SIQ-AL-ACRD--LRAMFDQLKEQYDFIVVDSSPVLPVADAMLIG--QHVDAVLFSIM
A0A2E8FLY0      N-PAE-LL-HGDR--FSELLAWAETVYDQILIDAPPALAVSDAAIIS--RQVDGGLLVVR
A0A3D2U1E1      N-PAE-LL-HGTR--FSELLAWAESIYDQILIDAPPALAVTDAAIIS--RQVDGGLLVVR
E8R3W3          Q-TIE-LL-NHNL--LAGLIEQARGVFDFIIIDSAPVLPVSDTLLVG--RAVDAALFVVM
A0A5C5ZM48      T-PHR-KL-SWLQ---ERVLAAAREDYDYVVIDTPPLLVASEALMLA--RAADASILCAM
A0A5B9WF77      D-ASR-IV-QGRS--FPMLIAQLRQTYEMIIIDSPPVLPVPDALALG--RWTDGALLATR
A0A7C4Z5R7      --FRS-PL-TQEA--VQLVFEQLKGEFDFILIDTSPVLPVADALVIG--QHTDGVLFSVL
A0A1P8WN28      N-AGM-LL-SMPA--LADILDWAVSEYDQVIVDCPPTLPVSDAAIVG--RYVDSMLFLMN
A0A3B9CTT0      N-AGT-LL-SMPA--LSELLDWAVANYDQVMVDCPPSMPVSDAAIVG--RYVDGLLYLMN
A0A518ALT3      N-PHQ-VV-EGSA--IPDLLRKLGKRFSTVIIDTPPVLSASEALVYA--KASDLVVYCSL
A0A286RGB6      H-RMA-VL-ANGV--IGGLFRQLREDFDFVIVDGSPVLPVADTRFIS--THTDGVVLSVV
A0A7V3TZQ6      H-RMA-VL-ANGV--IGGLFRQLREDFDFVIVDGSPVLPVADTRFIS--THTDGVVLSVV
A0A3M1QRP3      LEESE-IL-AGVA--PQRCLDAWRERYDMVLLDCSPILPVADARILA--RLADGTIMVVR
A0A517TMV0      D-PAE-LL-LGPN--LAELLAWADSRYDQVLLDCPPILAVSDAQIAA--RLVDGVVLVVT
A0A3E0MY88      N-PAE-LL-TSRR--LADLLAWAETHYDQILVDSPPVLAASDVMVIG--RIVDGLVLVIN
A0A518BBX8      N-PAE-LL-TSPH--FEELVEGVREKFDFVVIDTPPVLAVSDPSVVA--VRVDGVLLVLR
A0A5B9QF68      N-PAE-LL-SSHE--FVELLAWADSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVR
A0A5B9QGF0      N-PAE-LL-SSNE--FVELLAWADSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVR
A0A5C6CK24      N-PAE-LL-SSNE--FVELLAWADSQYDRVIVDCPPVLAVSDAQVVG--QLVDGAILVVR
A0A7C5FXU1      D-LLS-RI-LNGV--GQEFFARLRSSYEFVVIDCPPILPVADGRFIS--LFADGVVLVTR
A0A847YFA1      Y-GMA-VL-ANGA--VGSLFRELRDKFDFVIVDGSPLLPVADARFIS--TSVDGVILSVL
A0A1C3E6N1      N-PLE-LL-SSTR--FSELLAYVESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVR
A0A518GJT2      N-PLE-LL-SSTR--FSELLAYVESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVVR
A0A2E8B0L9      N-PVE-LL-TDSR--FVDVIAWAETHYDQVLIDCPPVMAASDAAVVG--RLVDGIMLVVQ
A0A5Q4GFE7      N-PAE-LL-SGPR--LADVLAWAEANYDQVLIDCPPILAAADAAIIG--RLTEGLIVVIQ
A0A257WS34      N-PSE-LL-STER--FSDVIAWAETIYDQILIDAPPILAVADPAIIG--RMVDAALVIIR
A0A7C4LP10      N-PSE-LL-SSER--FNDLLAWAESIYDQILIDAPPVLAVTDPAIIG--RMVDGAVIVIR
A0A2E3RCU8      N-PSE-LL-ASDR--LAQILAWAEGEYDQILVDCPPTLVASDAVLVG--RITDGMVIVVR
A0A517MLW3      D-PAE-LL-ASNA--LSDIVQWAASRYDHVVLDCPPVLIANDVALVT--RLTDGLVLVVR
A0A5B9QVD0      D-PAE-LL-SGPR--FSEVLEWATTQYDQIVLDCPPVLVANDVALAS--RLADGLVLVVR
A0A3A0DET7      N-PVE-LL-NNGY--FAELLESLKTRYDRIVIDSPPVLPVADARVIA--AVSDATLLVLR
A0A3B8PNV4      S-PAE-LL-HGGR--FAELIAWAESSYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVR
A0A3D1DR40      S-PAE-LL-HGGR--FAELIAWAESSYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVR
A0A2E7RYU8      S-PAE-LL-HGGR--FAELIAWAESAYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVR
A0A3B8LXG8      S-PAE-LL-HGGR--FAELIAWAESAYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVVR
A0A6M5Z0K7      AAAAG-LA-SPGA--VQRLIEELRGRYDFIVIDSSPLMLVPDAMMVA--GCVDGLLYSVR
A0A350CI62      N-PAE-LL-SSER--FAALLSWAETRYDQIIVDAPPVLAVSDPAIAG--RLVDAVVLVVR
A0A4P5WQK6      N-PAE-LL-SSER--FAALLSWAETRYDQIIVDAPPVLAVSDPAIAG--RLVDAVVLVVR
A0A3C1X4W5      N-PAE-LL-QSER--FAALLSWAETRYDQIVVDAPPVLAVSDPAIAG--RLVDAVVLVVR
A0A3D3W3A7      N-PAE-LL-QSER--FAALLSWAETRYDQIVVDAPPVLAVSDPAIAG--RLVDAVVLVVR
A0A7Y5SKC2      N-PAE-LL-ASPR--FAELLAWAELAYDHVLIDSPPALAASDTAVIG--RLVDGVMLVVQ
A0A7X7U104      N-PAE-II-GSQS--FAEVVKRLSEDYDRILIDSPPVAAVTDPLILA--ALCDVTILVVR
F0SI78          Q-YGE-LL-HNPK--LASVLDALRDKYDVIFIDSPPVLAVADATAIA--PLADSLLLVIK
A0A517MDV3      N-PSE-LL-MGKT--FFEMLETLRQKYEYILIDSTPLLAVSESTSLG--QKVDGVVVALR
A0A518IQ30      D-PTE-LF-SSSH--FGELLAWAEANYDQVLVDCPPVVAASDAAIIG--RFVDGLLMVVQ
A0A517LWP4      D-PTE-LF-SSSH--FGELLAWAEANYDQVLVDCPPVVAASDAAIIG--RFVDGLMMVVQ
A0A518JNW8      D-PTE-LF-SSSH--FGELLAWAEANYDQVLVDCPPVVAASDAAIIG--RFVDGLMMVVQ
A0A2E3GWX1      N-PVE-LL-TSDR--FAELIAWAEGEYDQILIDAPPSLAVTDPAIIG--RLVDGVILTVR
F0SG60          N-PVE-LL-TSDR--FAELIAWAEGEYDQILIDAPPSLAVTDPAIIG--RLVDGVILTVR
A0A2E9VST2      N-PVE-LL-TSER--FEELIGWAEGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVR
A0A356A6X2      N-PVE-LL-TSER--FEELIGWAEGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVR
A0A5C5XLM3      N-PVE-LL-TSER--FEELIGWAEGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTVR
A0A7V2UW16      N-PSE-LL-SSPR--LAELVHEAEERFDRVLFDSPPVGAVTDACVLA--PELDAVVHVIG
A0A518DRX3      D-AAE-LL-SGSR--IEELIAWAEIHYDQLLIDTPPILAASDAALAA--RHTDGILMVVQ
A0A518DZF9      D-AAE-LL-SGSR--IEELIAWAEIHYDQLLIDTPPILAASDAALAA--RHTDGILMVVQ
A0A2E7ENQ5      D-PSG-LL-TNRR--FAEFVAWACDHYDQVLIDTPPILAASDASIVS--RLTGGLVLIIQ
A0A7V2XSV8      N-PSE-LL-SSPR--MAEFLEEALEKYDRVIFDSPPVGAVTDACVLA--PSLDGVVQVIG
A0A847GXG1      N-PAE-LL-SDTR--LSDLLAWAETHYDQVLVDCPPILAASDAAIVG--RLTDSLILVVQ
A0A7C5BZF0      N-PAE-LL-SSQR--FSELLAWAESAYEQVFVDSPPALATSDAALIG--RITGAVLLVVQ
A0A847YGH5      N-PAE-LL-ASAR--MSELLTWTESTYDQVIIDTPPAPLASDTIILG--RMADGALLVTQ
A0A286RLF2      N-PAE-LL-AGPR--TAELLNWAVEHYDQVIIDSPPAPLASDTAIWG--RLADGVILVLQ
A0A7V3TX18      N-PAE-LL-AGPR--TAELLNWAVEHYDQVIIDSPPAPLASDTAIWG--RLADGVILVLQ
A0A1G3AQE9      N-PAE-LL-SSQR--FSELLAWAESVYDQILIDSPPVLAASDTAVIG--RLTSGVVLVVQ
A0A3L7UQT9      N-PAE-LL-ASER--FSELLAWAETCYDQILVDAPPVLAVADPIIIG--RMVDAAVLVVR
A0A4P5YBU2      N-PAE-LL-ASER--FSELLAWAETCYDQILVDAPPVLAVADPIIIG--RMVDAAVLVVR
A0A7C7V5U8      N-PAE-LL-ASPR--LADLLAWAESVYDRVLVDSPPALAASDTAIIG--RLVDGAMLVVQ
A0A3M1VCL4      N-PAE-LL-GSPR--FVDLLAWAETTYDQILVDAPPALAVADPTAVG--RFVDGALLVIR
A0A518AKT8      N-PAE-LL-SSQE--FIELLAWADSQYDQVLVDCPPVLAVSDAQIVG--RLVDGAILVVR
A0A5C5ZR72      D-HQL-LL-QPQR--LSQLIESARDRFDTILIDTPPVLGASEALSLC--RSADMTTLCAL
A0A7Y5SJZ4      N-PAE-ML-MSNR--FPELLGWAESNYDVILIDGPPVLPVADSLIIG--RLVDGVLFVVR
A0A5C5V7Z9      D-AAE-LL-SGPN--FTELLAWAEARYDQVLVDCPPVLAVSDAQIIG--RLVDGVVVVVT
A0A5C5YT05      D-AAE-LL-SGPN--FGELLAWAEGRYDQVLVDCPPVLAVSDAQIIG--RLVDGVVVVVT
A0A518D7F9      D-PAE-LL-VGPA--LTELLAWADSRYDQVLIDCPPVLAVSDAQIVG--RLVDGVVLVVS
A0A5C5ZIP0      D-PAE-LL-LGPN--FSELLAWADANYDQVLIDCPPVLAVSDAQIVG--RMVDGVVLVVS
A0A518KBK3      D-PAE-LL-LSPN--FAELLAWADSKYDQVLIDCPPILAVSDAQIAA--RLVDGVVLVVS
A0A5C6AKF9      D-PAE-LL-LGTN--FADLLAWADSRYDQVLVDCPPILAVSDAQIAA--RLVDGVVLVVT
A0A7C2KUQ9      SHDPE-LL-ANGM--IAASLKRWKSQYDVVLLDASPVLPVADARILA--RLVDGALLVVR
A0A7C5R0U3      D-AAE-LL-QRDA--LVRLLAWAEAQYDLVLVDCPPVMAASDAAIVG--DRVDATMVVVQ
A0A847YCQ7      A-ALE-GI-AQGK--ADELFARLRDGFDLVIVDTSPLLTTADALVLA--RMADGVLLSVL
A0A286RD13      E-VLE-AV-SQGK--LDRFLQSLRDQCDLVLVDSSPILTTADALILA--HVADSVVLSVI
A0A7V3TUJ6      E-VLE-AV-SQGK--LDRFLQSLRDQCDLVLVDSSPILTTADALILA--HVADSVVLSVI
A0A517TY85      S-PHH-IF-EGVK--IEGVLKGLREKFNTIIIDTPPILAASESLVFA--KAADLTVVCSL
A0A5B9QEI7      N-PHH-LI-DQAK--IEKLLDKLRGSFDTILIDTPPVLSASDSLIYA--KAADLVLFSSL
                                             :..*  *     .                  

A0A5S9IPR9      VHRTPKRMVKQLIHRMQTLDIELSGLILND---------------------------VKG
A0A533Q9U4      SNKTTKDAARKAIDHFSDMRDKLLGVVIND---------------------------VDF
A0A533Q6B7      NKKTSIAIAQKGAGCISAVHDKILGVVIND---------------------------LDF
A0A1U9NNE1      AGKTAADDLKEAYGRLHELNITVLGTVLNG---------------------------VHT
A0A2G2JCA2      RDVSRISQVQSVVERLESVGASPMGTVLNG---------------------------VSA
A0A1G2XVR0      SGQTPKELTRRALLQYKNSKSDLLGIILNL---------------------------VDV
A0A1G3B0P0      SGQTPKELTRRALLQYKNSKSDLLGIILNL---------------------------VDV
A0A1E3X4X0      TGETNRDAVKRSIAQFNDINAKVLGVVMNN---------------------------VDL
A0A286U4B3      SGKISKESARRSLHQFAGKKAEVLGVVINS---------------------------VDA
A0A5C6DDS2      SGVVAKEAAKRSLSQFAGKKGEVLGVVMNS---------------------------VDV
A0A5S9IJB5      NFKTPAKAVHIAKDVLSSNQVKLSGIILNN---------------------------MEV
A0A2E3GW02      NSKHSRPHAKQARESLDLVGAPLEGMVVN----------------------------LVC
A0A5B9QNZ7      TANTSRPEAERAVQRLQSVGVEPLGFVVND---------------------------IDY
A0A1Z8N7H5      PDKNRRKLVXRAXQNLTEMKIPLFGLVANGV--------------------------GAE
A0A1U7CZ81      YDISRAPQVERARRQLTNAGIPVLGTVING---------------------------MKS
A0A142YNY8      YDVSRAPQVERARRQLDLAGIPVLGTVING---------------------------MRT
A0A1U7GLS6      FDVSRAPQVERARRQLDLAGIPVLGTVING---------------------------MRT
A0A1G2YPI3      AEKSTRRNCLQAKHGLLSVGAHVLGVVVND---------------------------VPK
A0A532UIN2      AKKSTRKTSQQAKDGLSSVGAHILGALVND---------------------------VQG
A0A0S8KNX5      AGHTTMPDLKEATDRLAQINVRVLGTVLSS---------------------------VQA
A0A3D3UVZ8      AGHTTMPDLKEAKERLLQINVKVLGTVLSS---------------------------VQA
A0A517NFU9      VSKNGRRPVEQATKILQDIGMQPSAVIVNG---------------------------VDQ
A0A5C5YWH4      VNKHARGPVEQASKILQDQGLAPAAIVVNG---------------------------VDQ
A0A3D2TNK4      PEKNHRRSVMRAVESFHATGCHVFGVVANG---------------------------LSS
A0A7C1Y4F0      AEKSTRRQAQHARDSLLSVGARLLGAVVND---------------------------VQQ
A0A6I0ENW6      ASQTRRAEAMEALAELSAAGARLFGTVL-----------------------------IGT
A0A6L3A0B7      ASQTRRAEAMEALAELSAAGARLFGTVL-----------------------------IGT
A0A0J1B4A0      IEKNNRTLVERATEVLTDKGIAIEGVIVNS---------------------------RDS
A0A142WSB9      LEKNNRTVLRRACEQLDAHGIRLLGVIAND------------------------------
M5SZR3          LDKTTRKQAETAREILLSLDAPIVGIVANC---------------------------VRT
M5TW92          LDKTTRKQAETAREILLSLDAPIIGIVANC---------------------------VRT
A0A2S8FKY2      KDVSQVAQVDDAKRILNSFGAPIIGTVLSG---------------------------YSS
A0A517N8P6      IGRNIKPMSKRAITMLRMLHVNIIGLVINA---------------------------VGD
A0A432MJP4      PSEIRRAAMHRVAEVVQMMGTPLLGSVVNA-----------------------------D
M5UQ35          VAKNNRTIVQRAAEILDEHGSRAMGVVINT---------------------------QSP
A0A0S8FY64      ASKSRCKAADRARRQLAAVNGRIIGAVLND---------------------------VRP
A0A1N6KFT7      PEATKRHDAERTVELLKTMESPVLGFIVNG---------------------------IDR
L0DFG4          PEATKRHDAERTVELLKTMESPVLGFIVNG---------------------------MDR
A0A5C5XXG1      AASARRDEVMNSLKRVTDAGGNMVGCVLNT---------------------------FGA
A0A7C7YUM8      SGVVPGRVLTSAVNKLRQADVNLFGVILNA---------------------------VFV
A0A7C2AHI6      AGGVPREVFQAALRRLKTSRANLVGAILNA---------------------------VRP
A0A518BJJ1      SDGLPREAVSLATTRLRQAGAKLVGCVMNA---------------------------HRA
A0A518D182      AGGLPSRVVENTAKRMRASGAKIVGLVMNA---------------------------CRP
A0A7V4HWU2      LTKNARSTAHQATETLASLGAKILGVIVNAVSRGPRYGYGRYYSGYGYSGYGYAGSKYGY
A0A5C5WTY6      VATNKRHQVINAAKRIDAAGGQWIGALLNI---------------------------VQA
A0A5C5Y033      VARIRREQLANALQRLQSTGANLIGSMLNV---------------------------VGA
A0A5C6G1Y2      VARIRREQLANAMQRLQSTGANLIGSMLNV---------------------------VGA
A0A354PDV6      AVTARKSEVANTLRRLSSAGAVTVGSVLNT---------------------------LGA
A0A5C6FZ02      AASARRDEVMNSLKRVTDAGGNMVGCVLNT---------------------------FGA
M5TIT3          IANVRRDEVVNTLHRVESAGGNFVGCMINA---------------------------FGS
A0A5M6CY44      VSRARRDEVLNTMRRIRESGGNFVGWMLNS---------------------------LGA
F2AXG2          VANVRRDEVVNTLRRIDSSGGEMLGCMLNA---------------------------FGA
M2BB46          VANVRRDEVVNTLRRIDSSGGEMLGCMLNA---------------------------FGA
L7CLQ6          VANVRRDEVVNTLRRIDSSGGKMLGCMLNA---------------------------FGA
A0A0J1B719      VANVRRDEVVNTLRRIDSSGGEMLGCMLNA---------------------------FGA
Q7UF18          VANVRRDEVVNTLRRIDSSGGEMLGCMLNA---------------------------FGA
A0A2G1W1E0      VANVRRDEVVNTLRRIDSSGGEMLGCMLNA---------------------------FGA
K5E235          VANVRRDEVVNTLRRIDSSGGEMLGCMLNA---------------------------FGA
A0A5C6FFI9      IAKNGRRPVEQAGRILNDNGIVPLALIVNG---------------------------VDA
A0A5C5WDJ1      VIKNGRSIVEDAVRVLHDIQVEPTAVIVNG---------------------------VDK
A0A5C5X547      RDVSVVPDAISARDILRSHGATVIGTIVSG---------------------------HPV
A0A353FIP5      FNLSSESEVAGACHRLKLAGAKTLGAVLN-------------------------------
A0A7V7MJI7      FNRVPEGVVAASARRLVQSGAQPMGTILNA---------------------------VRT
A0A5B1CIK7      VANVRRDEVINTMRRIAASGGNFVGCVLNA---------------------------FGS
A0A5C5WHS2      VSRVRRDEVINTMRRIESSGGNFVGCMLNA---------------------------FGA
A0A5C6B6G8      VARVRRDEVINTMRRIRSSGGNFVGCMLNA---------------------------LGA
A0A5C5ZZN3      VANVRRDEVINTIRRIESAGGQFAGCMLNA---------------------------FGA
A0A5C5XS91      VSKVRRDEVVNTLRRVETAGGNFVGCMLNT---------------------------YGA
A0A5C6C4E6      VSKVRRDEVVNTLRRVETAGGNFVGCMLNT---------------------------YGA
A0A2E1VVJ1      SNLLPEAVIEQATHRLRVSGAPAIGAILNG---------------------------HRP
A0A3M2AEL0      AGVVPEVVAASATKRIRLTGAKLMGCILNG---------------------------VRA
A0A2A2W9R6      IEKNNRTLVERAAEILRDQRVPIDGVIVNG---------------------------RDS
A0A518HKC1      IEKNNRTLVERATEILRDQCVPIDGVIVNG---------------------------RDS
A0A518L3P0      IEKNNRTLVERAAEILRDQCVPIDGVIVNG---------------------------RDS
A0A255R1S0      IEKNNRTLVERAADILREQSTPAEAVIVNG---------------------------RAS
A0A5B9MKP1      IEKNSRTFVERAAEILRDHHVPIDGVIVNS---------------------------RDS
A0A351FYP6      YRKYPQLMTQRAKDMVIKVGGDLVGVVLNN---------------------------INI
A0A0S8J591      ASKNRRGLVMRAKNQLASVNARLAGAVLNN---------------------------VRG
A0A532UT69      ADKSTREASRRACASLSSVGAHILGVVVNN---------------------------VSK
A0A7V9G2R2      DGETKRSDLHTLRKELDPLAKKILGAVVIS---------------------------KTD
A0A2D5AWU0      LCVSTSPNAIRALGILRGVDARVVGTFVND---------------------------DSA
L0DC26          RDVSRIPTVHAAYERLSRLGIRMLGAIVTG---------------------------EQT
M5RT57          RNVSREGQVKIAHDRLTKAGIKPLGTVLNG---------------------------VPT
D5SZ21          PDKNQRRSVIRAAETLRMWGNNLLGLALNN---------------------------MSS
A0A7X7U1J4      AEISTRQTAIQAYEALSSVDATVLGVVVND---------------------------VPT
A0A7V8E5N8      EGRTGRGAARAAKNALIEMGVTVLGAVLNA---------------------------AEL
A0A356KTN1      ARTSSRSAATQANTELSRLGAAPVGLIFNQ---------------------------QPQ
A0A7Y5LV28      EGRTGRTVAQAAARRLKGMGVRMLGAVLNC---------------------------STG
A0A7Y5HFQ5      LGKTSIRGIRRACDHLNKVGAPLLGVVLNG---------------------------ASM
A0A7W1FMQ9      ERITEADVLADALVRLRPLTDHLLGVVVNG---------------------------DHL
A0A7W1NA62      DRVTSKSALGLAMRRLGPISEKVIGLVLND---------------------------ERR
A0A7V9JTP9      DRYTSKNLVRQVMARMLPIENKMLGTVLNG---------------------------ERR
A0A7W1FJ38      DRVTTKGTLRLVLDRLLPLRTKVLGLVFNA---------------------------ERI
A0A1G2YQB7      AGRTETPDLKESIERLKQININLIGIVLSN---------------------------VSY
A0A353P687      AGHTETPDLKDTIERLKQINVNLLGIVLSN---------------------------VKY
A0A356EME5      QDVSRASQVRTACERLVAAGCRPVAAVLNG---------------------------VSS
A0A3L7P4E4      MNGRTRMGAVRAAETLRTLGANILGLIANG---------------------------IDP
A0A3L7PEB5      MNGRTRMGAVRAAETLRTLGANILGLIANG---------------------------IDP
A0A1U9NL64      ADSSTRNVSVAACEALAGVGARPLGVVVTA----------------------------PG
A0A2N1UCJ3      AEKSTRKLAQQAREALAGIGARVLGAVVND---------------------------VSP
A0A7V2H881      AEKTTRPAGLSARDQLQSVGGRILGVVVND---------------------------VPR
A0A7C4EK84      SEKSSRRLARHALESLTSVGAKVLGVILND---------------------------VTR
A0A7C3F0T2      AEKSHRKFAERACQGLNDVGAHILGVVINA---------------------------VPR
A0A7X7U4K9      TGKSTRKMSQRAIHAMEGVGAHMLGVVVND---------------------------VHK
A0A2E0X4J3      AERATRRLCQAARNELWQVRAKRLGVVVNG---------------------------VPM
A0A838QZ11      AERSTRRMSLGARNELWRVRATRLGVVLNG---------------------------VPQ
A0A5C5YU10      AEKSTRRLSLAARDELWRVRAQRLGIVVNA---------------------------VPQ
A0A517MPZ6      ADCSTRRMSVAARDELWRVRAQRIGIVVNA---------------------------VPG
A0A5C6CNV7      ADRSTRRMSVASRDELWKVHAQRIGVVVNA---------------------------VPA
A0A518K5H4      AERSTRRISVGARDELLRVRTQRLGVVVNA---------------------------API
A0A5C6AA28      AERSTRRISVSARDELLKVRTQRLGVIVNA---------------------------APL
A0A2E7ESJ6      IHKRARPLALRARDALVTTGANVIGVVVNG---------------------------VDH
A0A2E9VK20      LHKNRRPSVKRALEMFEAHEIPLLGVIANG---------------------------LQD
A0A3D4PJK1      LHKNRRPSVKRALEMFEAHEIPLLGVIANG---------------------------LQD
A0A355AI52      PEKNRRRVLIKAVETLRMLGVTLFGTIVNA---------------------------VGL
A0A354PCQ3      RDVSRLDSIHQTTRRLEAAGASVIGTVFSG---------------------------VTS
A0A0S8GZ23      AGQTESSDLKETLDLLSQINVKILGNVLCN---------------------------VSP
A0A1I3DDV4      PAIDTKRKVFESIRRLTSSKSNLRGCILNT---------------------------YGS
A0A7V2UF66      AEKSHRKVAERARDALLGVGAQILGTVVNA---------------------------VPR
A0A2E0SMM6      PDKNRRGMVFRSIETLQMFGIHISGVVVNH---------------------------LTP
A0A3L7SI46      PDKNRRKLVLRAVESFRMSGVEVIGIVANH---------------------------IGS
A0A5B9PJZ8      ITNGVRSNSVRAKEVIDSMGVELSGVIING---------------------------LRR
A0A2S8G191      RDISRGVKVEEARELLNVFNVPFLGAVVVG---------------------------ITK
A0A2E7EGG1      RDVSRENHVRMTYHRLLSVGARPVGTVLNG---------------------------VPT
A0A2E2N5A9      SEVTSSTEVERGVAQLRQNATPVDWVILNQ---------------------------VDI
A0A7C8AGA2      VDRTSRPDLKEAIKRLERADAKILGTVVNN---------------------------VKV
A0A7C2FXP7      AKHTSRPELREAITRLEQIGVTILGTVLHN---------------------------VNM
A0A1P8WP26      PDKDRRRMVIRAAEALHNVGSNLLGVVVNH---------------------------LSG
A0A3L7V1F3      PDKDRRRMVIRATETLQTLGCTLLGVVINH---------------------------LTT
A0A2E3GWC6      MQKNNRPSIKRTLELLGSHGVNLMGVIANG---------------------------VEA
F0SLB0          MQKNNRPSIKRTLELLGSHGVNLMGVIANG---------------------------VEA
A0A3L7NDH9      PEKNRRRIIVRSVQTLRAFGVNIFGAVING---------------------------VGI
A0A7X8IIB9      VGQTSQIEMKQALARLQEIKANIIGTVVNN---------------------------VKT
A0A532UD06      ADKSTRRLSRQACDSLVSVGGHLLGAVVND---------------------------VKH
A0A660URN1      AEKSTRRLSRHARDNLLSVGGHLIGVVVND---------------------------VSQ
A0A517ZCB5      PDKNRRRMVMRAVEALSELGCNVYGLIVNH---------------------------VSP
A0A225EH48      QDISQLPKVLTASEKLTQLNIPLLGAVVNG---------------------------IKP
A0A518INW8      VQKNGRRPVERSRELLASNKVKVAGVIVNG---------------------------GER
A0A518JPH9      VQKNGRRPVERSRELLTSNKIKVAGIIVNG---------------------------AER
A0A5C5VEK8      AEKSTRSLSLAARNELWRVRTQRLGVVVNA---------------------------VPQ
A0A532UTJ0      AGHTTMPDLKEAKDRLAEINVKVLGTVLSS---------------------------VDA
A0A2E2CCW9      IDKNRRGVIRKVQQIIQTNGIKVAGILANS---------------------------VKS
A0A3C0AGX3      IDKNRRGVIRKVQQIIQTNGIKVAGILANS---------------------------VKS
A0A518AAQ5      IDKNRRGIIRKVQQVIQTNGIRITGLIANN---------------------------VIT
A0A517QBG9      IDKNRRGIIRKVQQIIQTNGIRITGLIANN---------------------------VIT
A0A518FTU3      IDKNRRGIIRKVQQIIQTNGIRITGLIANN---------------------------VIT
A0A517WHH5      IDKNRRGVIRKVQQIIQTNGIKITGLIANN---------------------------VIT
A0A5A8BGT3      IDKNRRGVIRKVQQIIQTNGIKITGLIANN---------------------------VII
A0A2E7K7A9      IDKNRRGVIRKVQQIIQTNGIKITGLIANN---------------------------VIT
A0A517PTS5      IDKNRRGVIRKVQQIIQTNGIKITGLIANN---------------------------VIT
A0A6I6AH34      IDKNRRGVIRKVQQIIQTNGIKITGLIANN---------------------------VIT
A0A517VTK3      VDKNRRGVIRKVQQIIQTNGINVTGILANG---------------------------IYN
A0A517WQT4      VDKNRRGVIRKVQQIIQTNRINVTGILANG---------------------------IYN
A0A517VID8      IDKNRRGVIRKVQQIIQTNGIKVTGILANG---------------------------VQS
A0A517RK10      LDKNRHGVIRKVQQIIQTNGIKVTGVLANG---------------------------IFS
A0A518IH18      LDKNRRGVMRKVQQVIQTNGIKVTGILANG---------------------------IFS
A0A7W0M4Y4      LGKRARAKGTEARDILERVGAKILGVVING---------------------------VNA
A0A2D5NDU9      GGSTSTKNVSAAYDALTQVNATVLGIVLNN---------------------------MPK
A0A5C5XLF4      LHKNRRPSVKRALEIFEAHEIPLLGVIANG---------------------------LQD
A0A518CHE5      PDKNRRGLVYRSVETLQMFGIHISGIVVNH---------------------------LTP
A0A1V5N3W2      AGHSNLTDFQETFHRLSQLHVRILGNVLAN---------------------------VAA
A0A517NSK8      IVKNGRRIAHRAITLLRQHDANVVGLVING---------------------------YQS
A0A5C5Z0D6      IVKNGRRSAKRARDILRQTGASIAAIVVNG---------------------------YQT
A0A7W5H7D9      IIKNGRKAAVRAADILRRSGSEVGAIIVNG---------------------------YQT
M5UE94          IIKNGRKSAIRACDILQRSGSEVGAIIVNG---------------------------YQS
A0A3E0MY27      RRVSQISNVYETCQRLQGTGIRLLGSVVNG---------------------------VSG
A0A7V4M591      PAKNRRRLLTRVVESLTLLKIPILGLVINR---------------------------VGS
A0A7X7F3G7      PEKNHRRAVIRAVEGLLSLRIPLLGLVVNH---------------------------AEG
A0A7Y4VQ32      ASHCRRSEAAEAVSLVSAAGGHTVGAVLVG---------------------------AEE
A0A2E0X9P6      SDVSQSQQVRRAARCLDATGSRIAGAVLSG---------------------------VPM
A0A1N6DAJ8      RDVSRIPKVQEAYERLAKLGIRMLGAIVTG---------------------------EKS
A0A2E8FLY0      PDKNRRRMVIRAAESMAAVEATLIGAVINH---------------------------IAD
A0A3D2U1E1      PDKNRRRMVVRATESLAAVGSTMLGAVINH---------------------------VTA
E8R3W3          RNQSRRDRVYDAYERLHRFGIPVLGTVVTA---------------------------ATS
A0A5C5ZM48      RDKSRGEQVREAGQRLQAAGVRLAGVVLNG---------------------------VPA
A0A5B9WF77      FEVSRSPQVERARRQLDNAGIPVLGTVING---------------------------LRS
A0A7C4Z5R7      RDVSRIPLVTAASQRLERLGVRLLGAVFVG---------------------------AKG
A0A1P8WN28      PDKTHRRSVARAVDQLRSMGLKIVGIVANT---------------------------SLS
A0A3B9CTT0      PATTHRSMISRTVDTLRSLDLTPVGVVVNM---------------------------GLS
A0A518ALT3      SDVSRARQVRLATEKLEATGARIAGTVLSG---------------------------VST
A0A286RGB6      RDISRAPQLRAARQVLESFHVRVLGAVMTG---------------------------SAE
A0A7V3TZQ6      RDISRAPQLRAARQVLESFHVRVLGAVMTG---------------------------SAE
A0A3M1QRP3      DGHSDRRDVLDAIQTLRSAGGTILGSVFNG---------------------------VPS
A0A517TMV0      PEKNHRRLVSRACDSFLTSGTPLLGVVANR---------------------------ITE
A0A3E0MY88      PAKNRRRLVTRAYESLRTMGVTVLGIVANR---------------------------IDQ
A0A518BBX8      LSKSGRHPAERAKELLSRHGVNVIGVVVNN---------------------------SDR
A0A5B9QF68      PEKNHRRSVIRAFESFQSVGCNVLGVVANA---------------------------LSD
A0A5B9QGF0      PEKNHRRSVIRAVESFQSVGCNVLGVVANA---------------------------LSD
A0A5C6CK24      PEKNHRRSVIRAVESFQSVGCNVLGVVANA---------------------------LSD
A0A7C5FXU1      RDVSRLPKVIDAYEILRALRVKMLGTVFLG---------------------------SKE
A0A847YFA1      RDTSRLPKVTAARKVLDAFNVRLLGAVVTG---------------------------AAE
A0A1C3E6N1      PDKNQRRSVIRAAETLRMWGNNLLGLALNN---------------------------MSS
A0A518GJT2      PDKNQRRSVIRAAETLRMWGNNLLGLALNN---------------------------MSS
A0A2E8B0L9      PEKNHRRLVLRAAEQLLSMGVNLIGVVPNR---------------------------VGD
A0A5Q4GFE7      PEKNHRRLVLRAIAGMSSMGVGLIGIVANR---------------------------IRH
A0A257WS34      PDKNRRRMVVRAVKSFIGAGVQVVGIAANH---------------------------LAN
A0A7C4LP10      PDKNRRKMVVRAVEAYRNTGVRVLGAVINH---------------------------LGD
A0A2E3RCU8      PEKNRRKVVFRAAQNLSEMKIPVYGLVANC---------------------------IKA
A0A517MLW3      PEKNSRRHVLRAIERLERFQTNVLGMVINA---------------------------MDA
A0A5B9QVD0      PEKNSRRHVLRAIERLARFNTNVYGLVING---------------------------LDS
A0A3A0DET7      AERSTRRSAIGARNELWRVHANRLGVVLNS---------------------------VPL
A0A3B8PNV4      PGTNRRRMVLRAAESITAIDADLLGVVINN---------------------------VDS
A0A3D1DR40      PGTNRRRMVLRAAESITAIDADLLGVVINN---------------------------VDS
A0A2E7RYU8      PGTNRRRMVLRAAESITAIDADLLGVVINN---------------------------VDS
A0A3B8LXG8      PGTNRRRMVLRAAESITAIDADLLGVVINN---------------------------VDS
A0A6M5Z0K7      PGISRVAEVHAGYERLREHRMPFLGVVVNG---------------------------VPQ
A0A350CI62      PDKDRRRMVIRAAETLRTLGCTLLGVVVNH---------------------------LNV
A0A4P5WQK6      PDKDRRRMVIRAAETLRTLGCTLLGVVVNH---------------------------LNV
A0A3C1X4W5      PDKDRRRMVIRAAETLRTLGCTLLGVVVNH---------------------------LNL
A0A3D3W3A7      PDKDRRRMVIRAAETLRTLGCTLLGVVVNH---------------------------LNL
A0A7Y5SKC2      PAKNHRRVLIRTVKSFSMLKIPVLGVVVNR---------------------------VDA
A0A7X7U104      AEQSMRRVSMQARDSLASVEARILGVVVND---------------------------VPL
F0SI78          NSKHSRPHAKQARESLDLVGAPLEGMVVNL---------------------------VCE
A0A517MDV3      TSNSSRPETERAVQRLQGVGVQAVGFVVND---------------------------IDR
A0A518IQ30      PAKNHRKLVIRSVEQLAQLGVQLTGIILNR---------------------------VDD
A0A517LWP4      PAKNHRKLVIRSVEQLGQLGVQLTGIILNR---------------------------VDD
A0A518JNW8      PAKNHRKLVIRSVEQLGQLGVQLTGIILNR---------------------------VDD
A0A2E3GWX1      PDRNRRRMILRAAESLQSLGANLLGVVVNR---------------------------LSD
F0SG60          PDRNRRRMILRAAESLQSLGANLLGVVVNR---------------------------LSD
A0A2E9VST2      PDRNKRRMIIRAAESVTSLGGNLLGVVVNG---------------------------LSD
A0A356A6X2      PDRNKRRMILRAAESVTSLGGTLLGVVVNG---------------------------LSD
A0A5C5XLM3      PDRNKRRMILRAAESVTSLGGTLLGVVVNG---------------------------LSD
A0A7V2UW16      FGRASRQEVREGKRQLTALGAKYLGAVFND---------------------------VPL
A0A518DRX3      PVKNNRRLVMRAVDEIRALDLNLIGVIANR---------------------------IDV
A0A518DZF9      PVKNNRRLVMRAVDEIRALDLNLIGVIANR---------------------------IDV
A0A2E7ENQ5      PSKNHRRLVHRAVDEIRAANLELIGVVINR---------------------------ISD
A0A7V2XSV8      HGRTSRHAVRHGRDQLVAFGATYLGAILNN---------------------------VPV
A0A847GXG1      PDKNHRRLVLRAVAGLTAVGVHVGGVIANK---------------------------IST
A0A7C5BZF0      PAKSTRRMVLRTIEQFQLLRIPVVGIVLNR---------------------------V-G
A0A847YGH5      PLKNTRRTLFRAIEHLRILKVPLIGLAVNR---------------------------LRG
A0A286RLF2      PEKNKRRAVIRAAEYLALLKIPLLGIVINR---------------------------LSN
A0A7V3TX18      PEKNKRRAVIRAAEYLALLKIPLLGIVINR---------------------------LSN
A0A1G3AQE9      PAKNRRRAVMRCVENLSVLKIPLLGIVLNR---------------------------IGS
A0A3L7UQT9      PDKNRRRMVIRAAEAFSAVEVNLMGVVVNH---------------------------LSS
A0A4P5YBU2      PDKNRRHMVIRAAEAFAAVEVNLLGVVVNH---------------------------LSS
A0A7C7V5U8      PEKNRRRLVMRAAESLTSLKINLLGVVINR---------------------------LAP
A0A3M1VCL4      PDKNRRKMVIRAAEAFRAVDVPLLGIVVNN---------------------------VSA
A0A518AKT8      PDKNHRRLVARACESFRNTGSQVLGVVAND---------------------------VS-
A0A5C5ZR72      RGVSRSRQVKMAAEKLDSAGANLAGAALSG---------------------------VA-
A0A7Y5SJZ4      PEKTRRRPALRAVGSIENFGVKVLGIVANH---------------------------VTF
A0A5C5V7Z9      PEKNHRRLVVRACDSFLHAGCHVHGVVANR---------------------------IS-
A0A5C5YT05      PEKNHRRLVVRACDSFLHAGCHVHGVVANR---------------------------IS-
A0A518D7F9      PEKNHRRLVSRACESFLSAGVHVLGVVANR---------------------------IT-
A0A5C5ZIP0      PEKNHRRLVARAYNSFLTAGVNMVGVVANR---------------------------IS-
A0A518KBK3      PEKNHRRLVNRACGHFTSGGAPLVGVVVNR---------------------------VS-
A0A5C6AKF9      PEKNHRRLVTRACSHFSTGGAPLLGVVANR---------------------------IS-
A0A7C2KUQ9      EGRCRRGDVADALALLWASGTKPLGTVIFA------------------------------
A0A7C5R0U3      PGKNRRRPVARAVDRLRALGVHLVGVVANR---------------------------VT-
A0A847YCQ7      QDGSRLARVYEAALKLRAVDMPLLGVVVHG---------------------------AH-
A0A286RD13      QDKSRLPRVFEAVQRLRSVDLPLLGIVLHG---------------------------TA-
A0A7V3TUJ6      QDKSRLPRVFEAVQRLRSVDLPLLGIVLHG---------------------------TA-
A0A517TY85      ADVSRAKQVRVAVERLHATGANVAGAVLSG---------------------------VS-
A0A5B9QEI7      ADISRAKQVRCAVERLQTTGANLAGVVLSG---------------------------VS-
                                                                            

A0A5S9IPR9      SYS-------------------------SQLSYYNYYGLYYSKSYYTRGLNKNPLGRNSK
A0A533Q9U4      SRD-----------------------------KYYY-QYYYQYYYHYGEKEAKEA-----
A0A533Q6B7      SDE------------------------------YRYHYYDKKERYYQKA-----------
A0A1U9NNE1      AHS------------------------------YNKYGYRYYKASSSPADKNGPTRNRPL
A0A2G2JCA2      SYY-----------------------------SYHYGHYGYNHA----------------
A0A1G2XVR0      SKG-----------------------------GYYSYYYSHYYKYGYGYGAEPPKEKRKR
A0A1G3B0P0      SKG-----------------------------GYYSYYYSHYYKYGYGYGAEPPKEKRKR
A0A1E3X4X0      SKG-----------------------------SYYYHYYQYYYRYGYGEEEEKKGRKKRR
A0A286U4B3      ARG-----------------------------DF------YGYGYGYGYGVEEKGKKGII
A0A5C6DDS2      AKG-----------------------------GYYQYGYQYGYQYGYGYGEDTGKKKGLI
A0A5S9IJB5      PKG---------RYYNSGY--------------YNYGYYGNDGLTT--------------
A0A2E3GW02      EET--------------SYRYEGGH---YRRGMYGS-NYNYGTNYSYHQRRYRYYYEGTD
A0A5B9QNZ7      LSR--------------QGDEGKYGYGYH----YGA-GGKAEKYFRPTASAK--------
A0A1Z8N7H5      NNK--------------GYSFGEGEG-------YGY-GYGYGDDENNDEDEGEIEQQGNR
A0A1U7CZ81      SDA--------------Y----------YGRYSYSR----GRSGYGEP-DASPTT-----
A0A142YNY8      SDS--------------Y----------YGRYSYSR-PGASTTDRERPADATSAG-----
A0A1U7GLS6      SDS--------------Y----------YGRYTYSR----QQSDRERPAGATPAD-----
A0A1G2YPI3      KGH------------------------------YGY-YGSYGYYYGDDRKKKKTGDRRPD
A0A532UIN2      NGR------------------------------YGY-YNGYGRNGKKKTGNREPAAGVRR
A0A0S8KNX5      E---------------------------HSYYRHGH-SYYAQSAQSRESARRSRRKLMFS
A0A3D3UVZ8      E---------------------------HSYYRHGH-SYYAQSAQTRESARVSRRKLMFS
A0A517NFU9      DAK--------------SYGYGN-----YQRDRYGY-VGHYHNQYAATNTENLPSVRTVP
A0A5C5YWH4      SSK--------------SYGYGS-----YSAGKYAY-VGDYHSQYEATDIES--------
A0A3D2TNK4      DSS--------------GYGYG-----------YGY-GYSYDGGYSHEEEQDMVDTADTM
A0A7C1Y4F0      KRG--------------QYGYYSSYG--N----YGY-YGKREKKTG--------------
A0A6I0ENW6      DPR--------------GGYYRG----------YDY-GSLARRPVEVSGV----------
A0A6L3A0B7      DPR--------------GGYYRG----------YDY-GSLARRPVEVSGV----------
A0A0J1B4A0      RSN--------------HYAYSSYDY--YGKKQYGY-VANYRRYYEANDDDDAGSAPRRK
A0A142WSB9      --A--------------AASTQTEGS-------YGN----YEEYYSTAPATSGGAARSKA
M5SZR3          SEL--------------DALGRARYG-------YGA-YEGYHQSRNGTTSKSPNRLTSNN
M5TW92          SEL--------------DALGRARYG-------YGA-YEGYHQSRNGTTSKSPSRLTSNN
A0A2S8FKY2      GM--------------------------Y----YSY-TNRSTSTVEVE------------
A0A517N8P6      SGY--------------SATYSQAWSDSYGGQPGGE-YGHSYYRYGSDRYLDASKGQTIT
A0A432MJP4      GSD--------------DAQFLHAGR--Y----YGR----YGRSYGSVDGSGPRTGSVWP
M5UQ35          RSG--------------DYGYSSYNY--YGKKENGY-VASYRRYYAASDVADEETPVSSS
A0A0S8FY64      KTL--------------RRYG-------S----YGY-YYYDYHRYYKDYQEDEGDELEMP
A0A1N6KFT7      QNA--------------SGYGQGYGY--G----YGY-GYGTYGRGDDGLDQITPSTKEIT
L0DFG4          QGT--------------GSYGQGYGYGQG----YGY-GYGTYGR--DEVSPIVSDGKEIA
A0A5C5XXG1      GKS--------------FDLGGGYYG--Y----YES-GYSRPT---NRTKPVTSARIVEV
A0A7C7YUM8      SRA---------------STSYGYGE--E----Y--------------------------
A0A7C2AHI6      TRA---------------GS----RS--Y----YGY-GYENDE---D-------------
A0A518BJJ1      DRS---------------SASDRYQG--D----YGY-GYTDAG---GDGGPPALEGVEAA
A0A518D182      EKA---------------KGAGAYSD--Y----YKA-RSAYYQ---DDRSP---------
A0A7V4HWU2      GRY--------------GYGYGAGYG--YG---YGY-GYGHGYGYGESDKVYYDEKTEQP
A0A5C5WTY6      -----------------PKEFHEQG--------YGY----QSDSYRSRIPVKSQPSKMAA
A0A5C5Y033      -----------------DKEFDAGVS--Q----YGY----YRNDYTRSSSQRKRG--RAA
A0A5C6G1Y2      -----------------DKEFDAGVS--Q----YGY----YRNDYTRSSSQRKRG--RAA
A0A354PDV6      -----------------QKEFSSDGG--Y----YGY----YRSGYSEVSVPQRSL-----
A0A5C6FZ02      -----------------GKSFDLGGG--Y----YGY----YESGYSRPTNRTKPV--TSA
M5TIT3          -----------------GKKFDSDGG--Y----YGY----YKSDYTRAASSNGRKPRVGE
A0A5M6CY44      -----------------GTKFDSAGG--Y----SGY----YESDYTRKSSRNGKA--VNG
F2AXG2          -----------------GKKFDSDGG--Y----YGY----YKSDYTRPSSSTTRQ--AAP
M2BB46          -----------------GKKFDSDGG--Y----YGY----YKSDYTRPSSSTTRQ--AAP
L7CLQ6          -----------------GKKFDSDGG--Y----YGY----YKSDYTRPSSSTTRQ--AAP
A0A0J1B719      -----------------GKKFDSDGG--Y----YGY----YKSDYTRPTSSATRQ--AAP
Q7UF18          -----------------GKKFDSDGG--Y----YGY----YKSDYTRPSSSTTRQ--AAP
A0A2G1W1E0      -----------------GKKFDSDGG--Y----YGY----YKSDYTRPSSSTTRQ--SAP
K5E235          -----------------GKKFDSDGG--Y----YGY----YKSDYTRPSSSTTRQ--AAP
A0A5C6FFI9      G----------------KRSSYGYGG--YRANEYAY-VGKYHNEYAA-----SEP--SSI
A0A5C5WDJ1      N----------------ALRSYQYGG--YGQNKYGY-VGRYHHQYGSKPVTKDDS--NTT
A0A5C5X547      ---------------------------------RGR-YDLYN------------------
A0A353FIP5      -----------------GQKGGDEKD--Y----Y------YEEGRSR-------------
A0A7V7MJI7      SRL--------------GSYGRSYGY--G----YGY-GYGYGYGYGYGSKGYGGN--NRA
A0A5B1CIK7      -----------------GQKFNVQGG--Y----YGY----YQSDYTKSPKKNGAV-----
A0A5C5WHS2      -----------------GKKFNVEGG--Y----YGY----YRSDYSRPASKNGSS-----
A0A5C6B6G8      -----------------GANFDGAGG--Y----YGY----YRSDYTRKKKNGRAE--AA-
A0A5C5ZZN3      -----------------GKKFDGGGG--Y----HGY----YKSDYTRPTNAG--S--KPA
A0A5C5XS91      -----------------AKAFDADGG--Y----YGY----YRSDYTRPTSKS--A--SAE
A0A5C6C4E6      -----------------SKAFDADGG--Y----YGY----YRSDYTRPKSKSAAA--AAE
A0A2E1VVJ1      SRL--------------QRDYSSYGY--G----YGY-------SYKQEGRSSGSE--L--
A0A3M2AEL0      PRL--------------GR-YSRYGY--S----YGY-------AYGY-GYGDGSK-----
A0A2A2W9R6      RRR--------------SYGYSSYNY--YGKGEYGY-VDSYRQYYESE----EED--S-S
A0A518HKC1      RRR--------------GYGYSSYNY--YGKGQYGY-VDGYRRYYESD----EEE--A-V
A0A518L3P0      RRR--------------GYGYSSYNY--YGKDQYGY-VDGYRRYYESD----DED--APT
A0A255R1S0      -RR--------------GYGYTGYNY--YSKKEYGY-VSTYRRYYEADADGQDED--RPI
A0A5B9MKP1      RRR--------------GYGYSSYNY--YGKGQYGY-VDSYRRYYEAE----EED--EPA
A0A351FYP6      SQD--------------SY-------------YYYYSGYYYDYYYKSRETEEEPVEDKKD
A0A0S8J591      TKG-----------------------------DYYY----------YRQRYQPVAEMMEE
A0A532UT69      KNS------------------------------YGY-YGGYKV-----------------
A0A7V9G2R2      PLK---LYGAYR---------------------SQQ-SHDAMTDISHG------------
A0A2D5AWU0      KKT---NAYAGG---------------------IAY-GAFRKVEALEA------PLPPRS
L0DC26          DHY---GSSYPS---------------------VSR-TDKR-------------------
M5RT57          RSY---AKTYGS---------------------YDY-ARRF------E------------
D5SZ21          DRA---GGYGYG---------------------YGY-GYGYGHTDTDGDHDDLLDDHASS
A0A7X7U1J4      RDH---RCGCYY---------------------ASR-G----------------------
A0A7V8E5N8      -NR---GAYGYG---------------------YGY-GYGY------A------EEKKGS
A0A356KTN1      DEA---GAYFYY---------------------YS--RYGY------G------GEPKDE
A0A7Y5LV28      QGG---A--------------------------YGY-GYGY------G------EAPRGG
A0A7Y5HFQ5      -GG---GYYYYY---------------------YYR-RYGYYGYTSDV------KEPGDG
A0A7W1FMQ9      TRP---G--------------------------YQY-EVSS------T------AERPTG
A0A7W1NA62      -GA---GAVGYY---------------------YNY-QYTL------A------NEPVAR
A0A7V9JTP9      ESD---GYYYYD---------------------YAY-KYGY------G------REPGSD
A0A7W1FJ38      DSA---GYGGYH---------------------YRY-QYGY------G------QRPDAG
A0A1G2YQB7      NKV---Y--------------------------YRY-GHDYYGKPATVKELKQNLPSENT
A0A353P687      NQI---Y--------------------------YPY-GYGYYGKTNVIKDVKQEPADNIV
A0A356EME5      RR-------------------------------YEY-SYGYYESVEE-------------
A0A3L7P4E4      TKH---G-------------------------GYGY-QYGVYGAGGRASKYYAEAPNKR-
A0A3L7PEB5      TKH---G-------------------------GYGY-QYGVYGAGGRASKYYAEAPNKR-
A0A1U9NL64      KKM---SKYGYGYGYGYGY-------------GYSY------------------------
A0A2N1UCJ3      KHS---RYGYYS--HYSYY-------------GYGY-GYGRKKE----------------
A0A7V2H881      RKG---VYGYYYADEGRYA-------------YYHY---------------------GRQ
A0A7C4EK84      SGE---P-------YGYAY-------------AYGY--------------------APLK
A0A7C3F0T2      KED---RYYHYS-GYGYYY-------------KHGY-GYGH---------------ERRR
A0A7X7U4K9      EGS-------------HYG-------------YYGA-GRGYYG-----------SNGNRR
A0A2E0X4J3      RGA---GSYGYGGGY-GYG-------------GYGY---GGYGDPVADEPLPSGRRKKSR
A0A838QZ11      RKH---GAYAYGDAD-GY--------------GYGY---GAYA--AIEEPASGRRPKKSR
A0A5C5YU10      SKG---GSYGYGYGYG-----------------YGY---GNYGEVAYGHEDQRSLGNRKK
A0A517MPZ6      RKQ---ANYSQGYGY-GYG-------------NYGH-SSGTYGDLAYGEPEPPVDISRRK
A0A5C6CNV7      RQQ---SSYSSGYGYGGYG-------------AYGH-AGGSYGESAYQLDAYPAN-GRRQ
A0A518K5H4      HRS---N-------FGGYS-------------GYGY---GSYGQVAYGHEDAAEARPAVR
A0A5C6AA28      HRA---S-------YGGYY-------------AYGY---GSNGQVAYGGEVAPEPAPSRR
A0A2E7ESJ6      ETS----------SYYSEY-------------KYGYAGYRYGYNSRYGEYSSDAQEQKAI
A0A2E9VK20      ASG--------------DY-------------QYRG-GYGGGYDKKSPYQQTNDIPEFLA
A0A3D4PJK1      ASG--------------DY-------------QYRG-GYGGGYDKKSPYQQTNDIPEFLA
A0A355AI52      EEM---GYGYGYGYGY-GY-------------GYGD-EYGLDDDGEYGDEEEEENYMRAA
A0A354PCQ3      RQY--------------VY-------------RYGDYQYALSGGDIHDDEFSDDNVSLGK
A0A0S8GZ23      SSS----------HYRYRY-------------GYGY-GYGRRRGDGNNDKRKRPKPKTLL
A0A1I3DDV4      SKEFTRDSGYYSSYNYYGY-------------GYGY-GYGNRGYGRRVKDNGSAETENGH
A0A7V2UF66      RED---RYYHYSGY---GY---------YYRRGYGY-GYG------YGSKRKKSSADQT-
A0A2E0SMM6      DQG---GEYYGYGYGY-GYNEDYGHEDTQAEQGYGDDGYGDDGYVGDGHADDGYRHAPAT
A0A3L7SI46      KSN---SEY--------GY-------------GYGY-SYG------YGHDDRSDTTTEAT
A0A5B9PJZ8      RDQ---KTYD---YKGGKY-------------GYGGYTYGGGYGSSYGKNYSGNAPTPAA
A0A2S8G191      ED---------------VY-------------NYTS----------QRNRKKQLVHVES-
A0A2E7EGG1      R----------------QY-------------ARRYGTYGYETASSYSADQEEVT-----
A0A2E2N5A9      KKA---E----------RH-------------GYRYSSYYDYYQYGSGSPS---------
A0A7C8AGA2      A------------HSYHRY-------------GYGY-GYGHASDGGQKRESKSHKRAETL
A0A7C2FXP7      SNS---YH---------QY-------------GYGYNAAGNNKSHGHTQNRRKMLLLTAK
A0A1P8WP26      SEA---E----------GY-------------GYGY-GYGYGYEENDTHPTDERRQPSHN
A0A3L7V1F3      TDT---D----------GY-------------GYGY-GYGYGYGYGHENEHEEQPER---
A0A2E3GWC6      TGG--------------EY-------------SYRG-GYG------GGYARQQPAKPTTP
F0SLB0          TGG--------------EY-------------SYRG-GYG------GGYARQQSAKPTTP
A0A3L7NDH9      EAD--------------GY-------------GYGY-GYGYGYGTPYGDEVEEESIDDAF
A0A7X8IIB9      TDS----------YRRYGY-------------GYGY-HYSAKKHPKRTPHKSRKTKTLLL
A0A532UD06      KRG---RYSY---YNYSGY-------------GYDS-GYDYGGYYDDDISAESRDQDEAN
A0A660URN1      RSG---RYGY---GRYGQY-------------GYYG-YCSYYGHYGYGRDERQRQYA---
A0A517ZCB5      QSD---SEY--------SY-------------GYGY-GYG------YGEHDNDADEDAQT
A0A225EH48      DIH--------------AY-------------GYNY------------------------
A0A518INW8      ADK---HFGYGEYVKPYEY-------------GYAT-QYT------RSYASKPNERPVAS
A0A518JPH9      GDK---NFGYGEYVKPYEY-------------GYAT-QYT------KSYSSKPQPRPVSS
A0A5C5VEK8      SRG---SSY--------GY-------------GYAYGGYGAYGEIAYGHEEDATLSSRKK
A0A532UTJ0      -----------------GH-------------GYYR-HHGYYTQSAQSREAAVGHKRKLM
A0A2E2CCW9      GKP---G----------DY-------------DYGS-GPGYSDYYIVPPQAQAKQADVPA
A0A3C0AGX3      GKP---G----------DY-------------DYGS-GPGYSDYYIVPPQAQAKQADVPA
A0A518AAQ5      NSL---A----------GY-------------DYID-SEGYQEYFQGPAQKTASPVAKPA
A0A517QBG9      NSL---A----------GY-------------DYID-SEGYQEYFQNPAQKTETPVEKPA
A0A518FTU3      NSL---A----------GY-------------DYID-SEGYQEYFQNPAQKTATPVEKPA
A0A517WHH5      NSL---V----------GY-------------DYID-SEGYQAYFEKPEPQTTKPAANPA
A0A5A8BGT3      NSL---V----------GY-------------DYID-SQGYQAYFEKPAAQDKKSAVNPV
A0A2E7K7A9      NSL---V----------GY-------------DYID-NEGYQAYFEKPAPEPAKPAANPA
A0A517PTS5      NSL---V----------GY-------------DYID-NEGYQAYFEKPAPEPAKPAANPA
A0A6I6AH34      NSL---V----------GY-------------DYID-SEGYQAYFEKPATQTSKPAANPA
A0A517VTK3      GKS---G----------KY-------------RYRG-GEGYHDYYLTPQQNNSPEPTVSV
A0A517WQT4      GKS---G----------KY-------------RYRG-SEGYHDYYLAPQQNNSPEPTVSV
A0A517VID8      GKL---G----------DY-------------DYGS-GPGYSDYYIVPSQVQAKQADATA
A0A517RK10      GRY---G----------EY-------------DYGA-GEGYQEYFEAQPKKKIRQPAVPV
A0A518IH18      GRY---G----------EY-------------DYGA-GEGYQEYFEAQPKKKTTQPVVPA
A0A7W0M4Y4      RGE---Y----------GY-------------QSGY-RYTAASTARYGYGETYFNNDYVD
A0A2D5NDU9      MKG---EVAY-------SY-------------GYGY-GGGVQARQPYAFTAAGPEVEVTR
A0A5C5XLF4      GSG--------------DY-------------QYRG-GYG------GGYDKKSPYQQTND
A0A518CHE5      DQG---SDYY-------GY-------------GYGY-GYSEDYGHEESTGEDGYDEDGYG
A0A1V5N3W2      RHS----------YNRYGY-------------GYGY-GYG------HKHNPPDGKQIDMK
A0A517NSK8      SNK---NYGYIEKYDSDSY-------------GYGY-GPTSGGYYRSADATAETVKVSSR
A0A5C5Z0D6      KDR---SYGYTGGYDAEAY-------------GYGY-GETHKAYYRESKKGSRPLQSTSS
A0A7W5H7D9      KDK---SYGYSGGYDADAY-------------GYGY-GESHKAYYGD-NVN--TLQSV--
M5UE94          KDK---KYGYTGGYDADAY-------------GYGY-GESHKAYYGE-KSAPFDLQSVS-
A0A3E0MY27      SQV---S------VGYYGY-------------GYGY-EDG------YGREELSHEVAES-
A0A7V4M591      DAD---KSYYGYHSGY-GY-------------GYGG-GYGYGYGYGYGAEEEDELLEEGE
A0A7X7F3G7      DDR---GGYYGYGYGY-GY-------------EYSG-GYG---------NDEDDYTDETE
A0A7Y4VQ32      TLP---Q----------KG-------------AYNR-YYG--------------------
A0A2E0X9P6      R----------------RY-------------TYAY-DYRPRAAADYGSGEAF-------
A0A1N6DAJ8      D----------------HY-------------GSKY-EYS------ARTRESV-------
A0A2E8FLY0      TAG---SEYY-------GC-------------GYEY-DSK------EDEE----LKQAA-
A0A3D2U1E1      EAG---GDYY-------GY-------------GYGF-EYG------SGEESSDGLKQAA-
E8R3W3          PKR---YGYDP--YGYYSY-------------GYTY-YYQ------HQRASEDGAA----
A0A5C5ZM48      K----------------QY-------------ATRY-GQP------YGDEGAEPVGAESY
A0A5B9WF77      SD---------------SY-------------YGRY-TYS------RQRATQTPSADAV-
A0A7C4Z5R7      D----------------VY-------------GHSY-QYT------ASAAN---------
A0A1P8WN28      EDT---S----------SY-------------GYQY-GYGYGNDYGYGHDDEEDDLDSVD
A0A3B9CTT0      SEK---EGQ----GYGYGY-------------GYGY-GYGYESQYGYGHDEDDDEYDQM-
A0A518ALT3      KSY---V------YAYGRY-------------ASLQ-GQA--------------------
A0A286RGB6      DV---------------YY-------------AYPY-HSP------IVEGDSQRQEAPER
A0A7V3TZQ6      DV---------------YY-------------AYPY-HSP------IVEGDSQRQEAPER
A0A3M1QRP3      RGG---YYYHG------SY-------------GYGS-AARNV----YGPATDNDPLDVRV
A0A517TMV0      QAG---K----------GY-------------GYGY-GYG------YGHDDTAEALEEKP
A0A3E0MY88      DQS---KGYGY------GY-------------GYTY-SYN------YGGSDEETHHVEEP
A0A518BBX8      GTR----------YGYGGY-------------GYAY-SYGNEKYLDESPLSSDSQDAT--
A0A5B9QF68      ESQ---S------YGYGGY-------------GYGY-GYGSDYGSDYGNDEEAFEEEVSD
A0A5B9QGF0      ESQ---T------YGYGGY-------------GYGY-GYG--YG--YGHDEEEFGDE--V
A0A5C6CK24      ESQ---T------YGYGGY-------------GYGY-GYG--YG--YGHDEQDFEDV--D
A0A7C5FXU1      DG-----------YYYHHY-------------RRYY-LAP------AAVEDKETK-----
A0A847YFA1      DV-----------YYYD----------------PRY-AAT------AAEADSQS------
A0A1C3E6N1      DRA---GGY--------GY-------------GYGY-GYG------YGHTDTDGDHDDLL
A0A518GJT2      DRA---GGY--------GY-------------GYGY-GYG------YGHTDTDGDHDDLL
A0A2E8B0L9      DSS---GYYGG--Y-GYGY-------------GYGY-GYD------DGYGM---------
A0A5Q4GFE7      ESG---GGYFG--YGGYGY-------------GYGY-GYR------DGYGQPADEARIDQ
A0A257WS34      SPS---Q-DYG--Y---GY-------------GYGY-GYG------YGHDDAIEDPALAA
A0A7C4LP10      VGQ---EYGYG--Y---GY-------------GYGY-GYG------YGHDDATDPQTGGD
A0A2E3RCU8      ENG---KGYNF--GEGEGY-------------GYGY-GYG------DDDSGSLDEADGTT
A0A517MLW3      STA---DGA----Y---GY-------------GYGY-GYG------YGDELTDEKQAVVM
A0A5B9QVD0      ASS---DRAYG--Y---GY-------------GYGY-GYG------YGDDNQDEKIHLI-
A0A3A0DET7      RKQ---AAY--------GY-------------GDPY-GYG------YGHQYGYGEYAAIE
A0A3B8PNV4      DTG---GDYD-------GY-------------GYEY-GGE------DEPASSPHRLAA--
A0A3D1DR40      DTG---GDYD-------GY-------------GYEY-GGE------DEPASSPHRLAA--
A0A2E7RYU8      DTG---SDYD-------GY-------------GYEY-GGE------DEPASSPHRLAA--
A0A3B8LXG8      DTG---SDYD-------GY-------------GYEY-GGE------DEPASSPHRLAA--
A0A6M5Z0K7      -----------------SH-------------AYAP-GYG------RSIVPVATVVETGQ
A0A350CI62      DDA---GGYG---YGY-GY-------------GYGY-GYG------YGHDQEPEEQSGSG
A0A4P5WQK6      DDA---GGYG---YGY-GY-------------GYGY-GYG------YGHDQEPEEQSGSG
A0A3C1X4W5      DDA---GGYG---YGY-GY-------------GYGY-GYG------YGHDQEPDEQSGAG
A0A3D3W3A7      DDA---GGYG---YGY-GY-------------GYGY-GYG------YGHDQEPDEQSGAG
A0A7Y5SKC2      GKS----------Y---YY-------------GYDG-SYH------YDYQSYDDSEIEFD
A0A7X7U104      KSG---RYGY---YGGYGY-------------RYYG-QYG------NGKQKKSRPKTTVA
F0SI78          ETS---YRYEGGHYRRGMY-------------GSNY-NYG------TNYSYHQRRYRYYY
A0A517MDV3      LAK---QGDEV------DA-------------GYGY-EYG------GQRKVNAYFRAPQS
A0A518IQ30      STA---GSQFG--YGY-GY-------------GYGY-GYG------YGDEEQDDVVESLP
A0A517LWP4      SVS---GGQFG--YGY-GY-------------GYGY-GYG------YGDEEQDDTVDALP
A0A518JNW8      SVS---GGQFG--YGY-GY-------------GYGY-GYG------YGDEEHDDAVEALP
A0A2E3GWX1      SSG---EYSYG--Y---GY-------------GY---GYG------YGHEDPVQDQPAAW
F0SG60          SSG---EYSYG--Y---GY-------------GY---GYG------YGHEDPVQDQSAAW
A0A2E9VST2      SRG---EYGYG--Y---GY-------------GYGE-GYG------EGHDDPTHDDE---
A0A356A6X2      SRG---EYGYG--Y---GY-------------GYGE-GYG------EGHDDPTNEVE---
A0A5C5XLM3      SRG---EYGYG--Y---GY-------------GYGE-GYG------EGHDDPAYEGE---
A0A7V2UW16      NTR----------WYGKLY-------------GHQY-PYA------YYEKYAGYYK----
A0A518DRX3      AQA---GYY--------GY-------------GYGY-GYG------ENDSDDDHISPTST
A0A518DZF9      AQA---GYY--------GY-------------GYGY-GYG------ENDSDDDHISPTST
A0A2E7ENQ5      DGD---SAY--------GY-------------SYGY-GQG------YGHGYHEDANVDDD
A0A7V2XSV8      RRR---RYGYG--YGGYGY-------------GYGY-GYG------SGGYYEQYGGYYG-
A0A847GXG1      EKN---STYYG--YSGYGY-------------GYGY-GYG------EPAADDELDDQQTD
A0A7C5BZF0      LKE---ADYYG--YG--YY-------------GYEY-EES------DGPADEELQQDLAD
A0A847YGH5      EEQ---ARYAG--YSGDYY-------------G----------------AEAEETAAAAP
A0A286RLF2      EKE---KDYSG--YSGDYY-------------G----------------QPDESHEEKEV
A0A7V3TX18      EKE---KDYSG--YSGDYY-------------G----------------QPDESHEEKEV
A0A1G3AQE9      EKE---GGYYG--YGYGGY-------------GYGY-IYK------YGADADSKDESELA
A0A3L7UQT9      DSS---GDYYG--YGY-GY-------------GYGY-GYG------YGYGHDDANAAAE-
A0A4P5YBU2      DSS---GDYYG--YGY-GY-------------GYGY-GYG------YGYGHDDANAAAE-
A0A7C7V5U8      DKD---GGYYG--YDA-GY-------------DYQY-A-G------QPDGLDETDGPPGG
A0A3M1VCL4      EDG---DGYYG--YGY-GY-------------GYGY-GYG------YGYAESDD------
A0A518AKT8      --D---MHGSG--YGY-GY-------------GYSY-HSE------DEEEPLPGEA----
A0A5C5ZR72      --------------PM-GY-------------GSVY-AYG------YGFPEQEE------
A0A7Y5SJZ4      EKK---QSYYG--YGY-GY-------------GYSY-HYG------YGHEEEAPAEEEAM
A0A5C5V7Z9      --N---KSEGG--YGY-GY-------------GYGQ-QYG------YGHTEEEE-LAPVA
A0A5C5YT05      --N---KSEGG--YGY-GY-------------GYG---YG------YGHSDEEERVEEKV
A0A518D7F9      --Q---GGGHG--YGY-GY-------------GYG---YG------YGHDEPDT------
A0A5C5ZIP0      --E---QAGKG--YGY-GY-------------GYG---YG------YGHTETND------
A0A518KBK3      --D---QIGKG--YGY-GY-------------GYG---YG------YGHEEEEH------
A0A5C6AKF9      --E---QAGKG--YGY-GY-------------GYG---YG------YGVDEADH------
A0A7C2KUQ9      ------SRNRI--GYP-SY-------------TVLP-SPR------PANSADSA------
A0A7C5R0U3      --P---EPGDD--YGY-GY-------------GYGY-GDS------RDGDGDDA------
A0A847YCQ7      --F---RRYRS--YYR-RY-------------TIDV-ATQ------PAGKA---------
A0A286RD13      --P---SRYRS--YYR-SY-------------TIDV-ESR------AAE-----------
A0A7V3TUJ6      --P---SRYRS--YYR-SY-------------TIDV-ESR------AAE-----------
A0A517TY85      --P---SHYVY--NYG-AY-------------GAHR------------------------
A0A5B9QEI7      --V---NRYVY--HYG-SY-------------GQHE------------------------
                                                                            

A0A5S9IPR9      INPLVDNTKKS-------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      LLTSGN------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      EKR-----EKKEINV---------------------------------------------
A0A1G3B0P0      EKR-----EKKEINV---------------------------------------------
A0A1E3X4X0      SKG---------------------------------------------------------
A0A286U4B3      ERMKWTKGKEKVENT---------------------------------------------
A0A5C6DDS2      ERM---KGKIKLKNV---------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A2E3GW02      A-----------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      DSYQGISFQSKTFDQSENXQEKLPAKFRKTA-----------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A1G2YPI3      GVVKDSALDAKAID----------------------------------------------
A0A532UIN2      TVVSPSRMAKDSRWRTPLMKT---------------------------------------
A0A0S8KNX5      VDGGVDHSSGLETSVAERSADNYSYTQSSESRKDTGRK--RKKPRLSVEDGAD-------
A0A3D3UVZ8      MEEGADNTYDSKIPESDKPGEGFSYSQSVESRKSVMRKRTRKKPPVSNEDIADADNTDTS
A0A517NFU9      SPKGELGPKGEAGLSGELGPKGRSSRSSERASL---------------------------
A0A5C5YWH4      ----------------TIPQRSPRILAAERSVG---------------------------
A0A3D2TNK4      MTPMPEIVQLPSIASEEHLPSASPQEHQSHETPFQTKSANSTTPLKPRRVA---------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      RSSSKRTAAASTRSLPIPEAASSNGHVANGSTVNGSSNGHPTT-----------------
A0A142WSB9      AAGKLW------------------------------------------------------
M5SZR3          GHANGALVTSTGDVEVNGHGDKHSSNPLEERGNPNS------------------------
M5TW92          GHANGALVTSTGDVEVNGHGDTHSSNPLEERGNPNS------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      VRSQRSRNADPARAATLSEPVKTTE-----------------------------------
A0A432MJP4      SGTAAGEGASASWAPASLLRRLRTGGPGPGFGNGGRGVNGNGKLG---------------
M5UQ35          ARLSAAKLRGVSGLPAQEGRPSRIDVFADGPVMEEQSVNGHSHENVKSGGLNGVASTEAR
A0A0S8FY64      ASVPVAVEDERPDDGPDEEGSAERFEPGTVSFVVRGGQDFSFSFELEDGQQTVVGRSSAE
A0A1N6KFT7      TSVSSSESTNGLPQPLLKD-----------------------------------------
L0DFG4          AFGPPSKPTNGLPQGILKD-----------------------------------------
A0A5C5XXG1      DNDA--------------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      LPSELEREVASASARDERF-----------------------------------------
A0A518D182      -----DRQAA--------------------------------------------------
A0A7V4HWU2      AGGNGAAANGKSSGKSPDKPSGKSATSAKSQPSK--------------------------
A0A5C5WTY6      IRSFAAEESVI-------------------------------------------------
A0A5C5Y033      ATPGSVNNAA--------------------------------------------------
A0A5C6G1Y2      SATGSVNNAA--------------------------------------------------
A0A354PDV6      QNGAIPSYNGRVGSVITTRASDIGSRD---------------------------------
A0A5C6FZ02      RI-VEVDNDA--------------------------------------------------
M5TIT3          SSASAATVNGRASHD---------------------------------------------
A0A5M6CY44      RAKAGRQLSARKTDS---------------------------------------------
F2AXG2          KA-ATISSNGRVAE----------------------------------------------
M2BB46          KA-ATISSNGRVAE----------------------------------------------
L7CLQ6          KA-ATISSNGRVAE----------------------------------------------
A0A0J1B719      KA-ATISANGQPKSK---------------------------------------------
Q7UF18          KA-ATISSNGRVAE----------------------------------------------
A0A2G1W1E0      KA-ATISSNGQPKPE---------------------------------------------
K5E235          KA-ATISSNGRVAE----------------------------------------------
A0A5C6FFI9      STLPRVKGATKSATSSGSPNASRAVVLGSATPTLPGMASQKAALE---------------
A0A5C5WDJ1      TLEDTWENRLRHSDDLGSRLHHNIDRLNEIVKN---------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A7V7MJI7      KKD---------------------------------------------------------
A0A5B1CIK7      ------------------------KPL--PARSAAISSDIAGRDG---------------
A0A5C5WHS2      ------------------------KRIASPARASSIPTDMN-------------------
A0A5C6B6G8      ------------------------RPIGSLPAAAKTENESDA------------------
A0A5C5ZZN3      RSG---------------------SLNGFSAAPAEAPVNGKAH-----------------
A0A5C5XS91      RTSRVATVQVNGKSQANGKA----QANGKASAGGNASANGKAKTK---------------
A0A5C6C4E6      RSNRVATAQVNGKAHTNGHANGTSQTNGTSQTSGKAKTNGKVKSK---------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      PTSKRS------QKRINGEAAKLNGRS-ARDRLISGKR----------------------
A0A518HKC1      ISNGRS------RKRVNGEAVKMNGRG-ASDRLITGKR----------------------
A0A518L3P0      SSNGRS------RKRVNGKAAKMNGHA-ASDRLITGKR----------------------
A0A255R1S0      RSARAATSSRVVNGKVNGHAKHASDVAEAAHPVTLDRK----------------------
A0A5B9MKP1      RVNGRS------HKRINGQVAKVNGRTATSDRLISGKR----------------------
A0A351FYP6      GKEEKLIAQADAAGEDVNP-----------------------------------------
A0A0S8J591      AGV---------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A7V9G2R2      ------------------------------------------------------------
A0A2D5AWU0      DAGV--------------------------------------------------------
L0DC26          ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
D5SZ21          HSSYSSRTAA--------------------------------------------------
A0A7X7U1J4      ------------------------------------------------------------
A0A7V8E5N8      AQGIEA------------------------------------------------------
A0A356KTN1      ES----------------------------------------------------------
A0A7Y5LV28      SRAPARG-----------------------------------------------------
A0A7Y5HFQ5      RPTRE-------------------------------------------------------
A0A7W1FMQ9      VTGVTGVGAA--------------------------------------------------
A0A7W1NA62      S-----------------------------------------------------------
A0A7V9JTP9      PVAKPA------------------------------------------------------
A0A7W1FJ38      RT----------------------------------------------------------
A0A1G2YQB7      SEKVKQQV----------------------------------------------------
A0A353P687      IPEVK-------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      -----EEDDKSSAKSA--------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7V2H881      KPANGAPKSNGDGATAPSGESVAS------------------------------------
A0A7C4EK84      RTAPGNGNGRASHTASHA------------------------------------------
A0A7C3F0T2      RKTARGDKEHVGNPEGQLPTVSQR------------------------------------
A0A7X7U4K9      KSLHAAETPSVATVKTSQEGCACC------------------------------------
A0A2E0X4J3      VIEPVAAETE--------------------------------------------------
A0A838QZ11      ALIQATATAAAPEAPAETF-----------------------------------------
A0A5C5YU10      RLIQARPETPAVVEQT--------------------------------------------
A0A517MPZ6      KSRARSQQLPSPEATSEAMEPLDI------------------------------------
A0A5C6CNV7      KGLAISAKAETPSTDPAETSEIST------------------------------------
A0A518K5H4      RRLKSMADEDLTSIDG--------------------------------------------
A0A5C6AA28      RLLKQDLEPELGAVDS--------------------------------------------
A0A2E7ESJ6      SKYYDDESSQTLQHESPYQS----------------------------------------
A0A2E9VK20      PTQAVIPS----------------------------------------------------
A0A3D4PJK1      PTQAVIPS----------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      GG----------------------------------------------------------
A0A0S8GZ23      ISGPGSK-----------------------------------------------------
A0A1I3DDV4      SLAGSTPAGRK-------------------------------------------------
A0A7V2UF66      ------------------------------------------------------------
A0A2E0SMM6      LEYANYDQQYESGYEDDDYEANPYHAA---------------------------------
A0A3L7SI46      DDEYEVKTPMAA------------------------------------------------
A0A5B9PJZ8      NTPSHQPPIPNLVDAKSSSKSRN-------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      LLTSEPRDETGDESGSS-------------------------------------------
A0A7C2FXP7      VAKINAAAVKV-------------------------------------------------
A0A1P8WP26      QADVAVSLSMIGSGPEPEDS--ADKKAA--------------------------------
A0A3L7V1F3      --DVASGLSALASGKSREADLRERNRAA--------------------------------
A0A2E3GWC6      PPILTKQ-----------------------------------------------------
F0SLB0          PPILTKQ-----------------------------------------------------
A0A3L7NDH9      VTDDALADHEDSNVDDGSDPGVEDRVLPMNPRSGTSSRSRGASNPRAVA-----------
A0A7X8IIB9      GEVAGATETTQ-------------------------------------------------
A0A532UD06      VHVHV-------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      LPAGPKFVSPEQLRKSA-------------------------------------------
A0A225EH48      --------------------------------------------------------VKQL
A0A518INW8      SSV---------------------------------------------------------
A0A518JPH9      ASV---------------------------------------------------------
A0A5C5VEK8      RLIKSRPAPAESATVVEQT-----------------------------------------
A0A532UTJ0      FSMEEGADDGKDSETPDGGVTTDV------------------------------------
A0A2E2CCW9      KTKITH------------------------------------------------------
A0A3C0AGX3      KTKITH------------------------------------------------------
A0A518AAQ5      RTEVTS------------------------------------------------------
A0A517QBG9      RTEVTS------------------------------------------------------
A0A518FTU3      RTEVTS------------------------------------------------------
A0A517WHH5      KTEVTS------------------------------------------------------
A0A5A8BGT3      KTEVTS------------------------------------------------------
A0A2E7K7A9      KTEVTS------------------------------------------------------
A0A517PTS5      KTEVTS------------------------------------------------------
A0A6I6AH34      KTEVTS------------------------------------------------------
A0A517VTK3      HTEVPG------------------------------------------------------
A0A517WQT4      HTEVPG------------------------------------------------------
A0A517VID8      KTKITQ------------------------------------------------------
A0A517RK10      NSDITG------------------------------------------------------
A0A518IH18      NTEITS------------------------------------------------------
A0A7W0M4Y4      DEQKERRPVRHVNGRSKQTVVRDV------------------------------------
A0A2D5NDU9      QPTSGPSRDSSAADDGHADERPSAD-----------------------------------
A0A5C5XLF4      MPEFLAPTQAVIPS----------------------------------------------
A0A518CHE5      DGNYQKEPAILGYTSPDSGQDAGYEDDDYETNPYQAA-----------------------
A0A1V5N3W2      QLMLLLRPDEKKKDTSPSEESSKN------------------------------------
A0A517NSK8      DAEEAPVAAGSRV-----------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
A0A7W5H7D9      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7V4M591      EEGAGVAVSDVAEEPPP--------DADDPEPPARNIRRRAA------------------
A0A7X7F3G7      A---------VVDTRPPRDERFHNTDPDGGGRPDGIVPRRAA------------------
A0A7Y4VQ32      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      AANETSV-----------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A7C4Z5R7      ------------------------------------------------------------
A0A1P8WN28      FPPPPSSDLGKVA-----------------------------------------------
A0A3B9CTT0      ------TDGELAA-----------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A286RGB6      G-----------------------------------------------------------
A0A7V3TZQ6      G-----------------------------------------------------------
A0A3M1QRP3      I-----------------------------------------------------------
A0A517TMV0      LAA---------------------------------------------------------
A0A3E0MY88      LPHAESPELAAPGSVSFELDSTAPWPPQTQQQVVHDGTTVPRKVA---------------
A0A518BBX8      ------------------------------------------------------------
A0A5B9QF68      ADEPQESIPDPATKRSRTPRRKQGPTEPIRPRRAA-------------------------
A0A5B9QGF0      ADEPLETIPHPSTKMSVTPRRKTSPTDPIRPRRAA-------------------------
A0A5C6CK24      ADSEELIVPHPATQVGVSLRRKETSTDPIRPRRAA-------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A847YFA1      ------------------------------------------------------------
A0A1C3E6N1      DDHASSHSSYSSRTAA--------------------------------------------
A0A518GJT2      DDHASSHSSSSSRTAA--------------------------------------------
A0A2E8B0L9      ----------DEEDEDDIQTSASDSIQPRRAA----------------------------
A0A5Q4GFE7      DRFASGETDWSDEEDSDVPPGAP---HPRNAA----------------------------
A0A257WS34      MEDDDGYRIAA-------------------------------------------------
A0A7C4LP10      DGGDDAHELQPVRRAA--------------------------------------------
A0A2E3RCU8      LNAEDNYADINFQMRPLDQKVSEIENASIHFRKSA-------------------------
A0A517MLW3      PSQNAVSQSELVVHTDSAAPKTAPVRRSTPRRRAA-------------------------
A0A5B9QVD0      --------AEPTADQPPAAPQAP--RRAAPRRRVA-------------------------
A0A3A0DET7      EASAPDRGRKKSRALVKAATEPAITSQE--------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A6M5Z0K7      PL----------------------------------------------------------
A0A350CI62      GHSG------SPEQPVAAGHSVSAGLYSISVGGSRSSGDSSRAA----------------
A0A4P5WQK6      GHSG------SPEQPVAAGHSVSAGLYSISVGGSRSSGDSSRAA----------------
A0A3C1X4W5      SQPS--------------------------------------------------------
A0A3D3W3A7      SQPSLSGYGMTSGQSATAGQSVSAGLYSISVGGSRGSGDSSRAA----------------
A0A7Y5SKC2      DDFAPDDEIAPRRVA---------------------------------------------
A0A7X7U104      VEAREIAVPLKEYRATRTKPEKAPTGTTNASITLSEFWKDVARDRRGRLEDDSSKQTSV-
F0SI78          EGTDA-------------------------------------------------------
A0A517MDV3      NG----------------------------------------------------------
A0A518IQ30      LQQAPTQAPHRKVA----------------------------------------------
A0A517LWP4      MQQAPTQPPHRKAA----------------------------------------------
A0A518JNW8      MEQTPTQSPHRKAA----------------------------------------------
A0A2E3GWX1      SDFYDAEPERQKKERKRFSRKAA-------------------------------------
F0SG60          SDFYDAEPERQKKERKRFSRKAA-------------------------------------
A0A2E9VST2      EEAIPMTQSNSHRPRKRFSRDESSDRYAA-------------------------------
A0A356A6X2      EEAIPISNNNSQRPRKRFSRDQSSDRYAA-------------------------------
A0A5C5XLM3      EEAIPISNNNSQRPRKRFSRDQSSDRYAA-------------------------------
A0A7V2UW16      ------------------------------------------------------------
A0A518DRX3      TATSTPQHSPVVRRPDRSTSSQPTSTPTTPTRRRPAATQSDDHQPQ--------VTRRRA
A0A518DZF9      TATSTPQHSPVVRRPDR-TSSQPTSTPTTPTRRRPAATQSDNHQPQ--------VTRRRR
A0A2E7ENQ5      PTTLPIQDPQVFQRP-----ADDASEPR------------------------------RR
A0A7V2XSV8      --------------------EDDEGK----------------------------------
A0A847GXG1      APMLSVVGAEPDSKPE----TVTAPKPE-----------------------LRRVRRPRR
A0A7C5BZF0      DAV-----------------KKEISPPTVAAEETAGELGGEDNREFGGEIVPSNLRKVRR
A0A847YGH5      PAT-----------------PDAAPDAETPAGEDAFRMEPEEDTPAEASIPLRGRIVPRR
A0A286RLF2      PEI-----------------TESISTPE--------------------------RTVPRR
A0A7V3TX18      PEI-----------------TESISTPE--------------------------RTVPRR
A0A1G3AQE9      EAAAIGKDAAGAQGNGVSRWKEADPPPG--------------------------LVP-RR
A0A3L7UQT9      ----------SEHEAG----DEEPASDE--------------------------VQPLRR
A0A4P5YBU2      ----------SEHEAG----DEEPASDE--------------------------VQPLRR
A0A7C7V5U8      HPSLVAENTLAGHTCG----QPDSSPPG--------------------------IVPQRR
A0A3M1VCL4      ---------EEHDGKRRSGRGKRAKKAA--------------------------------
A0A518AKT8      ----------------SLPHDDDSRRAA--------------------------------
A0A5C5ZR72      ----------------RPEGLVGVPGGV--------------------------------
A0A7Y5SJZ4      EAG-------------AGVAPVRIRRVA--------------------------------
A0A5C5V7Z9      APPTSPVDPDPRDWRRLGGDDADPARAA--------------------------------
A0A5C5YT05      EHDLSPVEPAAASWRRPTEGPADADRAA--------------------------------
A0A518D7F9      ----------------EDDTPIAPLRAA--------------------------------
A0A5C5ZIP0      ----------------EILENNAPGKAA--------------------------------
A0A518KBK3      ----------------VSHADENRPMAA--------------------------------
A0A5C6AKF9      ----------------DEPNDRSLPVAA--------------------------------
A0A7C2KUQ9      ----------------LETPSLPASQ----------------------------------
A0A7C5R0U3      ----------------SATLPLRGSRAA--------------------------------
A0A847YCQ7      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A7V3TUJ6      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      ------------------------------------------------------------
A0A533Q9U4      ------------------------------------------------------------
A0A533Q6B7      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A2G2JCA2      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A5C6DDS2      ------------------------------------------------------------
A0A5S9IJB5      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A5B9QNZ7      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A532UIN2      ------------------------------------------------------------
A0A0S8KNX5      KTDDPETPRTS-------------------------------------------------
A0A3D3UVZ8      ETDSENRPTEA-------------------------------------------------
A0A517NFU9      ------------------------------------------------------------
A0A5C5YWH4      ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A7C1Y4F0      ------------------------------------------------------------
A0A6I0ENW6      ------------------------------------------------------------
A0A6L3A0B7      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A517N8P6      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          LSDR--------------------------------------------------------
A0A0S8FY64      CDIGLPSASVSPQHCRIANSGGRIVVEDLGSANGTFVGYRRVRRATVGPGDVIRISPYTI
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
A0A5C5XXG1      ------------------------------------------------------------
A0A7C7YUM8      ------------------------------------------------------------
A0A7C2AHI6      ------------------------------------------------------------
A0A518BJJ1      ------------------------------------------------------------
A0A518D182      ------------------------------------------------------------
A0A7V4HWU2      ------------------------------------------------------------
A0A5C5WTY6      ------------------------------------------------------------
A0A5C5Y033      ------------------------------------------------------------
A0A5C6G1Y2      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
A0A5C6FZ02      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
A0A5M6CY44      ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A5C6FFI9      ------------------------------------------------------------
A0A5C5WDJ1      ------------------------------------------------------------
A0A5C5X547      ------------------------------------------------------------
A0A353FIP5      ------------------------------------------------------------
A0A7V7MJI7      ------------------------------------------------------------
A0A5B1CIK7      ------------------------------------------------------------
A0A5C5WHS2      ------------------------------------------------------------
A0A5C6B6G8      ------------------------------------------------------------
A0A5C5ZZN3      ------------------------------------------------------------
A0A5C5XS91      ------------------------------------------------------------
A0A5C6C4E6      ------------------------------------------------------------
A0A2E1VVJ1      ------------------------------------------------------------
A0A3M2AEL0      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A518HKC1      ------------------------------------------------------------
A0A518L3P0      ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A5B9MKP1      ------------------------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
A0A532UT69      ------------------------------------------------------------
A0A7V9G2R2      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A7X7U1J4      ------------------------------------------------------------
A0A7V8E5N8      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A7Y5LV28      ------------------------------------------------------------
A0A7Y5HFQ5      ------------------------------------------------------------
A0A7W1FMQ9      ------------------------------------------------------------
A0A7W1NA62      ------------------------------------------------------------
A0A7V9JTP9      ------------------------------------------------------------
A0A7W1FJ38      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
A0A7V2H881      ------------------------------------------------------------
A0A7C4EK84      ------------------------------------------------------------
A0A7C3F0T2      ------------------------------------------------------------
A0A7X7U4K9      ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A838QZ11      ------------------------------------------------------------
A0A5C5YU10      ------------------------------------------------------------
A0A517MPZ6      ------------------------------------------------------------
A0A5C6CNV7      ------------------------------------------------------------
A0A518K5H4      ------------------------------------------------------------
A0A5C6AA28      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A7V2UF66      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
A0A5B9PJZ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A7C8AGA2      ------------------------------------------------------------
A0A7C2FXP7      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A7X8IIB9      ------------------------------------------------------------
A0A532UD06      ------------------------------------------------------------
A0A660URN1      ------------------------------------------------------------
A0A517ZCB5      ------------------------------------------------------------
A0A225EH48      PA----------------------------------------------------------
A0A518INW8      ------------------------------------------------------------
A0A518JPH9      ------------------------------------------------------------
A0A5C5VEK8      ------------------------------------------------------------
A0A532UTJ0      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A518AAQ5      ------------------------------------------------------------
A0A517QBG9      ------------------------------------------------------------
A0A518FTU3      ------------------------------------------------------------
A0A517WHH5      ------------------------------------------------------------
A0A5A8BGT3      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A517PTS5      ------------------------------------------------------------
A0A6I6AH34      ------------------------------------------------------------
A0A517VTK3      ------------------------------------------------------------
A0A517WQT4      ------------------------------------------------------------
A0A517VID8      ------------------------------------------------------------
A0A517RK10      ------------------------------------------------------------
A0A518IH18      ------------------------------------------------------------
A0A7W0M4Y4      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A5C5XLF4      ------------------------------------------------------------
A0A518CHE5      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A517NSK8      ------------------------------------------------------------
A0A5C5Z0D6      ------------------------------------------------------------
A0A7W5H7D9      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A7V4M591      ------------------------------------------------------------
A0A7X7F3G7      ------------------------------------------------------------
A0A7Y4VQ32      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A5C5ZM48      ------------------------------------------------------------
A0A5B9WF77      ------------------------------------------------------------
A0A7C4Z5R7      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A518ALT3      ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A7V3TZQ6      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A517TMV0      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A518BBX8      ------------------------------------------------------------
A0A5B9QF68      ------------------------------------------------------------
A0A5B9QGF0      ------------------------------------------------------------
A0A5C6CK24      ------------------------------------------------------------
A0A7C5FXU1      ------------------------------------------------------------
A0A847YFA1      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A518GJT2      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A5Q4GFE7      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A7C4LP10      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A517MLW3      ------------------------------------------------------------
A0A5B9QVD0      ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
A0A6M5Z0K7      ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A4P5WQK6      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A7Y5SKC2      ------------------------------------------------------------
A0A7X7U104      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A517MDV3      ------------------------------------------------------------
A0A518IQ30      ------------------------------------------------------------
A0A517LWP4      ------------------------------------------------------------
A0A518JNW8      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A5C5XLM3      ------------------------------------------------------------
A0A7V2UW16      ------------------------------------------------------------
A0A518DRX3      A-----------------------------------------------------------
A0A518DZF9      AA----------------------------------------------------------
A0A2E7ENQ5      AA----------------------------------------------------------
A0A7V2XSV8      ------------------------------------------------------------
A0A847GXG1      AA----------------------------------------------------------
A0A7C5BZF0      VA----------------------------------------------------------
A0A847YGH5      VA----------------------------------------------------------
A0A286RLF2      VA----------------------------------------------------------
A0A7V3TX18      VA----------------------------------------------------------
A0A1G3AQE9      VA----------------------------------------------------------
A0A3L7UQT9      AA----------------------------------------------------------
A0A4P5YBU2      AA----------------------------------------------------------
A0A7C7V5U8      VG----------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A518AKT8      ------------------------------------------------------------
A0A5C5ZR72      ------------------------------------------------------------
A0A7Y5SJZ4      ------------------------------------------------------------
A0A5C5V7Z9      ------------------------------------------------------------
A0A5C5YT05      ------------------------------------------------------------
A0A518D7F9      ------------------------------------------------------------
A0A5C5ZIP0      ------------------------------------------------------------
A0A518KBK3      ------------------------------------------------------------
A0A5C6AKF9      ------------------------------------------------------------
A0A7C2KUQ9      ------------------------------------------------------------
A0A7C5R0U3      ------------------------------------------------------------
A0A847YCQ7      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A7V3TUJ6      ------------------------------------------------------------
A0A517TY85      ------------------------------------------------------------
A0A5B9QEI7      ------------------------------------------------------------
                                                                            

A0A5S9IPR9      -----------
A0A533Q9U4      -----------
A0A533Q6B7      -----------
A0A1U9NNE1      -----------
A0A2G2JCA2      -----------
A0A1G2XVR0      -----------
A0A1G3B0P0      -----------
A0A1E3X4X0      -----------
A0A286U4B3      -----------
A0A5C6DDS2      -----------
A0A5S9IJB5      -----------
A0A2E3GW02      -----------
A0A5B9QNZ7      -----------
A0A1Z8N7H5      -----------
A0A1U7CZ81      -----------
A0A142YNY8      -----------
A0A1U7GLS6      -----------
A0A1G2YPI3      -----------
A0A532UIN2      -----------
A0A0S8KNX5      -----------
A0A3D3UVZ8      -----------
A0A517NFU9      -----------
A0A5C5YWH4      -----------
A0A3D2TNK4      -----------
A0A7C1Y4F0      -----------
A0A6I0ENW6      -----------
A0A6L3A0B7      -----------
A0A0J1B4A0      -----------
A0A142WSB9      -----------
M5SZR3          -----------
M5TW92          -----------
A0A2S8FKY2      -----------
A0A517N8P6      -----------
A0A432MJP4      -----------
M5UQ35          -----------
A0A0S8FY64      SVEGPTGNRAG
A0A1N6KFT7      -----------
L0DFG4          -----------
A0A5C5XXG1      -----------
A0A7C7YUM8      -----------
A0A7C2AHI6      -----------
A0A518BJJ1      -----------
A0A518D182      -----------
A0A7V4HWU2      -----------
A0A5C5WTY6      -----------
A0A5C5Y033      -----------
A0A5C6G1Y2      -----------
A0A354PDV6      -----------
A0A5C6FZ02      -----------
M5TIT3          -----------
A0A5M6CY44      -----------
F2AXG2          -----------
M2BB46          -----------
L7CLQ6          -----------
A0A0J1B719      -----------
Q7UF18          -----------
A0A2G1W1E0      -----------
K5E235          -----------
A0A5C6FFI9      -----------
A0A5C5WDJ1      -----------
A0A5C5X547      -----------
A0A353FIP5      -----------
A0A7V7MJI7      -----------
A0A5B1CIK7      -----------
A0A5C5WHS2      -----------
A0A5C6B6G8      -----------
A0A5C5ZZN3      -----------
A0A5C5XS91      -----------
A0A5C6C4E6      -----------
A0A2E1VVJ1      -----------
A0A3M2AEL0      -----------
A0A2A2W9R6      -----------
A0A518HKC1      -----------
A0A518L3P0      -----------
A0A255R1S0      -----------
A0A5B9MKP1      -----------
A0A351FYP6      -----------
A0A0S8J591      -----------
A0A532UT69      -----------
A0A7V9G2R2      -----------
A0A2D5AWU0      -----------
L0DC26          -----------
M5RT57          -----------
D5SZ21          -----------
A0A7X7U1J4      -----------
A0A7V8E5N8      -----------
A0A356KTN1      -----------
A0A7Y5LV28      -----------
A0A7Y5HFQ5      -----------
A0A7W1FMQ9      -----------
A0A7W1NA62      -----------
A0A7V9JTP9      -----------
A0A7W1FJ38      -----------
A0A1G2YQB7      -----------
A0A353P687      -----------
A0A356EME5      -----------
A0A3L7P4E4      -----------
A0A3L7PEB5      -----------
A0A1U9NL64      -----------
A0A2N1UCJ3      -----------
A0A7V2H881      -----------
A0A7C4EK84      -----------
A0A7C3F0T2      -----------
A0A7X7U4K9      -----------
A0A2E0X4J3      -----------
A0A838QZ11      -----------
A0A5C5YU10      -----------
A0A517MPZ6      -----------
A0A5C6CNV7      -----------
A0A518K5H4      -----------
A0A5C6AA28      -----------
A0A2E7ESJ6      -----------
A0A2E9VK20      -----------
A0A3D4PJK1      -----------
A0A355AI52      -----------
A0A354PCQ3      -----------
A0A0S8GZ23      -----------
A0A1I3DDV4      -----------
A0A7V2UF66      -----------
A0A2E0SMM6      -----------
A0A3L7SI46      -----------
A0A5B9PJZ8      -----------
A0A2S8G191      -----------
A0A2E7EGG1      -----------
A0A2E2N5A9      -----------
A0A7C8AGA2      -----------
A0A7C2FXP7      -----------
A0A1P8WP26      -----------
A0A3L7V1F3      -----------
A0A2E3GWC6      -----------
F0SLB0          -----------
A0A3L7NDH9      -----------
A0A7X8IIB9      -----------
A0A532UD06      -----------
A0A660URN1      -----------
A0A517ZCB5      -----------
A0A225EH48      -----------
A0A518INW8      -----------
A0A518JPH9      -----------
A0A5C5VEK8      -----------
A0A532UTJ0      -----------
A0A2E2CCW9      -----------
A0A3C0AGX3      -----------
A0A518AAQ5      -----------
A0A517QBG9      -----------
A0A518FTU3      -----------
A0A517WHH5      -----------
A0A5A8BGT3      -----------
A0A2E7K7A9      -----------
A0A517PTS5      -----------
A0A6I6AH34      -----------
A0A517VTK3      -----------
A0A517WQT4      -----------
A0A517VID8      -----------
A0A517RK10      -----------
A0A518IH18      -----------
A0A7W0M4Y4      -----------
A0A2D5NDU9      -----------
A0A5C5XLF4      -----------
A0A518CHE5      -----------
A0A1V5N3W2      -----------
A0A517NSK8      -----------
A0A5C5Z0D6      -----------
A0A7W5H7D9      -----------
M5UE94          -----------
A0A3E0MY27      -----------
A0A7V4M591      -----------
A0A7X7F3G7      -----------
A0A7Y4VQ32      -----------
A0A2E0X9P6      -----------
A0A1N6DAJ8      -----------
A0A2E8FLY0      -----------
A0A3D2U1E1      -----------
E8R3W3          -----------
A0A5C5ZM48      -----------
A0A5B9WF77      -----------
A0A7C4Z5R7      -----------
A0A1P8WN28      -----------
A0A3B9CTT0      -----------
A0A518ALT3      -----------
A0A286RGB6      -----------
A0A7V3TZQ6      -----------
A0A3M1QRP3      -----------
A0A517TMV0      -----------
A0A3E0MY88      -----------
A0A518BBX8      -----------
A0A5B9QF68      -----------
A0A5B9QGF0      -----------
A0A5C6CK24      -----------
A0A7C5FXU1      -----------
A0A847YFA1      -----------
A0A1C3E6N1      -----------
A0A518GJT2      -----------
A0A2E8B0L9      -----------
A0A5Q4GFE7      -----------
A0A257WS34      -----------
A0A7C4LP10      -----------
A0A2E3RCU8      -----------
A0A517MLW3      -----------
A0A5B9QVD0      -----------
A0A3A0DET7      -----------
A0A3B8PNV4      -----------
A0A3D1DR40      -----------
A0A2E7RYU8      -----------
A0A3B8LXG8      -----------
A0A6M5Z0K7      -----------
A0A350CI62      -----------
A0A4P5WQK6      -----------
A0A3C1X4W5      -----------
A0A3D3W3A7      -----------
A0A7Y5SKC2      -----------
A0A7X7U104      -----------
F0SI78          -----------
A0A517MDV3      -----------
A0A518IQ30      -----------
A0A517LWP4      -----------
A0A518JNW8      -----------
A0A2E3GWX1      -----------
F0SG60          -----------
A0A2E9VST2      -----------
A0A356A6X2      -----------
A0A5C5XLM3      -----------
A0A7V2UW16      -----------
A0A518DRX3      -----------
A0A518DZF9      -----------
A0A2E7ENQ5      -----------
A0A7V2XSV8      -----------
A0A847GXG1      -----------
A0A7C5BZF0      -----------
A0A847YGH5      -----------
A0A286RLF2      -----------
A0A7V3TX18      -----------
A0A1G3AQE9      -----------
A0A3L7UQT9      -----------
A0A4P5YBU2      -----------
A0A7C7V5U8      -----------
A0A3M1VCL4      -----------
A0A518AKT8      -----------
A0A5C5ZR72      -----------
A0A7Y5SJZ4      -----------
A0A5C5V7Z9      -----------
A0A5C5YT05      -----------
A0A518D7F9      -----------
A0A5C5ZIP0      -----------
A0A518KBK3      -----------
A0A5C6AKF9      -----------
A0A7C2KUQ9      -----------
A0A7C5R0U3      -----------
A0A847YCQ7      -----------
A0A286RD13      -----------
A0A7V3TUJ6      -----------
A0A517TY85      -----------
A0A5B9QEI7      -----------
                           

© 1998-2022Legal notice